CLUSTAL format seed alignment for MF_00160

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SERC_PSEAE      -----------MSKRAFNFCAGPAALPDAVLQRAQAELLDWRGKGLSVMEMSHRSDDYVA
SERC_PSEPK      -----------MSKRAFNFCAGPAALPDAVLQRAQAEMLDWRGKGLSVMEMSHRSDDYVA
SERC_PSEST      -----------MSKRAFNFCAGPAALPEAVLQRAQAELLDWQGRGLSVMEMSHRSDAYVA
SERC_PSESM      -----------MSKRAFNFCAGPAALPEAVLLRAQAELLDWHGKGLSVMEMSHRSDEFVS
SERC_ACIAD      -------------MRAYNFCAGPAALPTAVLEKAQQELLDWQGKGLSIMEMSHRSKDYVA
SERC_CHRVO      ------------MAKVYNFSAGPAVLPHQVLAEAQSELLDWHGSGMSVMEMSHRGKEFME
SERC_NITEU      ------------MRKIYNFSAGPAVLPEEVLEQAREEMLDWHGSGMSVMEMSHRGKEFMS
SERC_BORBR      -----------MMARPWNFSAGPSALPEAVLQQAAAEMLDWHGSGMSVMEMSHRGKHFVQ
SERC_BORPA      -----------MMARPWNFSAGPSALPEAVLQQAAAEMLDWHGSGMSVMEMSHRGKHFVQ
SERC_BORPE      -----------MMARPWNFSAGPSALPEAVLQQAAAEMLDWHGSGMSVMEMSHRGKHFVQ
SERC_RALSO      -MNQADRALQASQARVYNFSAGPAVLPTEVLEQAREEMLSWQGSGMSVMEMSHRGREFES
SERC_AROAE      ------------MTRVYNFSAGPAALPEAVLQQAAEEMLDWQGAGCGVMEMSHRGKEFTS
SERC_NEIMA      ----------MSLYPIYNFSAGPAVLPEAVLETARQEMLDYNGTGFPVMAMSHRSEMFLS
SERC_NEIMB      ----------MSLYPIYNFSAGPAVLPEAVLETARQEMLDYNGTGFPVMAMSHRSEMFLS
SERC_NEIG1      ----------MSLYPIYNFSAGPAVLPEAVLRTAQQEMSDYNGTGFSVMEMSHRSEMFLS
SERC_XANAC      ------------MTRAFNFSAGPATLPESVLRQAQAEMVEWNGVGASIVEISHRSADFMA
SERC_XANOR      ------------MTRAFNFSAGPATLPESVLRQAQAEMVEWNGVGASIVEISHRSADFMA
SERC_XANCP      ------------MTRAFNFSAGPATLPESVLRQAQEEMVEWNGVGASIVEISHRSADFMA
SERC_XYLFA      -----------MTMRIFNFSPGPATLPEPVLRQAQDEMLEWNAVGASVMEISHRTVEFME
SERC_XYLFT      -----------MTMRIFNFSPGPATLPEPVLRQAQAEMLEWNAVGASVMEISHRSAEFIA
SERC_ECOLI      ------------MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQ
SERC_SHIFL      ------------MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQ
SERC_ECO57      ------------MAQIFNFSSGPAMLPVEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQ
SERC_ECOL6      ------------MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQ
SERC_SALCH      ------------MAQVFNFSSGPAMLPAEVLKLAQQELRDWHGLGTSVMEISHRGKEFIQ
SERC_SALTY      ------------MAQVFNFSSGPAMLPAEVLKLAQQELCDWHGLGTSVMEISHRGKEFIQ
SERC_SALGL      ------------MAQVFNFSSGPAMLPAEVLKLAQQELRDWHGLGTSVMEISHRGKEFIQ
SERC_SALTI      ------------MAQVFNFSSGPAMLPAEVLKLAQQELRDWHGLGTSVMEISHRGKEFIQ
SERC_YERPE      ------------MTQVYNFSAGPAMLPVEVLRRAEQELRNWHGLGTSVMEISHRSKEFMQ
SERC_YERPS      ------------MTQVYNFSAGPAMLPVEVLRRAEQELRNWHGLGTSVMEISHRSKEFMQ
SERC_YERE8      ------------MTQVYNFSAGPAMLPVEVLRRAEQELRNWHGLGTSVMEISHRSKEFMQ
SERC_PECAS      ------------MTQIFNFSAGPAMLPVEVLRRAEQELCNWNGLGTSVMEISHRSKEFMQ
SERC_PHOLL      ------------MNQVYNFSSGPAMLPVEVLRRAEQELCNWHGIGTSIMEISHRGKEFIA
SERC_XENNA      ------------MNQVYNFSAGPAMLPAEVLRRAEQELCNWHGLGTSVMEISHRSKEFIA
SERC_VIBVU      --------MEQNTDNVFNFSAGPAALPKPVMQQAQQELLNWQGLGTSVMEISHRSKEFIA
SERC_VIBVY      --------MEQNTDNVFNFSAGPAALPKPVMQQAQQELLNWQGLGTSVMEISHRSKEFIA
SERC_VIBPA      --------MEQNTDNVFNFSAGPAALPKAVMQQAQQELIDWQGLGTSVMEISHRSKEFIK
SERC_VIBCH      --------MEHNTDTVYNFSAGPAALPKAVMLQAQAEFVNWNHLGTSVMEISHRSQPFIQ
SERC_ALIF1      ------------MEKVFNFCAGPAMLPVDVLAQAQKELVNWNGLGTSVMEISHRSKEFIK
SERC_PHOPR      ------------MEKVYNFCAGPAMIPAEVLKKVQEELVNWNGLGTSVMEISHRSKEFLA
SERC_SHEON      ------------MSAIYNFCAGPAMLPAAVMKKAQQELLDWNGLGVSVMEVSHRGKEFIA
SERC_IDILO      ------------MSQLFNFSAGPAMLPVDVLKQAQEELLNWNGQGVSVMEISHRDPVYVH
SERC_BLOFL      ------------MKKIFNFSAGPSMLPKQVLNQIQQELYDWNNLGISIMEISHRSLEFME
SERC_BUCBP      -------MIMNDTTKVYNFSAGPAMIPREVLCQVKRELYNWKNLKKSIMEISHRSQEFIS
SERC_WIGBR      ------------MKDIFNFGSGPSMLPKIVLKKIKRDLFNWKNTNVSVMEISHRNKNFLK
SERC_BUCAI      ------------MNLIYNFSAGPAMIPRDVLNQAKKELHNWKNLGSSIMEISHRSEEFIQ
SERC_BUCAP      ------------MNLIYNFSAGPAMIPKDVLYQAKKELQNWNQIGCSIMEISHRSKEFIQ
SERC_HAEIN      ------------MSQVFNFSAGPAMIFPEVLQKAQNELINWLNQGVSVMEVSHRGKYFME
SERC_PASMU      ------------MSKVFNFSAGPAMMPEAVLAQAQAELLNWQEQQTSVMEVSHRGKLFMA
SERC_MANSM      ------------MSNVFNFSAGPAMMPPAVLKKAQEELLNWQGQGTSVMEVSHRGKYFME
SERC_HAEDU      ------------MKHVYNFSAGPAMMPKAVLAQAQQELLNWQQQGTSVMEVSHRSNAFMA
SERC_LEGPH      -----------MNSRVFNFGAGPAMLPEEILKEAQEEFLNWRNTGMSILEIGHRTPEIIS
SERC_LEGPL      -----------MNSRVFNFGAGPAMLPEEILKEAQEEFLNWRNTGMSILEIGHRTPEIIS
SERC_LEGPA      -----------MNSRVFNFGAGPAMLPEEILKEAQEEFLNWRNTGMSILEIGHRTPEIIN
SERC_COXBU      ------------MSRVYNFSAGPAAIPEEVLFTVRDELLDWHGIGMSIAEVSHRGEEFIG
SERC_BACCZ      ------------MERVYNFSAGPSILPLPVLEKVQKELVNYNGTGMSIMEMSHRSSYFQS
SERC_BACHK      ------------MERVYNFSAGPSILPLPVLEKVQKELVNYNGTGMSIMEMSHRSSYFQS
SERC_BACC1      ------------MERVYNFSAGPSILPLPVLEKVQKELVNYNGTGMSIMEMSHRSSYFQS
SERC_BACCR      ------------MERVYNFSAGPSILPLPVLEKVQKELLNYNGTGMSIMEMSHRSSYFQS
SERC_STRT1      -------------MTIYNFSAGPATLPKPVLEKAQAELLNYQDSGMSVLEMSHRSPEFDK
SERC_STRT2      -------------MTIYNFSAGPATLPKPVLEKAQAELLNYQDSGMSVLEMSHRSPEFDK
SERC_STRMU      -------------MTIYNFSAGPAVLPKPVLEKAQTEFLDYNHSGMSVMELSHRSKDFDD
SERC_STRA3      -------------MTIYNFSAGPAVLPKPVLVKAQSELLNYQGSSMSVLEVSHRSKEFDD
SERC_LACLA      --------------MIYNFGAGPSVLPKEVLKKVQEELLDFEKSGMSVMEISHRSKAFQK
SERC_LISMF      ------------MERVYNFSAGPAVLPVPVLEKVQRELLSYNGSGMSVMELSHRSELFQN
SERC_LISMO      ------------MERVYNFSAGPAVLPVPVLEKVQRELLSYNGSGMSVMELSHRSELFQN
SERC_LISIN      ------------MERVYNFSAGPAVLPVPVLEKVQRELLSYNGSGMSVMELSHRSELFQN
SERC_LACPL      -------------MPIYNFSAGPAVLPQPVITQIQAELPSFRDSGMSILEISHRSDLFAQ
SERC_LEPIC      --------MYLFQERIYNFGAGPAMLPNEVMEIAAAEFLNYKGSGMSVMEVSHREPLFED
SERC_LEPIN      --------MYLFQERIYNFGAGPAMLPNEVMEIAAAEFLNYKGSGMSVMEVSHREPLFED
SERC_DESPS      -----------MADRVYNFSAGPATLPFEVLEQAGKDIVNFKETGSGLIEISHRSPEFIE
SERC_RHOBA      MQSTSAQSSASHPERVFNFSAGPATMPESVLREVQDEMLCYPGAGASIMEISHRDKLFVD
SERC_ALKHC      ------------MKRAYNFNAGPSALPTEVLEKAQSELLDFENTGMSVMELSHRSKEYEN
SERC_GEOKA      ------------MKRAYNFNAGPSALPLPVLERAQKELLNFQNTGMSVMELSHRSKEYEA
SERC_BACSU      ------------MERTTNFNAGPAALPLEVLQKAQKEFIDFNESGMSVMELSHRSKEYEA
SERC_BACSK      ------------MNDVHNFNAGPAALPKQALERAQKELVNFDGTGMSVMELSHRGDTYDR
SERC_BACCI      -----------MSKRAYNFNAGPAALPLEVLERAQAEFVDYQHTGMSIMEMSHRGAVYEA
SERC_BACFN      -------------MKKHNFSAGPSILPREVIEETAKAILDFNGSGLSVLEVSHRGKDFQA
SERC_BACFR      -------------MKKHNFSAGPSILPREVIEETAKAILDFNGSGLSVLEVSHRGKDFQA
SERC_BACTN      -------------MKKHNFNAGPSILPREVIEDTAKAILDFNGSGLSLMEISHRAKDFQP
SERC_PORGI      -------------MKKHNFTAGPCILNDLVLKDAASACLNFAGTGLSVLEVSHRDKEFDA
SERC_CAMJE      -------------MRKINFSAGPSTLPLEILEQAQKELCDYQGRGYSIMEISHRTKVFEE
SERC_CAMJR      -------------MRKINFSAGPSTLPLEILEQAQKELCDYQGRGYSIMEISHRTKVFEE
SERC_MYCA1      ------MSMADQLQIPADIKPRDGRFGCGPSKVRPEQLQALSTTAAPLFGTSHRQAPVKN
SERC_MYCPA      ------MSMADQLQIPADIKPRDGRFGCGPSKVRPEQLQALSTTAAPLFGTSHRQAPVKN
SERC_MYCBO      ----MADQLTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKN
SERC_MYCTU      ----MADQLTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKN
SERC_MYCLE      ----MADQLTPSLDIPAALKPRDGRFGSGPSKVRPEQLQALTNTAATLFGTSHRQAPVKN
SERC_MYCSJ      --------MAE-LTIPADLKPRDGRFGSGPSKVRPEQLQALA-AAGDLFGTSHRQAPVKN
SERC_MYCSK      --------MAE-LTIPADLKPRDGRFGSGPSKVRPEQLQALA-AAGDLFGTSHRQAPVKN
SERC_MYCSS      --------MAE-LTIPADLKPRDGRFGSGPSKVRPEQLQALA-AAGDLFGTSHRQAPVKN
SERC_MYCVP      --------MAENLEIPADLKPADGRFGCGPSKVRPEQLKALA-ASGDLFGTSHRQAPVKN
SERC_METAC      --------------MKPTRVPKNPCFSSGPCAKHPG--YSVEELKDTPFGRSHRSKPGKE
SERC_METBF      --------------MKPTRVPNNPCFSSGPCAKHPG--YSIEELKDTPFGRSHRSNLGKE
SERC_METMA      --------------MKPTRVPKNPCFSSGPCAKHPG--YSIEDLNDAPFGRSHRSKPGKE
                                    .    :                         .**      

SERC_PSEAE      IASKAEQDLRDLLDIPSDYKVLFLQGGASQQFAEIPLNLLPEDG--------VADYIDTG
SERC_PSEPK      IAEKAEQDLRDLLSVPSNYKVLFLQGGASQQFAEIPLNLLPENG--------TADYIETG
SERC_PSEST      IAEKAEQDLRDLMAIPSDYKVLFLQGGASQQFAEIPLNLLPEGG--------VADYVDTG
SERC_PSESM      IANKAEQDLRDLLSIPSNYKVLFLQGGASQQFAQIALNLLPENG--------KADYIDTG
SERC_ACIAD      VAEKAEADLRKLMNIPENYQVLFLQGGASLQFSAIPMNLLGKNS--------KADYIHTG
SERC_CHRVO      IIHDAEQDLRQLMGIPAGYKVLFLQGGASLQFAMAPLNLLGDKD--------SIDIVNTG
SERC_NITEU      IADETESALRELAGIPDHYKVLFLQGGASSQFAMVPMNLLGKKG--------KADYVNTG
SERC_BORBR      ICDEAEADLRELLGLPADYAVMFMQGGGLGENAIVPMNLMGRRS------TPAADFVVTG
SERC_BORPA      ICDEAEADLRELLGLPADYAVMFMQGGGLGENAIVPMNLMGRRS------TPAADFVVTG
SERC_BORPE      ICDEAEADLRELLGLPADYAVMFMQGGGLGENAIVPMNLMGRRS------TPAADFVVTG
SERC_RALSO      IMAQAFADLRELLAVPDNYEILFLQGGAIAENAIVPLNLMRRLSLD----APKADYVVTG
SERC_AROAE      IVAQAEADLRELLAIPDNYRVLFLQGGATQQFAQIPMNLLAGGS---------ADYLVTG
SERC_NEIMA      ILHHAEQDLRQLLKVPDNYKILFLQGGATTQFNMAAMNLAHGFR--------TADAVVTG
SERC_NEIMB      ILHHAEQDLRQLLKVPDNYKILFLQGGATTQFNMAAMNLAHGFR--------TADAVVTG
SERC_NEIG1      ILHHAEQDLRQLLKVPDNYKILFLQGGATTQFNMAAMNLAHGFR--------TADAVVTG
SERC_XANAC      VAAAAEADLRSLLSIPDDYAVLFTAGGATTIQALLPLNFAAPGQ--------AADYVITG
SERC_XANOR      VAAAAEADLRSLLSIPDDYAVMFTAGGATTIQALLPLNFAAPGQ--------AADYVITG
SERC_XANCP      VAAAAEADLRTLLSIPDDYAVLFTSGGATTIQALLPLNFAAPGQ--------AVDYVVSG
SERC_XYLFA      LAKGIESDLRCLLGVPDDYAVLFLSGGATTQQALLPLNFAAPGQ--------TADYVVTG
SERC_XYLFT      LAKGIESDLRCLLGVPDDYAVLFLSGGATTQQALLPLNFAAPGQ--------TADYVVTG
SERC_ECOLI      VAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKT--TA------DYVDAG
SERC_SHIFL      VAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKT--TA------DYVDAG
SERC_ECO57      VAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKT--TA------DYVDAG
SERC_ECOL6      VAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKT--TA------DYVDAG
SERC_SALCH      VAEEAEQDFRDLLNIPSNYKVLFCHGGGRGQFAGVPLNLLGDKT--TA------DYVDAG
SERC_SALTY      VAEEAEQDFRDLLNIPSNYKVLFCHGGGRGQFAGVPLNLLGDKT--TA------DYVDAG
SERC_SALGL      VAEEAEQDFRDLLNIPSNYKVLFCHGGGRGQFAGVPLNLLGDKT--TA------DYVDAG
SERC_SALTI      VAEEAEQDFRDLLNIPSNYKVLFCHGGGRGQFAGVPLNLLGDKT--TA------DYVDAG
SERC_YERPE      VAEESEKDLRDLLQIPANYKVLFCHGGARAQFAAVPLNLLGDRN--SA------DYIDGG
SERC_YERPS      VAEESEKDLRDLLQIPANYKVLFCHGGARAQFAAVPLNLLGDSN--SA------DYIDGG
SERC_YERE8      VAEEAEKDLRDLMQIPANYKVLFCHGGARAQFAAVPLNLLGDSR--SA------DYIDGG
SERC_PECAS      VAAESEQDLRDLLKIPSNYKVLFCHGGARAQFAAVPLNLLGERS--TA------DYIDGG
SERC_PHOLL      VAKEAENDLRDLLSVPENYKVLFCHGGARGQFAAIPMNLLGDKV--KA------DYIDGG
SERC_XENNA      VAAEAEKDLRDLLAIPENYNVLFCHGGARGQFSALPQNLLGDKS--TA------DYIVSG
SERC_VIBVU      VAEQSEQDLRDLLNIPDNYKVLFCQGGARAQFAAVPLNLLGDAT--TA------TYIDAG
SERC_VIBVY      VAEQSEQDLRDLLNIPDNYKVLFCQGGARAQFAAVPLNLLGDAT--TA------TYIDAG
SERC_VIBPA      VAQEAEQDLRDLLNIPDNYKVLFCQGGARAQFAAVPLNLLGDAE--TA------TYIDGG
SERC_VIBCH      VAEHAERDLRDLLNIPDNYKVLFCQGGARAQFAAVPLNLLGDAE--TA------TYIDAG
SERC_ALIF1      VAEESEQDLRDLLAIPDNYKVLFCQGGARAQFAAVPLNLLGGNT--KA------DYVDAG
SERC_PHOPR      VAKQSEKDLRELLSIPSNYHVLFCHGGARGQFAAVPMNLLGDAN--TA------DYMDGG
SERC_SHEON      LTKQAEADLRELMHIPQNYHVLFMHGGGRGQFSAVVNNFLGNQG--RA------LYLVSG
SERC_IDILO      MAREAEQDLRDLLNVPDDYEVLFLQGGGRGQFSAVPQNIASPDA--TV------DYLDTG
SERC_BLOFL      LVHDTKRNLRNLLNIPNSYEILFCHGGARAQFSAIPMNFLRGSA--DN-----IDYINTG
SERC_BUCBP      VVQEIKHNLRKLLHIPNSYKIVFCHGGARGQFSAIPMNFSKNAN--HSSHNNVVDYINSG
SERC_WIGBR      VIENIKNDIKFLLSVSNDYNIILLQGGARAQFSGIPMNLTNNFS--DL-----ADYINTG
SERC_BUCAI      MALEAEKDLRDLLKIPDSFKVLFCQGGARGQFSAIPMNLLNNLQ--TA------DYINSG
SERC_BUCAP      VALEAEQDLRDLLNISNSYEILFCQGGARGQFAAVPMNLLGNFK--ET------DYINSG
SERC_HAEIN      LVTQAEKDLREVYNIPDNYRTLFLQGGARGQFATIPMNLIGKKG--KA------LYLNSG
SERC_PASMU      LASQSELDLRQLYQIPDNYRILFLQGGARGQFAAIPMNLLKEKG--KA------LYLTSG
SERC_MANSM      LITQADKDFRELYNIPENYKILFLQGGARGQFAAIPMNLANNKG--KA------LYLNTG
SERC_HAEDU      LATQTEQDLRQLYAIPDNYKVLFLQGGAHGQFAAIPMNLIGKKG--KA------LYLISG
SERC_LEGPH      LLSTAEQSLRELLNIPKNYHVLFLGGAARAQFAMIPMNLLRPGD--DA------AYFITG
SERC_LEGPL      LLSTAEQSLRELLNIPKNYHVLFLGGAARTQFAMIPMNLLRPGD--DA------AYFITG
SERC_LEGPA      LLSTAEQSLRELLNIPKNYHVLFLGGAARAQFAMIPMNLLQPGD--EA------AYFITG
SERC_COXBU      VAEEAERDLRELLAVPESYHILFLQGGSRLQFDMVPMNLLANHK--KA------VYIDSG
SERC_BACCZ      IIDEASNLLRELMNIPNEYDVLFLQGGASLQFSMIPLNLMNTYKK--------AGYVLTG
SERC_BACHK      IIDEAGSLLRELMNIPDEYEVLFLQGGASLQFSMIPLNLMNTYKK--------AGYVLTG
SERC_BACC1      IIDEAGSLLRELMNIPDEYEVLFLQGGASLQFSMIPLNVMNTYKK--------AGYILTG
SERC_BACCR      IIEEASNLLRELMSIPDEYEVLFLQGGASLQFSMIPLNLMNTYKK--------AGYVLTG
SERC_STRT1      IIKDAEATLRELMAIPDNYKVIFLQGGASTQFTMVPLNLAQG-KK--------AYYLVGG
SERC_STRT2      IIKDAEATLRELMAIPDNYKVIFLQGGASTQFTMVPLNLAQG-KK--------AYYLVGG
SERC_STRMU      IIKDAEKLLRDLMAIPDNYRVMFLQGGASLQFSMLPLNLAQG-RK--------AYYVVAG
SERC_STRA3      IIKGAERYLRDLMGIPDNYKVIFLQGGASLQFSMIPLNIARG-RK--------AYYHVAG
SERC_LACLA      VIDEAENDLRDLMSIPQNYKILFLQGGASSQFSMVPMNLAIG-KK--------AYYNISG
SERC_LISMF      ILDDAESLIRELMEIPENYKVLFLQGGASLQFDMVPMNLANG-KK--------AAYVNTG
SERC_LISMO      ILDDAESLIRELMEIPDNYKVLFLQGGASLQFDMVPMNLANG-KK--------AAYVNTG
SERC_LISIN      IIDDAESLIRELMGIPENYKVLFLQGGASLQFDMVPMNLANG-KK--------AVYVNTG
SERC_LACPL      VLQDAEQDLRDLMAIPDNYHVLFFQGGGTLQFTAAPLNLAPH-HR--------IGLLDSG
SERC_LEPIC      VITEAEILLRKLLNLGEDYSIAFFSGGATLHFSALPLNLLKEGES--------FDVAHTG
SERC_LEPIN      VITEAEILLRKLLNLGEDYSIAFFSGGATLHFSALPLNLLKEGES--------FDVAHTG
SERC_DESPS      VIEKTESLVRELLEVPDNYKVLFLQGGASSQFFMVPMNLL-GAGK-------KATYLNTG
SERC_RHOBA      VLHDAESTIRELLNVSDDYSVMFMQGGATLQFSAIPANLLRGSGK-------RAQYVLTG
SERC_ALKHC      VHHTAAQLLRDLLNIPEDYDVLFLQGGASLQFAMIPLNFLDEGKV--------ANYILTG
SERC_GEOKA      VHHAAKERLKRLLNVPDGYDILFLQGGASLQFSMVPMNLLTEGKI--------GCYVLTG
SERC_BACSU      VHQKAKSLLIELMGIPEDYDILFLQGGASLQFSMLPMNFLTPEKT--------AHFVMTG
SERC_BACSK      IHTHAIKKIRKLLDVPDDYHILFLQGGASLQFPMVPMNFLDSQ----------ATYILTG
SERC_BACCI      VHNEAQARLLALLGNPTGYKVLFIQGGASTQFAMIPMNFLKEGQT--------ANYVMTG
SERC_BACFN      VMDEAVALFKEILNIPEGYSVLFLGGGASMQFCMVPYNFLEKKA----------AYLNTG
SERC_BACFR      VMDEAVALFKEILNIPEGYSVLFLGGGASMQFCMVPYNFLEKKA----------AYLNTG
SERC_BACTN      VVDEAEALFKELLNIPEGYSVLFLGGGASMEFCMVPFNFLEKKA----------AYLNTG
SERC_PORGI      VMLEARNLFKELLDVPEGYEVLFLGGGASLQFYQVPLNLLKKKA----------AFINTG
SERC_CAMJE      VHFGAQEKAKKLYELNDDYEVLFLQGGASLQFAMIPMNLALNGVC---------EYANTG
SERC_CAMJR      VHFGAQEKAKKLYGLNDDYEVLFLQGGASLQFAMIPMNLALNGIC---------EYANTG
SERC_MYCA1      LVGRLRSGLAELFSLPDGYQVILGNGGATAFWDAAAFGLIDKRSLH----------LSYG
SERC_MYCPA      LVGRLRSGLAELFSLPDGYQVILGNGGATAFWDAAAFGLIDKRSLH----------LSYG
SERC_MYCBO      LVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLH----------LTYG
SERC_MYCTU      LVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLH----------LTYG
SERC_MYCLE      LVGRVRAGLAELFSLPDGYQVILGNGGATAFWDAAAFGLIDKRSLH----------LTYG
SERC_MYCSJ      LVGRVRDGIKQLFSVPEGYDVILGNGGSTAFWDAAAFGLIDKRSLH----------LTYG
SERC_MYCSK      LVGRVRDGIKQLFSVPEGYDVILGNGGSTAFWDAAAFGLIDKRSLH----------LTYG
SERC_MYCSS      LVGRVRDGIKQLFSVPEGYDVILGNGGSTAFWDAAAFGLIDKRSLH----------LTYG
SERC_MYCVP      LVGRVRDGLRQLFALPDGYEVILGNGGSTAFWDAAAFGLVDKRSLH----------LTYG
SERC_METAC      KLAEAIKRTRDMLGLPDDYFVGIVPASDTGAFEMCLWSMLGCRGVDV---------LVWE
SERC_METBF      KLAEAIKKTRDMLGLPDDYLVGIVPASDTGAFEMCLWSMLGCRGVDV---------LVWE
SERC_METMA      KLAEAIKRTRDMLGLPSDYLVGIVPASDTGAFEMCLWSMLGCRGVDV---------LVWE
                           :      :   :  ..          ..                     

SERC_PSEAE      IWSKKAIEEARRYG-----TVNVAASAKEYD---------YFAIPGQNEWTLT-KDAAYV
SERC_PSEPK      IWSKKAIEEARRFG-----NVNVAATAKPYD---------YLAIPGQNEWNLT-KNAAYV
SERC_PSEST      IWSRKSIEEARRFG-----NVNLAASAKPYD---------YFAISGQNDWQLS-DNAAYL
SERC_PSESM      IWSQKAIDEASRYG-----TINVAASAKAYD---------YFAIPGQNEWTLS-RDAAYV
SERC_ACIAD      IWSEKALKEAQRYG-----DINVIEAGTSIDG--------KLAIKNQSEWNLS-QDAAYV
SERC_CHRVO      HWSKLAIKEAKRYA-----KVNVVASSEDRN---------FCYVPEEAAWQRD-PNAAYL
SERC_NITEU      QWSAKAISEAKNYG-----SVQIAASSESDG---------FNSVPPLAQWHIS-PDAAYV
SERC_BORBR      HWSTRSHKEAGRYG-----DAQIAASAAEATEIDGQAQSSWTWLPPVDTWRVR-KDSAYL
SERC_BORPA      HWSTRSHKEAGRYG-----DAQIAASAAEATEIDGQAQSSWTWLPPVDTWRVR-KDSAYL
SERC_BORPE      HWSTRSHKEAGRYG-----DAQIAASAAEATEIDGQAQSSWTWLPPVDTWRVR-KDSAYL
SERC_RALSO      TWSVKSQQEARKYG-----EVNIAASSEAER---------FHRIPDVSAWKLS-DDAAYV
SERC_AROAE      SWSKKAYGEAKHLA-----GALGGAVRLAGS----TETAGFTRLLRTEELDLD-PRARYL
SERC_NEIMA      NWSRIAYEQMSRLT-----DTEIRLAAHGGE------QFDYLDLPPVETWDVA-PDSAFV
SERC_NEIMB      NWSRIAYEQMSRLT-----DTEIRLAAHGGE------QFDYLDLPPVETWDVA-PDSAFV
SERC_NEIG1      NWSRIAYEQMSRLT-----DTEIRLAAHGGE------QFDYLDLPPVETWDVA-PDSAFV
SERC_XANAC      HWGKTAIKQAATYV-----DARIAADAQAD---------GFVDIPAAASWTLS-PHSAYV
SERC_XANOR      HWGKTAIKQASPYV-----DARIAADAETG---------GFLDIPPAASWTLS-PHSAYV
SERC_XANCP      HWGKTAIKQATPYV-----DVRVAADGQPG---------GYVDIPPVASWTLS-PHAAYV
SERC_XYLFA      HWSKTALKQASPYV-----NINVVADGERG---------GFQHIPSRAGWRLS-KDAAYV
SERC_XYLFT      HWSKTALKQASPYV-----NINVVADGERD---------GFQDIPNRAGWRLS-KDAAYV
SERC_ECOLI      YWAASAIKEAKKYC-----TPNVFDAKVTVDG--------LRAVKPMREWQLS-DNAAYM
SERC_SHIFL      YWAASAIKEAKKYC-----TPNVFDAKVTVDG--------LRAVKPMREWQLS-DNAAYM
SERC_ECO57      YWAASAIKEAKKYC-----TPNVFDAKVTVDG--------LRAVKPMREWQLS-DNAAYM
SERC_ECOL6      YWAASAIKEAKKYC-----TPNVFDAKVTVDG--------LRAVKPMSEWQLS-DNAAYM
SERC_SALCH      YWAASAIKEAKKYC-----APQIIDAKITVDG--------KRAVKPMREWQLS-DNAAYL
SERC_SALTY      YWAASAIKEAKKYC-----APQIIDAKITVDG--------KRAVKPMREWQLS-DNAAYL
SERC_SALGL      YWAASAIKEAKKYC-----APQIIDAKITVDG--------KRAVKPMREWQLS-DNAAYL
SERC_SALTI      YWAASAIKEAKKYC-----APQIIDAKITVDG--------KRAVKPMREWQLS-DNAAYL
SERC_YERPE      YWAHSAIKEAQKYC-----TPNVIDVTTHDNG--------LTGIQPMKQWKLS-DNAAYV
SERC_YERPS      YWAHSAVKEAQKYC-----TPHVIDVTTHDNG--------LTGIQPMKQWKLS-DNAAYV
SERC_YERE8      YWAHSAVKEAQKYC-----TPNVIDVTTHDNG--------VTGIAPMKQWKLS-DNAAYV
SERC_PECAS      YWAHSAINEAEKYC-----TPNVIDVKTRIDD--------LRGIKPMREWKLS-DDAAFV
SERC_PHOLL      YWAACAVKEAKKYC-----TPNVINIKTEING--------LKSVKPMREWSLS-DDAAYV
SERC_XENNA      YWSECAAKEAEKYC-----TPNIIDIRSNTDG--------ITSVKPMNEWALS-SDAAYV
SERC_VIBVU      YWAESAVEEAKKYC-----QPDVFVAKAEKEG--------KQAVLPASEWQIH-PDAAYV
SERC_VIBVY      YWAESAVEEAKKYC-----QPDVFVAKAEKDG--------KQAVLPASEWQIH-PDAAYV
SERC_VIBPA      YWAESAVEEAKKYC-----EPDVFDAKTEIDG--------KVAVLPASEWKIA-PEAAYV
SERC_VIBCH      YWAMSAVKEAKKYC-----TVDVFDAKIEKEG--------KIAVLPASEWRIA-NNAAYV
SERC_ALIF1      YWAQSAVEEAQKYC-----TPNVINTIIDVDG--------KKAVQPASEWALS-DDAVYV
SERC_PHOPR      YWAHSAIAEAKKYC-----SPNAVDITCEREG--------KKAILPAREWSLS-DDAAFV
SERC_SHEON      QWSSAALAEAQKLA-----GDAQIDSLNIVEKHN-----CLNAVVLPDLHKID-ADYRYV
SERC_IDILO      IWSGFAIREAEKFV-----SKVNVAGQVQEGAK-------GKEIQSPENWKLS-ENAAYF
SERC_BLOFL      YWGYLAAIESKKYC-----HPNIINISSSKNEL--------RYIKPMSEWNIS-KNSTYI
SERC_BUCBP      YWSYSAALEAKKYC-----YTNILNVCKTNNKK--------QYILPMNTWEIN-DNSLYL
SERC_WIGBR      YWGMYAAIEAKKYC-----SVNIIDVIEKKDK---------LSILPMKNWNIS-KNSVYL
SERC_BUCAI      YWSNSAFMEAKKYC-----TPRSIFIRETNGVK--------ESLLPMHKWNIN-ENSAYI
SERC_BUCAP      YWSNCALIEAKKYC-----IPKNISVRQKKNGK--------SFLLKPSQWNIS-DNSAYI
SERC_HAEIN      HWSATAAKEARNFA-----EIDEITI--VEN--G-----EQTRITDLDFSHIA-DQYDYV
SERC_PASMU      HWSATAAKEARLFG-----DIDEVNI--LEE--G-----NELKIGQLDFSHIA-DQYDYV
SERC_MANSM      HWSATAAKEARNFT-----EVDELNI--TEQI-D-----GLTRVNRLDFSDIA-EQYDYV
SERC_HAEDU      HWSNRSAQEARNFC-----EVDQLNI--LTQDEA-----GVFSVNQTDFSDIA-EQYDYV
SERC_LEGPH      IWSKMAYHEANLLK-----KAYYLSSEEKEGF---------VSIPDYQKWELK-SNTAYV
SERC_LEGPL      IWSKMAYHEANLLK-----KAYYLSSEEKEGF---------VSIPDYQKWELK-SNTAYV
SERC_LEGPA      IWSKMAYHEANLLK-----QAYYLSNEEKEGF---------VSIPDYQKWELK-SNTPYV
SERC_COXBU      VWSNLAIREAKNYC-----DPHLATNAKELNY---------TGIPDQATWDMP-NEAAYF
SERC_BACCZ      SWSKKALQEAEKVG-----EVQVIASSENEK---------FTTIPKLDGLLGD-EKLDYV
SERC_BACHK      SWSKKALQEAEKVG-----EVQVIASSENEK---------FTTIPKLDGLLGN-EKLDYV
SERC_BACC1      SWSKKAMQEAEKVG-----EVQVIASSENEK---------FTTIPRLDGLLGD-EKLDYV
SERC_BACCR      SWSKKALQEAEKVG-----EVQVIASSEQEK---------FTTIPKLDGLLSD-EKLDYV
SERC_STRT1      SWGKKAYTEAVKLSKTIPFEPILLASSEDTV---------YDHIPSFDPSTID-PEAAYV
SERC_STRT2      SWGKKAYTEAVKLSKTIPFEPILLASSEDTV---------YDHIPSFDPSTID-PEAAYV
SERC_STRMU      SWGKKAYAEAVKLSKTIPFEPILLASSEETT---------YDHIPEIDSAKID-KDAAYV
SERC_STRA3      SWGKKAYTEAVKLSKTIPFEPILLASSEESV---------YDYIPEFDEKEID-PEAAYV
SERC_LACLA      AFGEKAYDEAVKLSHFLDLMAISLGSTKKDN---------YNHLLKIDKSKIDEKNGAYL
SERC_LISMF      SWAKKAISEAKKIQ---GVEVEVIASSEDRN---------FSYIPEIPTVSSD---AAYL
SERC_LISMO      SWAKKAISEAKKIQ---GVEVEVIASSEDRN---------FSYIPEIPTVSSD---VAYL
SERC_LISIN      SWAKKAISEAKKIQ---GVEVEVIASSEDRN---------FSYIPEIPTVSTD---AAYL
SERC_LACPL      HWAQRAADEAKRVG----TKVTILGSSAANH---------FNQLPTV-VQPID-QSLDYI
SERC_LEPIC      IWTKKAWEEGLKFN-----EVNVIYDSTNNH---------FTDVPVLTDSNLS-GKGKYL
SERC_LEPIN      IWTKKAWEEGLKFN-----EVNVIYDSTNNH---------FTDVPVLTDSNLS-GKGKYL
SERC_DESPS      TWAKKAIKEAQLFG-----DIDVAYSSEESI---------FNHVPANDAYQVA-EESEYL
SERC_RHOBA      SWGKKAVKEAKKEG-----DVDVLFDAAESN---------YDHIPSASDLACP-DDAAYM
SERC_ALKHC      SWSEKALKEAKFIG-----KTAIAGSTKESN---------YTFIPDISSLQYN-EHDSYV
SERC_GEOKA      AWSEKALKEAQKIG-----LTTVVASSKEAN---------YTYIPPLDDVQWP-KNAAYV
SERC_BACSU      AWSEKALAETKLFG-----NTSITATSETDN---------YSYIPEVD-LTDV-KDGAYL
SERC_BACSK      AWSEKALAEAKHFG-----KTVIGASGKDGN---------YKQIPALNQISEH-AQDSYV
SERC_BACCI      SWASKALKEAKLIG-----DTHVAASSEASN---------YMTLPKLQEIQLQ-DNAAYL
SERC_BACFN      VWAKKAMKEAKGF-----GEVVEVASSADAN---------YTFIPKDFTIPAD---ADYF
SERC_BACFR      VWAKKAMKEAKGF-----GEVVEVASSADAN---------YTFIPKDFTIPAD---ADYF
SERC_BACTN      VWAKKAMKEAKGF-----GEVVEVASSAEAT---------YTYIPKDYTIPAD---ADYF
SERC_PORGI      TWATNAIKQAKIMTQVYGGEVEVLASSEDKN---------FSYIPKDFVIPED---VDYF
SERC_CAMJE      VWTKKAIKEAQILG----VNVKTVASSEESN---------FDHIPRVEFSDNA----DYA
SERC_CAMJR      VWTKKAIKEAQILG----VNVKTVASSEESN---------FNHIPRVEFRDNA----DYA
SERC_MYCA1      EFSSKFAAAVAKNP----FVGDPVVIKSDAG-----------SAPEPQSDPSV----DLI
SERC_MYCPA      EFSSKFAAAVAKNP----FVGDPVVIKSDAG-----------SAPEPQSDPSV----DLI
SERC_MYCBO      EFSAKFASAVSKNP----FVGEPIIITSDPG-----------SAPEPQTDPSV----DVI
SERC_MYCTU      EFSAKFASAVSKNP----FVGEPIIITSDPG-----------SAPEPQTDPSV----DVI
SERC_MYCLE      EFSSKFASAVAKNP----FIDEPIVIKSDPG-----------SAPKPTGDPSV----DVI
SERC_MYCSJ      EFSAKFASAVAKNP----FVGDPIVVKADPG-----------SAPEPQSDPSV----DVI
SERC_MYCSK      EFSAKFASAVAKNP----FVGDPIVVKADPG-----------SAPEPQSDPSV----DVI
SERC_MYCSS      EFSAKFASAVAKNP----FVGDPIVVKADPG-----------SAPEPQSDPSV----DVI
SERC_MYCVP      EFSAKFASAVAKNP----FVGDPIIVKADAG-----------SAPKPQSDPSV----DVI
SERC_METAC      SFSKGWATDITKQL----KLKDTRVFEAEYG-----------KLPDLKKVDFK----NDV
SERC_METBF      SFSKGWATDITKQL----KLKDVRVFEAEYG-----------KLPDLKKVDFK----NDV
SERC_METMA      SFSKEWATDITKQL----KLKDTRVFEAEYG-----------KLPDLENVDFK----NDV
                 :                                                          

SERC_PSEAE      HYASNETIGGLEFD--WIPETG-------DVPLVTDMSSDILSRPLDVSRFGLIYAGAQK
SERC_PSEPK      HYASNETIGGLQFD--WVPQTG-------DVPLVVDMSSDILSRPIDVSQFGLIYAGAQK
SERC_PSEST      HYASNETIGGLQFD--WVPELG-------DTPLVVDMSSDILSRAIDVSKFGLIYAGAQK
SERC_PSESM      HYAPNETIGGLEFN--WIPETG-------DVPLVADMSSDILSRPVDISRFGMIYAGAQK
SERC_ACIAD      HYAENETIGGIQFA--DIPDV--------NVPLVSDLSSSILSAPLDVSKFGLIYAGAQK
SERC_CHRVO      HYTSNETIGGLQFP--YIP------AEQHGVPLVCDMSSDFLSREVDVSRFGMIYAGAQK
SERC_NITEU      HYASNETIGGVEFQ--WTPDLSAVAGDNKNIPLVADMSSNFLSRPFDVSKFGLIYAGAQK
SERC_BORBR      HLCSNETIGGVEFT--EWPDPASL--GAPDVPLVVDVSSHFLSRPLDIARAGLVFAGAQK
SERC_BORPA      HLCSNETIGGVEFT--EWPDPASL--GAPDVPLVVDVSSHFLSRPLDIARAGLVFAGAQK
SERC_BORPE      HLCSNETIGGVEFT--EWPDPASL--GAPDVPLVVDVSSHFLSRPLDIARAGLVFAGAQK
SERC_RALSO      HLCTNETIVGVEYQ--ETPDIGQ----AHGRVVVADVSSHILSRPVDWNGYAVLYGGAQK
SERC_AROAE      HLCTNETIHGVELC--EVSRLPD-----TGVPLVADMSSHILSRPLDIGRYGLIYAGAQK
SERC_NEIMA      HFAVNETVNGLQYR--EVPRLSE-----GMPPLVCDMSSEILSREFDVADYGLIYAGAQK
SERC_NEIMB      HFAVNETVNGLQYR--EVPCLSE-----GMPPLVCDMSSEILSREFDVADYGLIYAGAQK
SERC_NEIG1      HFAVNETVNGLQYR--EVPRLSD-----GMPPLVCDMSSEILSREFDVADYGLIYAGAQK
SERC_XANAC      HITANETIHGVEFR--DTPDV-------GTLPLFADFSSSIASEPLDISRYGLIYAGAQK
SERC_XANOR      HITANETIHGVEFR--DTPEV-------GTLPLFADFSSSIASEPLDISRYGLIYAGAQK
SERC_XANCP      HITANETIHGVEFR--DTPDV-------GTLPLFADFSSSIASEPLDIRRYGLIYAGAQK
SERC_XYLFA      HMTANETIHGVEFR--QTPDV-------GDVPLFADFSSSIAADLIDVSKYDLIYAGAQK
SERC_XYLFT      HMTANETIHGVEFR--QTPDV-------GDVPLFADFSSSIAADLIDVSKYDLIYAGAQK
SERC_ECOLI      HYCPNETIDGIAID--ETPDFG------ADVVVAADFSSTILSRPIDVSRYGVIYAGAQK
SERC_SHIFL      HYCPNETIDGIAID--ETPDFG------KDVVVAADFSSTILSRPIDVSRYGVIYAGAQK
SERC_ECO57      HYCPNETIDGIAID--ETPDFG------KDVVVAADFSSTILSRPIDVSRYGVIYAGAQK
SERC_ECOL6      HYCPNETIDGIAID--ETPDFG------KDVVVAADFSSTILSRPIDVSRYGVIYAGAQK
SERC_SALCH      HYCPNETIDGIAID--ETPDFG------PEVVVTADFSSTILSAPLDVSRYGVIYAGAQK
SERC_SALTY      HYCPNETIDGIAID--ETPDFG------PEVVVTADFSSTILSAPLDVSRYGVIYAGAQK
SERC_SALGL      HYCPNETIDGIAID--ETPDFG------PEVVVTADFSSTILSAPLDVSRYGVIYAGAQK
SERC_SALTI      HYCPNETIDGIAID--ETPDFG------PEVVVTADFSSTILSAPLDVSRYGVIYAGAQK
SERC_YERPE      HYCPNETIDGVAIN--EQPDFG------NKVVV-ADYSSSILSRPIDISRYGVIYAGAQK
SERC_YERPS      HYCPNETIDGVAIN--EQPDFG------NKVVV-ADYSSAILSRPIDISRYGVIYAGAQK
SERC_YERE8      HYCPNETIDGLAIN--EEPDFG------NKVVV-ADYSSSILSRPIDVSRYGVIYAGAQK
SERC_PECAS      HYCPNETIDGIAIE--EEPDFG------DKIVV-ADYSSSILSRRIDVSRYGVIYAGAQK
SERC_PHOLL      HYCPNETIDGIAIH--EQPDFS------DNKIIIADYSSSILSGPLDVSRYGMIYAGAQK
SERC_XENNA      HYCPNETIEGTAIF--EEPDFG------DDKIVIADYSSTILSAPIDVSRYGVIYAGAQK
SERC_VIBVU      HFCPNETIDGIEIN--DLP--V------TDKPIVADMSSTILSREIDVSKYGVIYAGAQK
SERC_VIBVY      HFCPNETIDGIEIN--DLP--V------TDKPIVADMSSTILSREIDVSKYGVIYAGAQK
SERC_VIBPA      HFCPNETIDGIEIN--DLP--I------TDKPIVADMSSTILSREIDVSKYGVIYAGAQK
SERC_VIBCH      HFCPNETIDGIEIN--DLP--V------TDKPIVADMSSTILSREIDVSKYGVIYAGAQK
SERC_ALIF1      HFCPNETIDGIEIN--DLP--V------TDKPIVADMSSTILSRKIDVSKYGVIYAGAQK
SERC_PHOPR      HFCPNETIDGIEIR--DLP--E------TDKPIVADLSSTILSRPIDVSKYGVIYAGAQK
SERC_SHEON      HYCPNETVDGIEIF--DEL--D------SPWPIVADLSSTIMSREIDVSRYGLIYAGAQK
SERC_IDILO      HYCPNETVDGIALH--EIP--D------VKAPIVADMSSNILSEPLDVSKFGVIYAGAQK
SERC_BLOFL      HYCPNETVEGISID--DIPDCF------EKKIVIADFSSTLLSRPVNVNNFGMIYAAAQK
SERC_BUCBP      HYCPNETIDGIAIH--EEPKFN------DKKIVIGDFSSTILSKRINLERYSFIYASSQK
SERC_WIGBR      HYCPNETINGTAIY--ETPKF-------KNKIVVADFSSTILSRPIDVNKFDIIYASSQK
SERC_BUCAI      HYCPNETIDGLSIY--EEPVF-------ENKIVVGDFSSFILSRSINIKNYDLIYAGAQK
SERC_BUCAP      HYCPNETIDGMSIY--EEPNF-------KNKIIVGDFSSFILSRRINIENYGLIYAGAQK
SERC_HAEIN      HYCPNETISGVEIF--DVPN-V------GNAVLVADMSSNILSRQIDISKFGVIYAGAQK
SERC_PASMU      HYCPNETISGVEIF--DLPK-V------GNAVLVADMSSNILSRKIDISQFGLIYAGAQK
SERC_MANSM      HYCPNETITGVEIN--EIPN-V------GNAVLVADMSSNIMARKLDISKFGIIYAGAQK
SERC_HAEDU      HYCPNETISGVEIP--DIPI-V------GKAVLVADMSSNILSRNIDISKFGLIYAGAQK
SERC_LEGPH      YYTPNETINGVRFP--YVP-KT------EGVPLVADMTSCLLSEPINIRQYGLIFAGAQK
SERC_LEGPL      YYTPNETINGVRFP--YVP-KT------GGVPLVADMTSCLLSEPININQYGLIFAGAQK
SERC_LEGPA      YYTPNETINGVRFP--YVP-KT------GGVPLVADMTSCLLSEPININQYGLIFAGAQK
SERC_COXBU      YYVDNETVNGIEFP--FIP-DT------D-LTLVCDMSSNLLSRPFDVSRYGLIFACAQK
SERC_BACCZ      HITTNNTIEGTKYV--DIPRV-------DKVPLVADMSSNILSERYDVSKFGLIYAGAQK
SERC_BACHK      HITTNNTIEGTKYV--DIPHV-------DKVPLVADMSSNILSERYDVSKFGLIYAGAQK
SERC_BACC1      HITTNNTIEGTKYV--DIPHV-------DKVPLVADMSSNILSERYDVSKFGLIYAGAQK
SERC_BACCR      HITTNNTIEGTKYV--DIPHV-------EKVPLVADMSSNILSERYDVSKFGLIYAGAQK
SERC_STRT1      HLTTNNTIEGTSIY--DLPDT-------NGVPIVADMSSNILAARYNVEDFALIYAGAQK
SERC_STRT2      HLTTNNTIEGTSIY--DLPDT-------NGVPIVAHMSSNILAARYNVEDFALIYAGAQK
SERC_STRMU      HITTNNTIEGTSIY--DLPET-------HGVPIVADMSSNILAVRYNVADFGLIYAGAQK
SERC_STRA3      HVTTNNTIEGTSLY--DIPKT-------NGVPVIADMSSNILAVKYKVEDFAMIYAGAQK
SERC_LACLA      HLTTNNTIEGTSIFPENLPEF-------ASLPLVADMSSNILAVDYDVSKFGLIYAGAQK
SERC_LISMF      HVTTNNTIEGTAMF--DVPD--------SAVPVVADMSSNILSSVYDVKKFGLIYAGAQK
SERC_LISMO      HVTTNNTIEGTAMF--DVPD--------SAVPVVADMSSNILSSVYDVKKFGLIYAGAQK
SERC_LISIN      HVTTNNTIEGTAMF--DVPD--------SAVPVVADMSSNILSSVYDVKKFGLIYAGAQK
SERC_LACPL      HLTTNNTIEGTMMT--RLPVT-------GQVPLVADMSSNFLGEPYQVSDFGLIFAGAQK
SERC_LEPIC      HITSNNTIYGTQYP--EIPKI-------KQIPLVADMTSELLSRKIDVKDFGVIFAGAQK
SERC_LEPIN      HITSNNTIYGTQYP--EIPKI-------KQIPLVADMTSELLSRKIDVKDFGVIFAGAQK
SERC_DESPS      YFASNNTIYGTQFE--TMPQSKK--------MLVADMSSDIFSRKVDVSKFGLIFAGAQK
SERC_RHOBA      YYCSNETIQGVQFP--TEPNCPDS------VPLVSDASSDFLCRPLPIEKYGLLYACAQK
SERC_ALKHC      HLTSNNTIFGTQWH--TYPSV-------SHAPLIVDMSSDILSRPLPVKNFDLIYAGAQK
SERC_GEOKA      HITSNNTIFGTQWK--EFPN--------TPVDLVADMSSDILSRPFDVSQFALIYAGAQK
SERC_BACSU      HITSNNTIFGTQWQ--EFPN--------SPIPLVADMSSDILSRKIDVSKFDVIYGGAQK
SERC_BACSK      HMTSNNTIYGTQWH--AFPN--------TKAPLVCDMSSDIFSRRIPVNQFGLIYAGAQK
SERC_BACCI      HLTSNETIEGAQFK--AFPDT-------GSVPLIGDMSSDILSRPFDLNQFGLVYAGAQK
SERC_BACFN      HVTTNNTIYGTELK----GDLD------SPVPMVADMSSDIFSRPVDVSKYICIYGGAQK
SERC_BACFR      HVTTNNTIYGTELK----GDLD------SPVPMVADMSSDIFSRPVDVSKYICIYGGAQK
SERC_BACTN      HITTNNTIYGTELK----EDLN------SPVPMVADMSSDIFSRPIDVSKYICIYGGAQK
SERC_PORGI      HFTTNNTIYGTEIR----KDFD------TKTRLVADMSSDIFSRPIDVSKYDLIYGGAQK
SERC_CAMJE      YICSNNTIYGTQYQ--NYPK--------TKTPLIVDASSDFFSRKVDFSNIALFYGGVQK
SERC_CAMJR      YICSNNTIYGTQYQ--NYPK--------TKTPLIVDASSDFFSRKVDFSNIALFYGGVQK
SERC_MYCA1      AWAHNETSTGVAVPVR-RPADS------GDALVAIDATSGAGGLPVDIGETDAYYFSPQK
SERC_MYCPA      AWAHNETSTGVAVPVR-RPVDS------GDALVAIDATSGAGGLPVDIGETDAYYFSPQK
SERC_MYCBO      AWAHNETSTGVAVAVR-RPEGS------DDALVVIDATSGAGGLPVDIAETDAYYFAPQK
SERC_MYCTU      AWAHNETSTGVAVAVR-RPEGS------DDALVVIDATSGAGGLPVDIAETDAYYFAPQK
SERC_MYCLE      AWAHNETSTGVAVPVR-RPTGS------GGALIAIDATSGAGGLPVDIAQTDAYYFAPQK
SERC_MYCSJ      AWAHNETSTGVAVPVQ-RPADS------GDALIVIDATSGAGGLPVDIAQADAYYFAPQK
SERC_MYCSK      AWAHNETSTGVAVPVQ-RPADS------GDALIVIDATSGAGGLPVDIAQADAYYFAPQK
SERC_MYCSS      AWAHNETSTGVAVPVQ-RPADS------GDALIVIDATSGAGGLPVDIAQADAYYFAPQK
SERC_MYCVP      AWAHNETSTGVAVPVV-RPDGS------GDALIVIDATSAAGGLPVDITEADAYYFAPQK
SERC_METAC      VFVWNGTTSGVKVPNADWIPDD------REGVTLCDATSAIFAMDIPYHKLDVITFSWQK
SERC_METBF      VFVWNGTTSGVKVPNGDWIPEN------REGLTLCDATSAIFAMDIPYHKLDVITFSWQK
SERC_METMA      VFVWNGTTSGVKVPNGDWIPDS------REGLTLCDATSAVFAMDIPYHKLDVLTFSWQK
                    * *  *                         . :*                   **

SERC_PSEAE      NIGPSG----LVVVIVREDLLG-RARSV--CPTMLNYKTAAD------NGSMYNTPATYS
SERC_PSEPK      NIGPSG----LVVVIVREDLLG-HARSS--CPTMLDYKVSAD------NGSMYNTPATYS
SERC_PSEST      NIGPSG----LVVVIVRDDLLG-KARSS--CPTMLDYKIAAD------NGSMYNTPATFS
SERC_PSESM      NIGPSG----VVVVIIREDLLG-RARTL--CPTMLDYKVAAD------NGSMYNTPPTLA
SERC_ACIAD      NIGPAG----LTIVIVRDDLLD-QSRSD--IPSILKYSAQAK------NGSMVNTPATYA
SERC_CHRVO      NIGPSG----LTVLLIREDLLG-KARAD--IPTMLNYQVHAD------ADSMYNTPGTYP
SERC_NITEU      NVGPAG----LVVVIVREDLLDIPPLAG--TPAMFRYKTHAD------NASMYNTPPTYA
SERC_BORBR      NAGPAG----VTVVIARRDLLG-HALPI--CPSAFDYANVAA------DHSRYNTPPTFA
SERC_BORPA      NAGPAG----VTVVIARRDLLG-HALPI--CPSAFDYANVAA------DHSRYNTPPTFA
SERC_BORPE      NAGPAG----VTVVIARRDLLG-HALPI--CPSAFDYANVAA------DHSRYNTPPTFA
SERC_RALSO      NIGPAG----LTIVIARKDLLG-HAHPL--CPSAFNWRLVAE------NGSMYNTPPTYA
SERC_AROAE      NIGPSG----LVVVIVREDLLG-HASPV--TPTIMDYRVMAE------NGSMLNTPPTYA
SERC_NEIMA      NIGPAG----VTVVIVREDLLE-RCPND--IPDVFNYRSHIN------RDGMYNTPSTYA
SERC_NEIMB      NIGPAG----VTVVIVREDLLE-RCPND--IPDVFNYRSHIN------RDGMYNTPSTYA
SERC_NEIG1      NIGPAG----VTVVIVREDLLE-RCPND--IPDVFNYRSHLN------RDGMYNTPSTYA
SERC_XANAC      NLGPVG----ISVVIVRRDLLE-RAGQP--RADIFNYASQVA------RDSMLNTPPTWN
SERC_XANOR      NLGPVG----ISVVIVRRDLLE-RAGQP--RADIFNYASHVA------RDSMLNTPPTWN
SERC_XANCP      NLGPVG----ISVVIVRRELLE-RAGQP--RADIFNYASHVA------RDSMLNTPPTWN
SERC_XYLFA      NLGPVG----ICVVIVRRTLLE-RTGQP--RADIFTYASHAE------RDSMLNTPPTFN
SERC_XYLFT      NLGPVG----ICVVIVRRTLLE-RTGQP--RADIFTYASHAE------RDSMLNTPPTFN
SERC_ECOLI      NIGPAG----LTIVIVREDLLG-KANIA--CPSILDYSILND------NGSMFNTPPTFA
SERC_SHIFL      NIGPAG----LTIVIVREDLLG-KANIA--CPSILDYSILND------NGSMFNTPPTFA
SERC_ECO57      NIGPAG----LTIVIVREDLLG-KANVA--CPSILDYSILND------NGSMFNTPPTFA
SERC_ECOL6      NIGPAG----LTIVIVREDLLG-KANIA--CPSILDYSILND------NDSMFNTPPTFA
SERC_SALCH      NIGPAG----LTLVIVREDLLG-KAHES--CPSILDYTVLND------NDSMFNTPPTFA
SERC_SALTY      NIGPAG----LTLVIVREDLLG-KAHES--CPSILDYTVLND------NDSMFNTPPTFA
SERC_SALGL      NIGPAG----LTLVIVREDLLG-KAHES--CPSILDYTVLND------NDSMFNTPPTFA
SERC_SALTI      NIGPAG----LTLVIVREDLLG-KAHES--CPSILDYTVLND------NDSMFNTPPTFA
SERC_YERPE      NIGPAG----LTLVIVREDLLG-KAHTA--LPSILDYKVLAD------NDSMFNTPPTFA
SERC_YERPS      NIGPAG----LTLVIVREDLLG-KAHTA--LPSILDYKVLAD------NDSMFNTPPTFA
SERC_YERE8      NIGPAG----LTVVIVREDLLG-KARTE--LPSILDYKVLAE------NDSMFNTPPTFA
SERC_PECAS      NIGPAG----LTLVIVREDLLG-KARRE--LPSILDYQVLAD------NDSMFNTPPTFA
SERC_PHOLL      NIGPAG----ITLVIVREDLLG-KARKE--TPSIFDYAVLAE------NDSMFNTPPTFA
SERC_XENNA      NIGPAG----ITVVIIREDLLG-KAHKH--IPSILDYTVQVK------ADSMYNTPPTFA
SERC_VIBVU      NIGPSG----IAIAIVRDDLLG-LAKEV--LPSILNYKVLAE------QDSMFNTPPTFA
SERC_VIBVY      NIGPSG----IAIAIVRDDLLG-LAKEV--LPSILNYKVLAE------QDSMFNTPPTFA
SERC_VIBPA      NIGPSG----IAIAIVRDDLLG-MAKQV--LPSILDYKVLAE------KESMFNTPPTFA
SERC_VIBCH      NIGPAG----ICIAIVRDDLLD-LASDL--LPGVLNYKILAE------QESMFNTPPTFA
SERC_ALIF1      NIGPAG----LTIVIVRDDLLD-LASQT--LPSVLNYGVLAD------KESMFNTPPTYA
SERC_PHOPR      NIGPAG----LTIVIVRDDLLG-KAKQE--IPSIFDYTVLVD------KESMFNTPPTFA
SERC_SHEON      NIGPSG----LSIVIVRDDMLT-LPSLP--QSSIMDYRLAVE------HDSMFNTPPTFA
SERC_IDILO      NIGPSG----FAIAIVKKSLLG-HPQKQ--VSSIMDYQLQAK------DGSMYNTPNTFA
SERC_BLOFL      NMGISG----LTVLIIRRSLIN-NISTVQKIPAILNYRILAD------SNSMFNTPVTVS
SERC_BUCBP      NIGPSG----ITLIIMHESLLQ-NINSY--VPSILNYKILVN------SNSMFNTPNTFS
SERC_WIGBR      NIGVSG----MTIMIFKKNIFL-KQNKF--TPSILNYEIIYK------NNSLFNTPPTFN
SERC_BUCAI      NIGPAG----ITIIIIRKNIIG-YSSKM--TPSILDYKKISD------HHSMFNTPPTFA
SERC_BUCAP      NIGPSG----ITIILIRKDLIG-YASKI--SPSIFNYYIISK------YNSMFNTPPTFS
SERC_HAEIN      NLGPAG----ITLVIIRDDLIG-NARKE--TPSIWNYATQRD------ADSMINTPPTFA
SERC_PASMU      NLGPAG----ITLVIVREDLIG-HARQT--TPTIWNYEIQSK------ADSMINTPPTFA
SERC_MANSM      NLGPAG----IVIVIVREDLIG-HARKA--TPSIWNYEVQAN------ADSMINTPPTFA
SERC_HAEDU      NLGPAG----ITIVIIRQDLIG-NAQRA--TPSIWNYATQVN------ADSMINTPPTFA
SERC_LEGPH      NIANAG----LTVVIIHEELLQ-NQPEP-VIPTMLNYKNHAD------HRSLYATPPVFN
SERC_LEGPL      NIANAG----LTVVIIHEELLK-NQPEP-VIPTMLNYKNHAE------HRSLYATPPVFN
SERC_LEGPA      NIANAG----LTIVIIHEDLLK-NQPEP-AIPTMLNYKNHAE------HRSLYATPPVFN
SERC_COXBU      NMGLAG----LTIVIVHDDLLK-RSPLP-TTPSYLQYALHAK------ERSFINTPPTFA
SERC_BACCZ      NLGPAG----LTIAIIKRDLIG---GADRYCPTMLNYETYSK------NNSLYNTPPSFS
SERC_BACHK      NLGPAG----LTIAIIKRDLIG---GADRYCPTMLNYETYSK------NNSLYNTPPSFS
SERC_BACC1      NLGPAG----LTIAIIKRDLIG---GADRSCPTMLNYETYSK------NNSLYNTPPSFS
SERC_BACCR      NLGPAG----LTIAIIKRDLIG---EADRSCPTMLNYETYSK------NNSLYNTPPSFS
SERC_STRT1      NIGPAG----VTVVIVREDFLN---DQP-QLSAMLDYRIQAE------AGSLYNTPPCFN
SERC_STRT2      NIGPAG----VTVVIVREDFLN---DQP-QLSAMLDYRIQAE------AGSLYNTPPCFN
SERC_STRMU      NIGPAG----VTIVIVREDLLN---DEP-VLSSMLDYRIQAE------AGSLYNTPPTYG
SERC_STRA3      NIGPAG----VTVVIIREDMIN---EEP-TLSSMLDYKIQSD------ASSLYNTPPAYS
SERC_LACLA      NLGIAG----LTIVIIREDLLN---EAE-SLSSMMDYQILVE------NGSMYNTPPTFA
SERC_LISMF      NIGPAG----LTLVIVREDLIG---QVE-GLPSMLDFKVQAE------NDSMYNTPPTFA
SERC_LISMO      NIGPAG----LTLVIVREDLIG---QVE-GLPSMLDFKVQAE------NDSMYNTPPTFA
SERC_LISIN      NIGPAG----LTLVIVREDLIG---QVE-GLPSMLDFKVQAE------NGSMYNTPPTFA
SERC_LACPL      NLGPAG----LTIVIVRDDLIG---QVA-NLPSMLDYQLFAA------KDSMFNTPPVFA
SERC_LEPIC      NIGPSG----LSLAIIRNDLLG---ISGRKIPILLDYSVMVK------NRSLYNTPSTYS
SERC_LEPIN      NIGPSG----LSLAIIRNDLLG---ISGRKIPILLDYSVMVK------NRSLYNTPSTYS
SERC_DESPS      NLGPAG----VTLVIIRDDLLE---KTPAHTPTMLSYKTHAD------KGSMFNTPPCFA
SERC_RHOBA      NAGPAG----VSVVIMRKDLLD---KADPNIPGYLHFKNHHD------NDSEWNTPPTFA
SERC_ALKHC      NLGPSG----VTVVIIRKELLK---RNVDHVPTMLRYQTHAE------KQSLYNTPPTFG
SERC_GEOKA      NLGPSG----VTVVILRNDLLE---RIPDGLPTMLDYRTHQK------SNSLYNTPPTFA
SERC_BACSU      NLGPSG----VTVVIMKKSWLQ---NENANVPKILKYSTHVK------ADSLYNTPPTFA
SERC_BACSK      NLGPSG----VTLVLIQDAFLQ---RAKSGLPAMLSYDTFVK------SNSLYNTPPVFS
SERC_BACCI      NLGPSG----VTVVIVREDLVA---ESPKHLPTMLRYDTYVK------NNSLYNTPPSFG
SERC_BACFN      NLAPSG----VTFVIVKDDAVG---KVSRYIPSMLNYKTHID------GGSMFNTPPVLP
SERC_BACFR      NLAPSG----VTFVIVKDDAVG---KVSRYIPSMLNYKTHID------GGSMFNTPPVLP
SERC_BACTN      NLAPAG----VTFVIVKNDAVG---KVSRYIPSMLNYQTHID------NGSMFNTPPVVP
SERC_PORGI      NIGPAG----ATFVLVKTDVLG---QVDRPLPDMLNYQIHIK------KDSMFNTPPVFP
SERC_CAMJE      NAGISG----LSCIFIRKDMLE--RSKNKQIPSMLNYLTHAE------NQSLFNTPPTFA
SERC_CAMJR      NAGISG----LSCIFIRKDMLE--RSKNKQIPSMLNYLTHAE------NQSLFNTPPTFA
SERC_MYCA1      NFAGDGGLWLALMSPAALARVESIAASGRWVPDFLSLPIA---VENSLKDQTYNTPAIGT
SERC_MYCPA      NFAGDGGLWLALMSPAALARVESIAASGRWVPDFLSLPIA---VENSLKDQTYNTPAIGT
SERC_MYCBO      NFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIA---VENSLKNQTYNTPAIAT
SERC_MYCTU      NFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIA---VENSLKNQTYNTPAIAT
SERC_MYCLE      NFASDGGLWLAIMSPAALARVDSITASGRWVPDFLSLPIA---VENSLKNQTYNTPAICT
SERC_MYCSJ      NFAGDGGLWLAVVSPAALARIEAIGQSGRWVPDFLSLPIA---VENSLKNQTYNTPAIGT
SERC_MYCSK      NFAGDGGLWLAVVSPAALARIEAIGQSGRWVPDFLSLPIA---VENSLKNQTYNTPAIGT
SERC_MYCSS      NFAGDGGLWLAVVSPAALARIEAIGQSGRWVPDFLSLPIA---VENSLKNQTYNTPAIGT
SERC_MYCVP      NFAGDGGLWLAILSPAALARVDAIAAAGRWVPEFLSLPIA---IENSLKNQTYNTPAIAT
SERC_METAC      VLGGEGAHGMLILSPRAVQRLESYTPA-WPLPKIFRLTKGGKLNKDIFAGSTINTPSMLA
SERC_METBF      VLGGEGAHGMLILSPRAVQRLESYTPA-WPLPKIFRLTKGGKLNKKIFEGSTINTPSMLA
SERC_METMA      VLGGEGAHGMLILSPRAVQRLESYTPA-WPLPKIFRLTKGGKLNKEIFEGSTINTPSMLA
                  .  *              .          .                      **    

SERC_PSEAE      WYLSGLVFEWLK-EQGGVTAMEQRNRAKKDLLYKTIDASD-FYTNPI-QPSARSWMNVPF
SERC_PSEPK      WYLSGLVFEWLK-EQGGVEAMEQRNRAKKDRLYGFIDRSE-FYTNPI-SVNARSWMNVPF
SERC_PSEST      WYLSGLVFEWLK-EQGGVEVMEQRNRAKKELLYGFIDASE-FYTNPI-AENARSWMNVPF
SERC_PSESM      WYLSGLVFEWLK-EQGGVEAIGKLNDIKQRTLYDFIDASG-LYSNPI-NTPDRSWMNVPF
SERC_ACIAD      WYLSGLVFEWLL-EQGGVDAIHQVNLEKAKLLYGYIDSSD-FYNNPI-AVPNRSIMNVPF
SERC_CHRVO      IYIAGLVFKWLK-EQGGVKGIATRNEEKAGLLYHVIDSSGGFYSTHI-EQPFRSKMNVVF
SERC_NITEU      IYIMGLVMEWLK-KQGGLTAIEQRNIAKAKLIYDLIDVSS-FYHCPV-NQADRSRMNVPF
SERC_BORBR      IYVMGLVFKWIK-AHGGVRGMEEANRAKAELLYGYLDGS-AFYRNPV-QPAVRSRMNVPF
SERC_BORPA      IYVMGLVFKWIK-AHGGVRGMEEANRAKAELLYGYLDGS-AFYRNPV-QPAVRSRMNVPF
SERC_BORPE      IYVMGLVFKWIK-AHGGVRGMEEANRAKAELLYGYLDGS-AFYRNPV-QASVRSRMNVPF
SERC_RALSO      IYVAGLVFQWIK-RQGGVEALETRNIVKAKMLYDFIDAS-GFYRNDI-HPSCRSRMNVPF
SERC_AROAE      IYIAGLVFRWLK-AQGGLAAVEANNIAKSDLLYDFLDAS-DFYENRV-AQDSRSRMNIPF
SERC_NEIMA      IYMSGLVFRWLQ-AQGGVKKIEAVNRLKAQTLYETIDGSGGFYINRI-RPNARSKMNVVF
SERC_NEIMB      IYMSGLVFRWLQ-AQGGVKKIEAVNRLKAQTLYETIDGSDGFYINRI-RPNARSKMNVVF
SERC_NEIG1      IYMSGLVFRWLQ-AQGGVKKIEAVNRLKAQTLYETIDGSGGFYINDI-HPDARSKMNVVF
SERC_XANAC      WYLLGLTVKWML-EQGGVQEFARRNAEKAALVYGAIDGSGGFYRNLI-KPAVRSRMNIPF
SERC_XANOR      WYLLGLTVKWML-EQGGVQEFARRNAEKAALVYGAIDGAGGFYRNLI-TPAVRSRMNIPF
SERC_XANCP      WYLLGLTVKWML-EQGGVAAFAQRNAEKAALVYGAIDGSGGFYRNQV-MPTVRSRMNIPF
SERC_XYLFA      WYLLGLTVKWML-AEGGVQEFARRNQAKAQLVYQTIDQSGGFYRNGV-AAAVRSRMNIPF
SERC_XYLFT      WYLLGLTVKWML-AEGGVQEFARRNQAKAQLVYQTIDQSGGFYRNGV-AAAVRSRMNIPF
SERC_ECOLI      WYLSGLVFKWLK-ANGGVAEMDKINQQKAELLYGVIDNSD-FYRNDV-AKANRSRMNVPF
SERC_SHIFL      WYLSGLVFKWLK-ANGGVAEMDKINQQKAELLYGVIDNSD-FYRNDV-AKANRSRMNVPF
SERC_ECO57      WYLSGLVFKWLK-ANGGVAEMDKINQQKAELLYGVIDNSD-FYRNDV-AKANRSRMNVPF
SERC_ECOL6      WYLSGLVFKWLK-ANGGVAAMDKINQQKAELLYGVIDNSD-FYRNDV-AKANRSRMNVPF
SERC_SALCH      WYLSGLVFKWLK-AQGGVAAMHKINQQKAELLYGVIDNSD-FYRNDV-AQANRSRMNVPF
SERC_SALTY      WYLSGLVFKWLK-AQGGVAAMHKINQQKAELLYGVIDNSD-FYRNDV-AQANRSRMNVPF
SERC_SALGL      WYLSGLVFKWLK-AQGGVAAMHKINQQKAELLYGVIDNSD-FYRNDV-AQANRSRMNVPF
SERC_SALTI      WYLSGLVFKWLK-AQGGVAAMHKINQQKAELLYGVIDNSD-FYRNDV-AQANRSRMNVPF
SERC_YERPE      WYLSGLVFKWLK-EQGGLGEMEKRNQAKAELLYGAIDRTG-FYRNQV-AITNRSWMNVPF
SERC_YERPS      WYLSGLVFKWLK-EQGGLGEMEKRNQAKAELLYGAIDRTG-FYRNQV-AIANRSWMNVPF
SERC_YERE8      WYLSGLVFKWLK-EQGGLGEMGKRNQAKAELLYGAIDRTD-FYRNQV-ATANRSWMNVPF
SERC_PECAS      WYLSGMVFKWLK-EHGGLAEMEKRNQEKADLLYSAIDGND-FYRNDV-ALANRSRMNVPF
SERC_PHOLL      WYLSGLVFKWLK-EQGGVQEMAKRNRAKAELLYDVIDKSD-FYRNQV-APENRSLMNVPF
SERC_XENNA      WYLSGMVFKWLK-EQGGLQEISKRNLAKAELLYRAIDNSN-LYINRV-ALQNRSIMNVPF
SERC_VIBVU      WYLSGLVFKWLK-AQGGVKAIEQVNREKAAILYNYIDESD-FYINNV-HPDNRSLMNVPF
SERC_VIBVY      WYLSGLVFKWLK-AQGGVKAIEQVNREKAAILYNYIDESD-FYINNV-HPDNRSLMNVPF
SERC_VIBPA      WYLSGLVFKWLK-AQGGVKSIETVNREKAKLLYDYIDQSD-FYRNGV-HPSNRSLMNVPF
SERC_VIBCH      WYLSGLVFQWLK-AQGGVKAIEEVNRAKAALLYGYIDSSD-FYRNEI-HPDNRSLMNVPF
SERC_ALIF1      WYLAGLVFKWLK-SNGGIDAMETHNRKKAAVLYDYIDQSD-FYRNDV-HSDNRSLMNVPF
SERC_PHOPR      WYLAGEVFKWLK-ELGGLEAMKQRNDAKAELLYNFIDGSN-FYNNDV-HVDNRSFMNAPF
SERC_SHEON      WYLAAEVFAWLK-SIGGVASIAKINQQKAQMLYACIDANP-FYKNGV-VAANRSQMNVTF
SERC_IDILO      WYLAGLVFKWLK-AQGGLTAMGERNRHKAQLLYDFVDKSD-FYRNDI-NPAYRSIMNIPF
SERC_BLOFL      WYIANLVFKWLQ-DQGGLDKIAEYNKKKSNLLYHAIDSND-FYYNNI-HSLNRSRMNIPF
SERC_BUCBP      LYLSGLILKWIK-KIGGIKEIEKRNIIKSNMLYNMIDSTD-FYINDV-VSNNRSRMNVPF
SERC_WIGBR      WYVSGLVLKWLI-DQGGVKKINNINKIKSKLIYDIIDKSK-FYKNNI-YDEYRSYMNIIF
SERC_BUCAI      WYLSGLVFKWLK-KQGGLKAIEKLNKKKSDLLYKKIDNSD-FYINKI-NSKHRSQMNVVF
SERC_BUCAP      WYLSGLVFKWLK-KQGGIKKIEQLNQKKSNLLYQIIDNSN-FYINDI-DKRNRSQMNVVF
SERC_HAEIN      WYLCSLVFKHLK-EIGGLEIIEKRNALKAQTLYDYIDSSK-LYRNVV-AKENRSTMNVTF
SERC_PASMU      WYLCALVFKHLL-SLGGIEEIEKRNQAKAQLLYDYLESTP-FYRNPV-AKVNRSRMNVTF
SERC_MANSM      WYLCSLVFKDLL-ANGGIDTVEKRNAQKAALLYDYLDQTV-FYHNTI-AKENRSVMNVTF
SERC_HAEDU      WYLCSLVFKHLR-AAGGLASVEQRNQQKAALLYQYLDNSH-FYHNYV-APQNRSLMNVTF
SERC_LEGPH      CYLASKMFEWIK-KQGGIEELFQRNCLKAAKLYQYLDSTD-FYLTPV-SKEARSIMNVCF
SERC_LEGPL      CYLASKMFEWIK-TQGGIEGLFQRNCLKAAKLYQYLDSTD-FYLTPV-FKEARSIMNICF
SERC_LEGPA      CYLASKMFEWIK-TQGGIEGVFQRNCLKAAKLYQYLDSTD-FYLTPV-SKEARSIMNICF
SERC_COXBU      WYLAGLIFKWVK-NQGGVAVLAERNQRKAAKLYKFIDKSN-FFDNPI-NPTYRSRMNVIF
SERC_BACCZ      IYVTKLVLEWLK-EQGGVSAIEEQNKMKSSLLYNFLDESK-LFTSPV-DPTYRSLMNIPF
SERC_BACHK      IYVTKIVLEWLK-EQGGVSAIEEQNKMKSSLLYNFLDESK-LFTSPV-DPTYRSLMNIPF
SERC_BACC1      IYVTKLVLEWLK-EQGGVSAIEEQNRMKSSLLYNFLDESK-LFTSPV-DPTYRSLMNIPF
SERC_BACCR      IYVTKLVLEWLK-EQGGVSAIEEQNRMKSSLLYNFLDESK-LFTSPV-DPTYRSLMNIPF
SERC_STRT1      IYISKLVFDWVKNEIGGVDKMAEIQREKSGLLYDYIESSD-FYTNPVKDAKDRSVCNIPF
SERC_STRT2      IYISKLVFDWVKNEIGGVDKMAEIQREKSGLLYDYIESSD-FYTNPVKDAKDRSVCNIPF
SERC_STRMU      IYIAKLVFEWLK-ELGGVDEMEKINREKSGLLYDFIEQSD-FYTSPVKSPKDRSVANIPF
SERC_STRA3      IYIAKLVFEWVK-SLGGVDAMEKANREKSGLLYDYIDSSE-FYSNPVRDKKSRSLCNIPF
SERC_LACLA      IYVAGLVFKWVK-AQGGVKKLEEMNQRKAQLLYDLIDQSD-FYQNPIKNKDERSICNVVF
SERC_LISMF      IYVAKLVFEWIK-EQGGVAGIEALNRKKAALLYNYIDQSD-FFSSPV-EPSARSLTNVPF
SERC_LISMO      IYVAKLVFEWIK-EQGGVAGIEALNRKKAALLYDYIDQSD-FFSSPV-EPSARSLTNVPF
SERC_LISIN      VYVAKLVFEWIK-EQGGVAGIEALNRKKAALLYDYIEQSD-FFSSPV-EPSARSLTNIPF
SERC_LACPL      IYAAGLVLKWLK-AQGGLSTMTARNHAKAALLYDFLDQSQ-LFTNPV-KTSDRSTMNVPF
SERC_LEPIC      IYIAKLVFEWLL-KLGGIEAIEKVNEQKAKLIYDFIDSSS-LYVCPV-QKRARSKMNVVF
SERC_LEPIN      IYIAKLVFEWLL-KLGGIEAIEKVNEQKAKLIYDFIDSSS-LYVCPV-QKRARSKMNVVF
SERC_DESPS      IYVMGEVLAWLKN-LGGVEKIEEINREKAALLYSQIDASD-YYRVHA-QDGSRSLMNVTF
SERC_RHOBA      IYVLGKVARWLRDDMGGLEKMESINHEKSQQLYSVIDSSNGFYRGHA-QTDCRSLMNVTF
SERC_ALKHC      IYMLKEVLQWLK-NIGGTEQIAERNQTKANLIYGAIDESEQFYKGHA-TKESRSLMNVTF
SERC_GEOKA      IYMLSLVLEWVE-EQGGVAAMEERNQQKAAVLYEAIDESGGFYKPHA-EKGSRSLMNVTF
SERC_BACSU      IYMLSLVLEWLK-ENGGVEAVEQRNEQKAQVLYSCIDESNGFYKGHA-RKDSRSRMNVTF
SERC_BACSK      IYMLGLVLDWLE-ESGGLTEIENRNKAKAQLLYEAIDESDGFYIGHA-AQDSRSNMNVTF
SERC_BACCI      IYMVNEVLKWIE-ERGGLEGVQQANRKKASLIYDAIDQSGGFYRGCV-DVDSRSDMNITF
SERC_BACFN      IYSAMQTLRWIK-AQGGVKEMDRRATEKADMLYAEIDRNK-MFVGTA-AKEDRSRMNICF
SERC_BACFR      IYSAMQTLRWIK-AQGGVKEMDRRATEKADMLYAEIDRNK-MFVGTA-AKEDRSRMNICF
SERC_BACTN      IYAALLNLRWIK-AQGGVKEMERRAIEKADMLYAEIDRNK-LFVGTA-AKEDRSRMNICF
SERC_PORGI      VYVALQTMKWYK-ELGGVKVLEKMNLDKAALIYDAIDSSK-IFRGTV-NPEDRSIMNACF
SERC_CAMJE      IYMFNLEMDWLL-NQGGLDKVHEKNSQKATMLYECIDLSNGFYKGHA-DKKDRSLMNVSF
SERC_CAMJR      IYMFILEMDWLL-NQGGLDKVHEKNSQKAAMLYECIDLSNGFYKGHA-DKKDRSLMNVSF
SERC_MYCA1      LALMAEQVDWML-GNGGLDWAVKRTADSAGRLYSWAEERD-YTTPFVADPKLRSQ--VVG
SERC_MYCPA      LALMAEQVDWML-GNGGLDWAVKRTADSAGRLYSWAEERD-YTTPFVADPKLRSQ--VVG
SERC_MYCBO      LALLAEQIDWLV-GNGGLDWAVKRTADSSQRLYSWAQERP-YTTPFVTDPGLRSQ--VVG
SERC_MYCTU      LALLAEQIDWLV-GNGGLDWAVKRTADSSQRLYSWAQERP-YTTPFVTDPGLRSQ--VVG
SERC_MYCLE      LALLAEQLDWLL-GNGGLEWAVKRTADSSQRLYAWAEDRP-YTTPFVVDPALRSQ--VVG
SERC_MYCSJ      LVLLADQLDWLN-GNGGLDWAVKRTADSSQRLYSWAEASS-YATPFVTDPALRSQ--VVG
SERC_MYCSK      LVLLADQLDWLN-GNGGLDWAVKRTADSSQRLYSWAEASS-YATPFVTDPALRSQ--VVG
SERC_MYCSS      LVLLADQLDWLN-GNGGLDWAVKRTADSSQRLYSWAEASS-YATPFVTDPALRSQ--VVG
SERC_MYCVP      LILLAEQIDWLL-GNGGLDWATKRTAESSSRLYSWAEAAS-FATPFVADPALRSQ--VVG
SERC_METAC      NEDWLATLKWAE-SVGGLKQLIRRTNENLAVFEAFVAKNN-WIHFLAETKEIRSSTSVCF
SERC_METBF      NEDWLATLKWAE-SVGGLKPLIQRTNDNLAVFEAFVAKNN-WIHFLAETKEIRSSTSVCF
SERC_METMA      NEDWLATLKWAE-SVGGLKQLIQRTNENLAVFEAFVAKNN-WIHFLAETKEIRSSTSVCF
                               **          .   .                    **      

SERC_PSEAE      RLADE--RLDKPFLEGAEARGLLNLKGHRSV--GGMRASIYNALGLDAVEALVAYMAEFE
SERC_PSEPK      RLADE--RLDKAFLAGADARGLLNLKGHRSV--GGMRASIYNALGLEAVEALVGYMAEFE
SERC_PSEST      RLADE--RLDKAFLAGADARGLLNLKGHRSV--GGMRASIYNAVGLDAVEALVAYMAEFE
SERC_PSESM      RLADD--RLDKPFLAGADANGLLNLKGHRSV--GGMRASIYNAVDINAVNALVAYMKDFE
SERC_ACIAD      TLADE--ALEKLFLQEAEENHLLNLAGHRSV--GGMRASIYNAVPLEGVQALVNFMDTFV
SERC_CHRVO      KLRDE--ALDEIFLLEARKNGLAQLKGHRAV--GGMRASIYNAMPIEGVKSLVNFMQDFA
SERC_NITEU      TLSDP--GLDDAFLKQAQAHGLIQLKGHRSV--GGMRASIYNAMPLEGVQTLVTFMREFE
SERC_BORBR      VLRDE--SLNDAFLQGAEAAGLMQLKGHKSV--GGMRASIYNAMPLAGVQALIDYLKEFE
SERC_BORPA      VLRDE--SLNDAFLQGAEAAGLMQLKGHKSV--GGMRASIYNAMPLAGVQALIDYLKEFE
SERC_BORPE      VLRDE--SLNDAFLQGAEAAGLMQLKGHKSV--GGMRASIYNAMPLAGVQALIDYLKEFE
SERC_RALSO      FLNDE--SRNEAFLAQARAQGLVQLKGHKSV--GGMRASIYNAMPLEGVEALVDFMREFE
SERC_AROAE      LLRDD--ALNDPFLAGAKAAGLTQLKGHKSV--GGMRASIYNAMPLAGVQALVDYMRDFS
SERC_NEIMA      QTGDE--ELDRRFVLEAELQGLCLLKGYKTV--GGMRASIYNAMPLEGVRALADFMRDFQ
SERC_NEIMB      QTGDE--ELDRRFVLEAELQGLCLLKGYKTV--GGMRASIYNAMPLEGVRALADFMRDFQ
SERC_NEIG1      KTASE--DLDRRFVLEAELQGLCLLKGYKSV--GGMRASIYNAMPLEGVRALADFMRDFQ
SERC_XANAC      FLPDE--RLDALFVSESKAAGLLALKGHKAV--GGIRASLYNAMPVAGAQALAAFMHDFQ
SERC_XANOR      FLPDE--QLDALFVSESKAAGLLALKGHKAV--GGIRASLYNAMPLAGAQALANFMHDFQ
SERC_XANCP      FLGDE--QLDALFVSESKAAGLLALKGHKAV--GGIRASLYNAMPVAGAQALVAFMHDFQ
SERC_XYLFA      FLPNV--EQDARFAAEAKAAGLLSLKGHKAL--GGIRASLYNAMPLAGVQALVAFMHDFQ
SERC_XYLFT      FLPNV--EQDARFAAEAKAAGLLSLKGHKAV--GGIRASLYNAMPLAGVQALVAFMHDFQ
SERC_ECOLI      QLADS--ALDKLFLEESFAAGLHALKGHRVV--GGMRASIYNAMPLEGVKALTDFMVEFE
SERC_SHIFL      QLADS--ALDKLFLEESFAAGLHALKGHRVV--GGMRASIYNAMPLEGVKALTDFMVEFE
SERC_ECO57      QLADS--ALDKLFLEESFAAGLHALKGHRVV--GGMRASIYNAMPLEGVKALTDFMVEFE
SERC_ECOL6      QLADS--ALDKLFLEESFAAGLHALKGHRVV--GGMRASIYNAMPLEGVKALTDFMVEFE
SERC_SALCH      QLADN--TLDKVFLEESFAAGLHALKGHRVV--GGMRASIYNAMPIEGVKALTDFMIDFE
SERC_SALTY      QLADN--TLDKVFLEESFAAGLHALKGHRVV--GGMRASIYNAMPIEGVKALTDFMIDFE
SERC_SALGL      QLADN--ALDKVFLEESFAAGLHALKGHRVV--GGMRASIYNAMPIEGVKALTDFMIDFE
SERC_SALTI      QLADN--ALDKVFLEESFAAGLHALKGHRVV--GGMRASIYNAMPIEGVKALTDFMIDFE
SERC_YERPE      QMADA--SLDKLFLSEAEAQGLQALKGHRVA--GGMRASIYNAMPIEGVKALTDFMADFE
SERC_YERPS      QMAEA--SLDKLFLSEAEAQGLQALKGHRVA--GGMRASIYNAMPIEGVKALTDFMADFE
SERC_YERE8      QMIDP--SLDKLFLSEAEAQGLQALKGHRVA--GGMRASIYNAMPIEGVKALTDFMAEFE
SERC_PECAS      LLADS--ALDKVFLEESVAAGLHALKGHRVV--GGMRASIYNAMPLEGVKALTEFMADFA
SERC_PHOLL      QMVDA--SLDSKFLAEADAQGLQALKGHRVS--GGMRASIYNAMSIEGVQALVDFMADFE
SERC_XENNA      QLVNP--ALDGKFLEEAYAHGLHALKGHKVA--GGARASIYNAMSYEGVKALVEFMADFE
SERC_VIBVU      QMVKP--ELDAKFLKEAEALGLKSLKGHRVV--GGMRASIYNAMPIEGVKALVDFMRQFE
SERC_VIBVY      QMVKP--ELDAKFLKEAEALGLKSLKGHRVV--GGMRASIYNAMPIEGVKALVDFMRQFE
SERC_VIBPA      QLAKP--ELDATFLELADAKGLKALKGHRVV--GGMRASIYNAMPLEGVQALVDFMKEFE
SERC_VIBCH      QLAKP--ELDDTFLELAEARGLVSLKGHRVV--GGMRASIYNAMPLEGVQALVDFMKEFE
SERC_ALIF1      QLANP--ELDTKFLELADEAGLKALKGHRVV--GGMRASIYNAMPLEGVEALVQFMKEFE
SERC_PHOPR      QLKKP--ELDSKFLEQADAAGLKALKGHRVV--GGMRASIYNAMPIEGVQALVDFMRQFE
SERC_SHEON      QLADE--SLDGAFLKEAEAVGLVALKGHRIV--GGMRASLYNAMPLEGVAALVTFMNEFA
SERC_IDILO      QLAYD--KLDAEFLQGAKNQGLLGLKGHRFV--GGMRASIYNAMPVEGVEALLNYMADFE
SERC_BLOFL      FLKKE--KLNSLFLSESTSFGLHGLKGHKVI--GGMRASLYNAMTLEGVQKLVNFMNFFS
SERC_BUCBP      TIINT--KLHEIFVKEAYKYGLHALKGHNLK--GGIRASIYNAMPIKGVLKLINFMKIFE
SERC_WIGBR      YLPNK--KLNNLFLKLSKINGLLFLKGHRAV--GGIRASMYNSMTIKGAKKLANFMKYFE
SERC_BUCAI      HLVNP--KLNYIFLKEASKTGLNYLRGHSIV--GGMRASLYNAMPLEGVESLVKFMSYFE
SERC_BUCAP      HLYNS--KLDNLFLKEAKNAGLNALKGHNVI--GGMRASIYNAMPLEGVQSLAKFMLYFE
SERC_HAEIN      ITGNP--ELDAKFVAESTAAGLQALKGHKVL--GGMRASIYNAMSQNGVEALISFMKKFE
SERC_PASMU      TTDND--ELNAKFVAEATAAGLHALKGHKVL--GGMRASIYNAMPMEGVQALIAFMKQFE
SERC_MANSM      TTGDD--QLNAKFVAQATEAGLQALKGHKVF--GGMRASIYNAMPVEGVEALIAFMKKFE
SERC_HAEDU      TTNND--ELNAKFVAEAAENGLHALKGHKVV--GGMRASIYNAMPLDGVEALIEFMQKFA
SERC_LEGPH      SLYYP--DLEQKFLDMANERGLKALKGHRFT--GGLRASLYNAMPMAGVDALIEFMSEFA
SERC_LEGPL      SLCYP--DLEHKFLDMANERGLKALKGHRFT--GGLRASLYNAMPMAGVDALIEFMSEFA
SERC_LEGPA      SLCYP--DLEQKFLDMANKRGLKALKGHRFT--GGLRASLYNAMPMAGVDALIEFMSEFA
SERC_COXBU      RLADE--RLNSLFLKEATENGLANLKGHRLL--GGMRASIYNAMTEEGVDALINFMGQFE
SERC_BACCZ      TTPSE--ELNNEFLQKAKERGLVTLKGHRSV--GGMRASIYNAMPVQGVQQLVNYMKEFE
SERC_BACHK      TTPSE--ELNNEFLQKAKERGLVTLKGHRSV--GGMRASIYNAMPAHGVQQLVNYMKEFE
SERC_BACC1      TTPSE--ELNSEFLQKAKERGLVTLKGHRSV--GGMRASIYNAMPAEGVQQLVNYMKEFE
SERC_BACCR      TTPSE--ELNSEFLQKAKERGLVTLKGHRSV--GGMRASIYNAMPVQGVQQLVNYMKEFE
SERC_STRT1      VTPSK--DLDAKFVAEADALGFKNIKGHRSV--GGMRASVYNAFPRQGVLDLIDFMKKFE
SERC_STRT2      VTPSK--DLDAKFVAEADALGFKNIKGHRSV--GGMRASVYNAFPRQGVLDLIDFMKKFE
SERC_STRMU      VTPSQ--DLDAKFVKEADALGFKNIKGHRSV--GGMRASLYNAFPRQGVLDLIDFMKKFE
SERC_STRA3      ITINK--DLDEKFVKEATERGFKNIKGHRSV--GGMRASLYNAFPKQGVIELIDFMKTFE
SERC_LACLA      TSPSQ--ELDELFTQKAEEKGFKSLKGHRSV--GGMRASIYNAFPLEGVVELVKFMKEFE
SERC_LISMF      VTNSA--EFDKAFVQEAEANGFKNLKGHRSV--GGMRASLYNAFPIEGVEALIAFMEKFA
SERC_LISMO      VTNSA--EFDKAFVKEAEANGFENLKGHRSV--GGMRASLYNAFPIEGVEALIAFMEKFA
SERC_LISIN      VTNSA--EFDKAFVKEAEANGFKNLKGHRSV--GGMRASLYNAFPIEGVEALIAFMEKFA
SERC_LACPL      VTGQA--DLDAAVIQGAREHGLLNLKGHRLV--GGMRASLYNAMPLAGVQALVDYLAAFE
SERC_LEPIC      LLKDK--NLDSKFLDEAEKNGLHGLGGHRLV--GGFRASIYNSMPLTGVQKLVSFMKDFE
SERC_LEPIN      LLKDK--NLDSKFLDEAEKNGLHGLGGHRLV--GGFRASIYNSMPLTGVQKLVSFMKDFE
SERC_DESPS      NLPTA--ELEAKFIAEASALQMKGLKGHRSI--GGCRASIYNAFPREGVVKLVEFMQVFA
SERC_RHOBA      NLPSD--ELTAKFIAEAAEHKLAALKGHRSV--GGIRASIYNAMPREGVNALASFMNNFA
SERC_ALKHC      TLPTE--ELTQQFLSEAKEKGFVGLNGHRSV--GGCRASIYNGVPVEACEALADFMHSFY
SERC_GEOKA      TLPNE--ELTKTFLAEAKERGFVGLGGHRSV--GGCRASIYNAVPLEACEALASFMNEFR
SERC_BACSU      TLRDD--ELTKTFVQKAKDAKMIGLGGHRSV--GGCRASIYNAVSLEDCEKLAAFMKKFQ
SERC_BACSK      TLAND--ALTSVFLQEAKEAGFVGLNGHRSV--GGLRASIYNAVPYASCEALVDFMKQFK
SERC_BACCI      RLASE--ELEKEFVKASEQEGFVGLKGHRSV--GGLRASIYNAVPYESCEALVQFMEHFK
SERC_BACFN      VMAPEYKDLEADFLKFATDKGMSGIKGHRSV--GGFRASCYNAMPKESVQALIDCMQEFE
SERC_BACFR      VMAPEYKDLEADFLKFATDKGMSGIKGHRSV--GGFRASCYNAMPKESVQALIDCMQEFE
SERC_BACTN      VMAPEYKDLEADFMKFATEKGMVGIKGHRSV--GGFRASCYNALPKESVQALIDCMQEFE
SERC_PORGI      VMKDEYKELEKEFATFAASRGMVGIKGHRSV--GGFRASLYNALPIESVQSLVSVMKEFE
SERC_CAMJE      NIAKN-KDLEPLFVKEAEEAGMIGLKGHRIL--GGIRASIYNALNLDQVKTLCEFMKEFQ
SERC_CAMJR      NIAKN-KDLEPLFVKEAEEAGMIGLKGHRIL--GGIRASIYNALNLDQVKTLCEFMKEFQ
SERC_MYCA1      TIDLVDDVDAAAVAKILRANGVVDTEPYRKLGRNQLRVGMFPAVDPDDVSALTQCVDWVV
SERC_MYCPA      TIDFVDDVDAAAVAKILRANGVVDTEPYRKLGRNQLRVGMFPAVDPDDVSALTQCVDWVV
SERC_MYCBO      TIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVV
SERC_MYCTU      TIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVV
SERC_MYCLE      TIDFTDDVDAAAVAKILRANGIIDTEPYRKLGRNQLRVAMFPAVEPDDVRALTECVDWIV
SERC_MYCSJ      TIDFADDVDAAAVAKVLRANGIVDTEPYRKLGRNQLRVAMFAAVDPEDVSALTRCVDWVV
SERC_MYCSK      TIDFADDVDAAAVAKVLRANGIVDTEPYRKLGRNQLRVAMFAAVDPEDVSALTRCVDWVV
SERC_MYCSS      TIDFADDVDAAAVAKVLRANGIVDTEPYRKLGRNQLRVAMFAAVDPEDVSALTRCVDWVV
SERC_MYCVP      TVDFSDSVDAAAVAKVLRANGVVDTEPYRKLGRNQLRVGMFPAVEPDDVSALTACVDWVV
SERC_METAC      KVDLSDEKLKELIKTLEKEKVAYDIGSYRDA-PSGLRIWCGATVEKEDLECLCEWIEWAY
SERC_METBF      KVDLSDEKLKELIKTLEKEKVAYDIGSYRDA-PSGLRIWCGATVEKEDLQCLCEWIEWAY
SERC_METMA      KVDLSEEKLKELIKMLENEKVAYDIGSYRDA-PSGLRIWCGATIEKEDLECLCEWIEWAY
                            .              :     .  *      .       *   :    

SERC_PSEAE      KEHG------
SERC_PSEPK      KEHG------
SERC_PSEST      KEHG------
SERC_PSESM      KEHG------
SERC_ACIAD      QKHG------
SERC_CHRVO      RQYG------
SERC_NITEU      KNHA------
SERC_BORBR      RRHG------
SERC_BORPA      RRHG------
SERC_BORPE      RRHG------
SERC_RALSO      RTAA------
SERC_AROAE      ARNG------
SERC_NEIMA      RRYG------
SERC_NEIMB      RRYG------
SERC_NEIG1      RRYG------
SERC_XANAC      QRHG------
SERC_XANOR      QRHG------
SERC_XANCP      QRHG------
SERC_XYLFA      QRYG------
SERC_XYLFT      QRYG------
SERC_ECOLI      RRHG------
SERC_SHIFL      RRHG------
SERC_ECO57      RRHG------
SERC_ECOL6      RRHG------
SERC_SALCH      RRHG------
SERC_SALTY      RRHG------
SERC_SALGL      RRHG------
SERC_SALTI      RRHG------
SERC_YERPE      RRHG------
SERC_YERPS      RRHG------
SERC_YERE8      RRHG------
SERC_PECAS      RRHG------
SERC_PHOLL      RRNG------
SERC_XENNA      RRNG------
SERC_VIBVU      QENA------
SERC_VIBVY      QENA------
SERC_VIBPA      QNYA------
SERC_VIBCH      AQYA------
SERC_ALIF1      EKYV------
SERC_PHOPR      QKNA------
SERC_SHEON      AKHYNI----
SERC_IDILO      RKLG------
SERC_BLOFL      KKYG------
SERC_BUCBP      KKYG------
SERC_WIGBR      KRYG------
SERC_BUCAI      KRYG------
SERC_BUCAP      KKYG------
SERC_HAEIN      TENLPQ----
SERC_PASMU      AENR------
SERC_MANSM      AENA------
SERC_HAEDU      QENR------
SERC_LEGPH      KENG------
SERC_LEGPL      KENG------
SERC_LEGPA      KENG------
SERC_COXBU      KRHG------
SERC_BACCZ      LENR------
SERC_BACHK      LENR------
SERC_BACC1      LENR------
SERC_BACCR      LENR------
SERC_STRT1      DENK------
SERC_STRT2      DENK------
SERC_STRMU      AENK------
SERC_STRA3      AENA------
SERC_LACLA      EGYK------
SERC_LISMF      NARKGGEVRV
SERC_LISMO      NARKGGEVRV
SERC_LISIN      NARKGGEVRV
SERC_LACPL      AHHR------
SERC_LEPIC      SKI-------
SERC_LEPIN      SKI-------
SERC_DESPS      ANNPA-----
SERC_RHOBA      SKNS------
SERC_ALKHC      QTHR------
SERC_GEOKA      RRFA------
SERC_BACSU      QENE------
SERC_BACSK      NKHAEKGATV
SERC_BACCI      RSRG------
SERC_BACFN      KLH-------
SERC_BACFR      KLH-------
SERC_BACTN      KLH-------
SERC_PORGI      AKH-------
SERC_CAMJE      GKYA------
SERC_CAMJR      GKYA------
SERC_MYCA1      ERL-------
SERC_MYCPA      ERL-------
SERC_MYCBO      ERL-------
SERC_MYCTU      ERL-------
SERC_MYCLE      ERL-------
SERC_MYCSJ      ERL-------
SERC_MYCSK      ERL-------
SERC_MYCSS      ERL-------
SERC_MYCVP      ERL-------
SERC_METAC      NLVK------
SERC_METBF      NLVK------
SERC_METMA      DLVK------