CLUSTAL format seed alignment for MF_00161

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LSPA_HELPY      ---------------------------------------MLKTTKKSLLVFMGVFFLIFG
LSPA_HELPH      ---------------------------------------MLKTTKKSLLVFMGGFFLIFG
LSPA_HELPJ      ---------------------------------------MLNTTQKSLLVFMGVFFLIFG
LSPA_HELAH      ---------------------------------------MLKTTQTSLFIFIGVFLLIFG
LSPA_WOLSU      -------------------------------------------MRIALFRSLGLFVLVFA
LSPA_SULDN      ---------------------------------------MHNKTVRHLTILILTIAGIFI
LSPA_BORBU      --------------------------------------MSAKSKQYFNIFVFIISL--IF
LSPA_BORBP      --------------------------------------MGAKSKQYFNIFVFVISL--IF
LSPA_BORAP      --------------------------------------MSVKSKQYFNIFIFIISL--IF
LSPA_TREPA      ------------------------------------MKLTRIQKEKWIPLFAAGLV--VV
LSPA_TREDE      ---------------------------------------MNNKKDYYLPFLLTAIV--IV
LSPA_LEPIC      -----------------------------------MKYFEKRFLDVYRPIYLGVIFLGIV
LSPA_LEPIN      -----------------------------------MKYFEKRFLDVYRPIYLGVIFLGIV
LSPA_LEPBJ      -----------------------------------MKYFEKRFLDVYRPLYIGVIFLGII
LSPA_LEPBL      -----------------------------------MKYFEKRFLDVYRPLYIGVIFLGII
LSPA_CHLCV      --------------------------------------MSSRSRSTFLAISFFVLI--DW
LSPA_CHLAB      --------------------------------------MSSRSRSTFLAIACFVLI--DW
LSPA_CHLFF      --------------------------------------MSNRSRSTLLTISFFVLI--DW
LSPA_CHLPN      --------------------------------------MATRFRSTLLVITLFVLI--DW
LSPA_CHLTR      --------------------------------------MPTRSLPTFLTLLLLASI--DW
LSPA_CHLTA      --------------------------------------MPTRSLPTFLTLLLLASI--DW
LSPA_CHLMU      --------------------------------------MTTRSLSTFLTSFLLVSL--DW
LSPA_BUCAI      -------------------------------------MKQKYSKKSKKWIYITTIIFILI
LSPA_BUCAP      -------------------------------------MKRKYY-----WIYINIIFFIIT
LSPA_BUCBP      -------------------------------------MKIPLIY-NRILILFFFIANIII
LSPA_FRATO      -----------------------------------------MNLLRPKLKYFILAILIIA
LSPA_FRATT      -----------------------------------------MNLLRPKLKYFILAILIIA
LSPA_FRAT1      -----------------------------------------MNLLRPKLKYFILAILIIA
LSPA_FRATH      -----------------------------------------MNLLRPKLKYFILAILIIA
LSPA_FRATN      -----------------------------------------MNLLRPKLKYFILAILIIA
LSPA_RICCN      ------------------------------------MLPLLKKLYLTFARSSRIIITLVI
LSPA_RICFE      ------------------------------------MFLLLKKLYITFARSSRIIITLVI
LSPA_RICPR      ------------------------------------MISLLKKLYFTFSRSSRIIITLVI
LSPA_RICTY      ------------------------------------MISLFKKLYFTFSRSSRIIITLVI
LSPA_RICBR      ------------------------------------MILSFKKLYLTFARSSRIIITLVI
LSPA_WIGBR      --------------------------------------------MKTKSNLIIISIF--L
LSPA_BLOFL      --------------------------------------------MYTKYKWLYLSIFFML
LSPA_PELUB      ---------------------------------------MNKINLKNFYLNLVIILVVFI
LSPA_AQUAE      ---------------------------------------MENFLRKTAWLYLSIAVSVFL
LSPA_ECOLI      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_SHISS      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_SHIBS      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_ECOK1      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_ECOUT      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_ECOL6      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_SHIDS      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_SHIFL      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_ECO57      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_ECOL5      ---------------------------------------MSQSICSTGLRWLWLVVVVLI
LSPA_SHIF8      ---------------------------------------MSQSICSTGLRWLWLVVIVLI
LSPA_SALTI      ---------------------------------------MSKPLCSTGLRWLWLVVVVLI
LSPA_SALPA      ---------------------------------------MSKPLCSTGLRWLWLVVVVLI
LSPA_SALTY      ---------------------------------------MSKPLCSTGLRWLWLVVVVLI
LSPA_SALCH      ---------------------------------------MSKPLCSTGLRWLWLVVVVLI
LSPA_KLEAK      ---------------------------------------MSKSICSTGLRWLWVVVAVLI
LSPA_YERPE      ---------------------------------------MNKPICSTGLRWLWLAVVVVI
LSPA_YERPS      ---------------------------------------MNKPICSTGLRWLWLAVVVVI
LSPA_YERPA      ---------------------------------------MNKPICSTGLRWLWLAVVVVI
LSPA_YERPN      ---------------------------------------MNKPICSTGLRWLWLAVVVVI
LSPA_YERE8      ---------------------------------------MSKPICSTGLRWLWLAVLVVI
LSPA_PHOLL      ---------------------------------------MNKPICSTGLRWLWLVVVVLI
LSPA_SODGM      ---------------------------------------MNRTIMSTGLRWLWLALVVLA
LSPA_SHESM      ---------------------------------------MPLTWKDSGLRWYWVVVLVFL
LSPA_SHESR      ---------------------------------------MPLTWKDSGLRWYWVVVLVFL
LSPA_SHEON      ---------------------------------------MPLTWKDSGLRWYWVVVLVFL
LSPA_VIBVU      ------------------------------------MSGKAQIFKQTGVRWLWLALVVFL
LSPA_VIBVY      ------------------------------------MSGKAQIFKQTGVRWLWLALVVFL
LSPA_VIBPA      ------------------------------------MSEKALTLKQSGVRWLWLAIVIFL
LSPA_VIBCH      ------------------------------------MSNSSLALKQSGLRWLWLALLVFI
LSPA_HAEIN      -----------------------------------------MSK-KSGLSFLWLSAVAFV
LSPA_HAEI8      -----------------------------------------MSK-KSGLSFLWLSAVAFV
LSPA_PASMU      -----------------------------------------MTKSKSGLSFLWLSAVTFL
LSPA_HAES1      -----------------------------------------MNLSKTGLPFLWISAVAFF
LSPA_HAEDU      -----------------------------------------MAK-QSGIKWLWLSLVVIT
LSPA_PSEAE      -------------------------------MPD--------VDRFGRLPWLWITVLVFV
LSPA_PSEAB      -------------------------------MPE--------VDRFGRLPWLWITVLVFV
LSPA_PSEF5      -------------------------------MPN-------AAGRFGRLGWLWLSVLVLV
LSPA_PSEPF      -------------------------------MPN-------AVGRFGRLSWLWLSLLVLV
LSPA_PSEFL      -------------------------------MPN-------ADSRFGRLGWLVLSLLVLV
LSPA_PSEPK      -------------------------------MPNP------AAGRFGRLAWLWLSLLVLV
LSPA_PSESM      -------------------------------MPDAT----LSNTSLGRLAWLWLTVLIVA
LSPA_XYLFA      -------------------------------MTR--------PTHPNALIWLLLSIAIIA
LSPA_XYLFT      -------------------------------MTR--------PTHPNALIWLLLSIAIIA
LSPA_XANAC      -------------------------------MSQ--------RPNPSALIWLLLSALVVG
LSPA_XANC5      -------------------------------MSQ--------RPNPSALIWLLLSVLVVG
LSPA_XANOM      -------------------------------MSQ--------RPNPSALIWLLLSALVIG
LSPA_XANOR      -------------------------------MSQ--------RPNPSALIWLLLSALVIG
LSPA_XANC8      -------------------------------MSQ--------RPNPSALIWLLLSAVVIG
LSPA_XANCP      -------------------------------MSQ--------RPNPSALIWLLLSAVVIG
LSPA_ACIAD      -------------------------------MPKLEAKKGLFQFYPHNLIWLGLSILAII
LSPA_COXBU      -------------------------------MVT--------KKSKKAWPWLWFSVLVIL
LSPA_NEIMA      ----------------------------------------MSSSVSSKTRYWVLALAAIV
LSPA_NEIMF      ----------------------------------------MSSSVSSKTRYWVLALAAIV
LSPA_NEIMB      ----------------------------------------MSSSVSSKTRYWVLALAAIV
LSPA_NEIG1      ----------------------------------------MSSSVSSKTRYWVLALAAIV
LSPA_CHRVO      ---------------------------------------MTMPGARGWPKWFALAALVIV
LSPA_RALSO      --------------------------MATRNNGKSKAAGSKSGGGHGVGPWLGLGVIWIL
LSPA_SERMA      --------------------------------------MLIIGKKLSPYALLSISGLLAA
LSPA_BRUA2      -------------------------------------MKR-----HAVWSSLFVVILAVL
LSPA_BRUAB      -------------------------------------MKR-----HAVWSSLFVVILAVL
LSPA_BRUME      -------------------------------------MKR-----HAVWSSLFVVILAVL
LSPA_BRUSU      -------------------------------------MKR-----HAVWSSLFVVILAVL
LSPA_RHILO      -------------------------------------MRS-----WSPYALL--VVAAIA
LSPA_RHIME      -------------------------------------MRQEQTLFSRPLPIALFILIALA
LSPA_BACAN      ----------------------------------------------MIYYVIAL--FVIA
LSPA_BACCZ      ----------------------------------------------MIYYVIAL--FVIA
LSPA_BACHK      ----------------------------------------------MIYYVIAL--FVIA
LSPA_BACC1      ----------------------------------------------MIYYVIAL--FVIA
LSPA_BACSU      ----------------------------------------------MLYYMIAL--LIIA
LSPA_OCEIH      ---------------------------------------------MIMYYLIAI--ALVI
LSPA_BACHD      ----------------------------------------------MIYYIVAL--VIIL
LSPA_GEOKA      ----------------------------------------------MAYYWIAA--AVVI
LSPA_LISMF      ----------------------------------------------MYYYLITL--AVIA
LSPA_LISMO      ----------------------------------------------MYYYLITL--AVIA
LSPA_LISW6      ----------------------------------------------MYYYLITL--AVIA
LSPA_LISIN      ----------------------------------------------MYYYLITL--AVIA
LSPA_STAAC      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAAM      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAA8      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAAN      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAAS      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAAW      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAA3      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAAU      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAAR      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAAB      ---------------------------------------MHKKYFIGTSILIAV--FVVI
LSPA_STAES      ---------------------------------------MKKKYYISISLLMTI--IVLV
LSPA_STAEQ      ---------------------------------------MKKKYYISISLLMTF--IVLV
LSPA_STAHJ      ---------------------------------------MKKKYYITISLIVAI--AILI
LSPA_STACT      ---------------------------------------MKKPYFVSITLFITI--AVLI
LSPA_LACLM      -------------------------------------------MKKLLSLVIIV--VGII
LSPA_LACLS      -------------------------------------------MKKLLSLVIIV--VGII
LSPA_LACLA      -------------------------------------------MKKLLSLVIIV--VGIV
LSPA_LACPL      ---------------------------------------------MWIYLILMV--ALVI
LSPA_LACS1      ---------------------------------------------MWLYIPMII--ILII
LSPA_LACSS      ---------------------------------------------MLLYIILGL--LILV
LSPA_STRP3      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRPC      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRPB      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRPF      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRPM      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRP8      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRPG      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRP1      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRPD      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRP6      -------------------------------------------MKKRLFVLSLI--LLVA
LSPA_STRA1      -------------------------------------------MRKIIIPIITI--LLIA
LSPA_STRA3      -------------------------------------------MRKIIIPIITI--LLIA
LSPA_STRA5      -------------------------------------------MRKIIIPIITI--LLIA
LSPA_STRMU      -------------------------------------------MRKIVLAVTAL--LLVA
LSPA_STRR6      ------------------------------------------MKKRAIVAVIVL--LLIG
LSPA_STRT1      -------------------------------------------MRKVAIPVAIL--ALIG
LSPA_STRT2      -------------------------------------------MRKVAIPVAIL--ALIG
LSPA_STRTD      -------------------------------------------MRKVAIPVAIL--ALIG
LSPA_ENTFA      -------------------------------------------MTRLLVVYFLISALLVG
LSPA_LACGA      ----------------------------------------MKRAKQVLYLVISL--LVVI
LSPA_LACJO      ----------------------------------------MSKAKQALYLIVSL--LVII
LSPA_CALS4      -------------------------------------------------MAIVIVAFVVF
LSPA_HUNT2      ------------------------------------------------MIFIVLIAAFVA
LSPA_CLOAB      -------------------------------------------------MEILVVAVGIL
LSPA_CLONN      -------------------------------------------------MEVLIIIFGII
LSPA_CLOTE      -------------------------------------------------MEIIIIVLGII
LSPA_CLOD6      ------------------------------------------------MLYILIIILLIG
LSPA_FUSNN      -----------------------------------MSKMCSSVEIGDSMIYIFLFLILLI
LSPA_DESAG      -------------------------------------------MRPRFFVVYLIAALVIA
LSPA_SOLUE      -------------------------------------------MPDLRWKAYGVAALIFA
LSPA_GEOMG      -------------------------------------------MKPNYRIFSIVTAVSLV
LSPA_GEOSL      -------------------------------------------MKPTYRIFNAVVLGSLV
LSPA_SYNAS      -------------------------------------------MKKPLILFLITAGLVLL
LSPA_TROW8      -------------------------------------------MTTRTLRFYALVGFLVF
LSPA_TROWT      -------------------------------------------MTTRTLRFYALVGFLVF
LSPA_MYCBO      ------MPDEPTGSADP--LTSTEEA-------GGAGEPNAPAPPRRLRMLLSVAVVVLT
LSPA_MYCTU      ------MPDEPTGSADP--LTSTEEA-------GGAGEPNAPAPPRRLRMLLSVAVVVLT
LSPA_MYCBP      ------MPDEPTGSADP--LTSTEEA-------GGAGEPNAPAPPRRLRMLLSVAVVVLT
LSPA_MYCA1      ------MPEEPTGSTAP--QDR---------------------PPRRLRLLLSVAATVLA
LSPA_MYCLE      --MMGRVPDGPTGLAAL--VPSVEEA-------------QAMLPPRRLRLLLSIAAVVLT
LSPA_RHOJR      -MDDERVSQDPTAENETDAEDRNDDD-------PSGSAPPQPVTHQRRLLLFVIAGVVLA
LSPA_STRCO      MAEAERIIGTPDIPDAAGEGQERPDADPEREQQEQEQAPERTRGKRRVAVLFAVALFAYL
LSPA_STRAW      MAEAERIIGTPDIPEAAGAEPEQADG----ESGGAGAGTERPKGRRRIAVLFAVAALAYA
LSPA_LEIXX      ---MATSRTAPTRAPSLRSSPALEAS-----------PSRTKASVGALVILAVVALCVYL
LSPA_SYNY3      --------------------------------------MARSFSLAKNPLFWQVAIAGII
LSPA_THEEB      --------------------------------------MSSRHFKIKNSLFWWVAGLALA
LSPA_SYNPX      ----------------------------------------MTGSILRRAPLLGVAGLVVL
LSPA_RHOPA      --------------------------------------------MTPVRLGVLAGIVALV
LSPA_SPHAL      ---------------------------------------MSSARSPYLRFGLIFAAVAFL
LSPA_MYCGE      ------------------------MKLRKTKFFSQLKHQVLTANQKPFLFYKLTMIGFVG
LSPA_MYCPN      -------------------------MAKAPTFFSKLLKQILFANRKPFLYYKLALILFVG
LSPA_MYCGA      ---------------------MYTFKRYLTKTKDTLIRQFKAANAKKLIKIKYPILAVMG
LSPA_BIFLO      ------------------------------------MTNQQGRLRTRVAVFACVAAAALI
LSPA_CAUVC      --------------------------------------MPSLSITRQGWIAYAIAAVTVV
LSPA_CHLTE      -----------------------------------------------MALFYLLAIAAAL
LSPA_DEIRA      ----------------------MWPFSRQQNVSRILPIVPTAPRRFPVWFPAVLVLVLIA
LSPA_PORGI      -------------------------------------MASFLSRLPQGKVVAALIVLLLV
LSPA_RHOBA      ------------------MNSAKVNPSGHAPTPAPTASQGAAFPANRYALFFGLAIAGGA
LSPA_MYCPE      ----------MIKQFFSNVYEGIKHYSNYLWELSKKQLIKIYLNKKHLIWKISIILICAF
                                                                            

LSPA_HELPY      VDQAIKYAIL--------------EGFRYESLMIDIVLVFNKGVAFSLLSFL------EG
LSPA_HELPH      VDQAIKYAIL--------------EGFRYESLMVDIVLVFNKGVAFSLLSFL------EG
LSPA_HELPJ      VDQAIKHAIL--------------EGFHYESLVIDIVLVFNKGVAFSLLSFL------EG
LSPA_HELAH      TDQAIKYAIL--------------EGFRYESSIIDIVLVFNKGVAFSLLSFL------EG
LSPA_WOLSU      IDQAIKALIL--------------GGFRWESEALSITLAFNKGVAFSMFAFL------EG
LSPA_SULDN      IDQNIKSLFV--------------DGYRYYSDCIDLILVYNKGVAFSMFAFL------DE
LSPA_BORBU      FDQLSKYLVA--KYVKLG-----SIYFSFFDDFFRIIHVRNTGILFSMGSNIH-YSLKKI
LSPA_BORBP      FDQLSKYLVV--KYVKLG-----SIYFSFFDNFFRIIHVRNTGILFSMGSDIH-YSLKKI
LSPA_BORAP      FDQLSKYLVV--KYVKLG-----SVYFSFFENFFRIIHVRNTGILFSIGSNIN-YSLKKI
LSPA_TREPA      LDQCAKLLVG--AYVPTN-----TSGVRVLGDFVRIVHVYNVGAAFSIGHQLN-QVLRTL
LSPA_TREDE      VDQVTKILVV--QYMSVN-----EV-IPVIGDLVNLRFVYNTGAAFSLGAGFG-EIARKI
LSPA_LEPIC      LDLVTKFLVI--LYFQPH-----RY-LEVFGSFFRMTLTFNTG--FVFGAFQD-NAIPSL
LSPA_LEPIN      LDLVTKFLVI--LYFQPH-----RY-LEVFGSFFRMTLTFNTG--FVFGAFQD-NAIPSL
LSPA_LEPBJ      LDLVTKFLVI--LYFEPH-----RY-LEVLGSFFRMTLTFNTG--FVFGAFQD-NAIPSL
LSPA_LEPBL      LDLVTKFLVI--LYFEPH-----RY-LEVLGSFFRMTLTFNTG--FVFGAFQD-NAIPSL
LSPA_CHLCV      VSKLAVLLYR--GNLPD------ARPILYQYSWGKLIFCICPTFNEGAAFGIF-SKYKYF
LSPA_CHLAB      VTKLAVLLYL--GNLPD------ANPILYQYSWGKLLFCICPTFNEGAAFGLF-AKYKYF
LSPA_CHLFF      VTKLAVLLYR--GNLPN------ANPILYQYSWGKLFFCICPTFNEGAAFGLF-SKYKYF
LSPA_CHLPN      VTKLVVLLQY--KDLQIL-----THPTLYTHSWGRFSFSIAPVFNEGAAFGLF-SNYKYF
LSPA_CHLTR      VSKLVVLLKS--CQLSPH-----SSAFLYSYVWGHFSFLIIPSFNEGAAFGLF-TQYKIP
LSPA_CHLTA      VSKLVVLLKS--CQLSPH-----SSAFLYSYVWGHFSFLIIPSFNEGAAFGLF-TQYKIP
LSPA_CHLMU      VSKLVVLLKS--CQLSPH-----SPALLYSYVWGHFSFLIVPSFNEGAAFGLF-AQYKIP
LSPA_BUCAI      LDISSKRLII-KYIKTYD-----T---KKIFSVLNFFHVHNHGAAFSFLS-DQNGWQKWF
LSPA_BUCAP      VDFYSKKWIL-NHLNIYE-----K---QKVFFILNLFHVHNFGAAFSILS-DQNGWQKYF
LSPA_BUCBP      LDQVSKKWII-NNLLLHE-----K---KPLISIMNIFYVRNYGTAFNFFS-NNPGEKNYI
LSPA_FRATO      ADLYTKYLAN-TYLEFAQ-----S---LKITSFFNLTLLYNHGAAFSLLSNDQTSWQMIM
LSPA_FRATT      ADLYTKYLAN-TYLEFAQ-----S---LKITSFFNLTLLYNHGAAFSLLSNDQTSWQMIM
LSPA_FRAT1      ADLYTKYLAN-TYLEFAQ-----S---LKITSFFNLTLLYNHGAAFSLLSNDQTSWQMIM
LSPA_FRATH      ADLYTKYLAN-TYLEFAQ-----S---LKITSFFNLTLLYNHGAAFSLLSNDQTSWQMIM
LSPA_FRATN      ADLYTKYLAN-TYLEFAQ-----S---VKITSFFNLTLLYNHGAAFSLLSNDQTSWQMIM
LSPA_RICCN      IDQLSKWWFI-DNLRWKS-----GL-MLKVTSFLNMVYTWNYGISFGLMR----EYYQYS
LSPA_RICFE      IDQLSKWWFI-DDLRWKP-----GL-MLKVTSFLNMVYTWNYGISFGLMR----EYYQYS
LSPA_RICPR      IDQLTKWWFI-NNLRWKP-----GL-MLKVTSVLNMVYTWNYGISFGLMR----EYYQYS
LSPA_RICTY      IDQLTKWWFI-NNLRWKP-----GL-MLKVTSILNMVYTWNYGISFGLMR----EYYQYS
LSPA_RICBR      IDQLTKWWFI-NNLRWKP-----GL-TLKVTSFLNMVYTWNYGISFGLMR----DYYQYS
LSPA_WIGBR      IDFFTKKWIL-NNYEIFD-----S---IKIFPMIKITYIRNYGIALGLFQ----SYSNLI
LSPA_BLOFL      LDGIIKYGIR-AYFQIGE-----V---LYILPGINICYIENSGLAFGLFS----EISIHY
LSPA_PELUB      FDRTTKLYIL-KLAEVET-----SV-DIYITPFLNLFLIWNKGIAFGLFS----IDGSVI
LSPA_AQUAE      LDIITKNLAE-KLFTTHV-----E-----VFPFLEFYLIYNKGVAFGLLS---ELPDPLR
LSPA_ECOLI      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_SHISS      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_SHIBS      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_ECOK1      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_ECOUT      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_ECOL6      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_SHIDS      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_SHIFL      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_ECO57      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_ECOL5      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_SHIF8      IDLGSKYLIL-QNFALG-------DTVPLFP-SLNLHASAYYGAAFSFLADS--GGWQRW
LSPA_SALTI      IDLGSKYLIL-QNFALG-------DTVGLFP-SLNLHYARNYGAAFSFLADS--GSWQRW
LSPA_SALPA      IDLGSKYLIL-QNFALG-------DTVGLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_SALTY      IDLGSKYLIL-QNFALG-------DTVGLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_SALCH      IDLGSKYLIL-QNFALG-------DTVGLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_KLEAK      IDLGSKFLIL-QNFALG-------ETVSLFP-SLNLHYARNYGAAFSFLADS--GGWQRW
LSPA_YERPE      LDISSKQWVM-AHFALY-------ESVPLIP-FFNLTYAQNFGAAFSFLADK--SGWQRW
LSPA_YERPS      LDISSKQWVM-AHFALY-------ESVPLIP-FFNLTYAQNFGAAFSFLADK--SGWQRW
LSPA_YERPA      LDISSKQWVM-AHFALY-------ESVPLIP-FFNLTYAQNFGAAFSFLADK--SGWQRW
LSPA_YERPN      LDISSKQWVM-AHFALY-------ESVPLIP-FFNLTYAQNFGAAFSFLADK--SGWQRW
LSPA_YERE8      VDLSSKQWVM-THFALY-------ESVPLIP-FFNLTYAQNFGAAFSFLADK--SGWQRW
LSPA_PHOLL      LDLGSKQLVL-QHFHLY-------ESVPLIP-YFNLTYAQNFGAAFSFLAEK--DGWQRW
LSPA_SODGM      LDLGSKQWVM-THFWLG-------ESVPVIP-FINFTYAHNPGAAFSFLADI--GGWQRW
LSPA_SHESM      ADQLSKQWVL-ANFDLF-------ESVKLLP-FFNFTYVRNYGAAFSFLSEA--GGWQRW
LSPA_SHESR      ADQLSKQWVL-ANFDLF-------ESVKLLP-FFNFTYVRNYGAAFSFLSEA--GGWQRW
LSPA_SHEON      ADQLSKQWVL-ANFDLF-------ESVQLLP-FFNFTYVRNYGAAFSFLSEA--GGWQRW
LSPA_VIBVU      ADIGIKFIVM-ENMGYGW-----ANRIEVLP-FFNLLYVHNYGAAFSFLSDQ--AGWQRW
LSPA_VIBVY      ADIGIKFIVM-ENMGYGW-----ANRIEVLP-FFNLLYVHNYGAAFSFLSDQ--AGWQRW
LSPA_VIBPA      ADIGIKYVVM-NNMGYGW-----ANRIEILP-FFNLLYVHNYGAAFSFLSDQ--AGWQRW
LSPA_VIBCH      ADITIKLIVM-DNMGYGW-----ANRIEVLP-FFNLLYVHNYGAAFSFLSDQ--EGWQRW
LSPA_HAEIN      IDLLTKYIVV-QKFDLY-------ESVNVLP-VFNLTYVRNYGAAFSFLADH--SGWQQY
LSPA_HAEI8      VDLLTKYIVV-QKFDLY-------ESVNVLP-VFNLTYVRNYGAAFSFLADH--SGWQQY
LSPA_PASMU      LDLSSKYFVV-KNFELY-------ESINILP-VFNLTYVRNYGAAFSFLADH--DGWQKY
LSPA_HAES1      TDLITKLAVV-KNFSLY-------ESINILP-FFNLTYVRNHGAAFSFLADH--AGWQKY
LSPA_HAEDU      LDLFSKYLVV-ERFELY-------ESINILP-IFNLTYARNYGAAFSFLADH--SGWQKY
LSPA_PSEAE      LDQVSKAFFQ-AELSMY-------QQIVVIPDLFSWTLAYNTGAAFSFLADS--SGWQRW
LSPA_PSEAB      LDQLSKAFFQ-AELSMY-------QQIVVIPDLFSWTLAYNTGAAFSFLADS--SGWQRW
LSPA_PSEF5      IDQVSKLHFE-SSLSMY-------QQIVVIPDYFSWTLAYNTGAAFSFLADG--SGWQRW
LSPA_PSEPF      IDQASKFYFE-GKLEMF-------QQIVVIPDLFSWTLAYNTGAAFSFLADS--SGWQRW
LSPA_PSEFL      IDQVSKAHFE-GSLEMF-------QQIVVIPDYFSWTLAYNTGAAFSFLADG--GGWQRW
LSPA_PSEPK      IDQATKLYFN-NALTMY-------QQIVVIPDYFSWTLAYNTGAAFSFLADG--AGWQRW
LSPA_PSESM      VDQVSKYYFE-NALSLY-------QQIIVIPDYFSWTLAYNTGAAFSFLADG--AGWQRW
LSPA_XYLFA      LDQATKAWVL-TSLPEY-------IPVPVIHGFWNWYRSYNTGAAFSFLSDA--GGWQMW
LSPA_XYLFT      LDQATKAWVL-TSLPEY-------IPVPVIHGFWNWYRSYNTGAAFSFLSDA--GGWQMW
LSPA_XANAC      LDQWSKAWVL-SSLPEY-------TPVPVIDGFWNWYRTYNTGAAFSFLSDA--GGWQLW
LSPA_XANC5      LDQWSKAWVL-SSLPEY-------TPVPVIDGFWNWYRTYNTGAAFSFLSDA--GGWQLW
LSPA_XANOM      LDQWSKAWVL-SSLPEY-------TSVPVIDGFWNWYRTYNTGAAFSFLSDA--GGWQLW
LSPA_XANOR      LDQWSKAWVL-SSLPEY-------TSVPVIDGFWNWYRTYNTGAAFSFLSDA--GGWQLW
LSPA_XANC8      LDQWSKAWVL-SSLPEY-------TPVPVIDGFWNWYRTYNTGAAFSFLSDA--GGWQLW
LSPA_XANCP      LDQWSKAWVL-SSLPEY-------TPVPVIDGFWNWYRTYNTGAAFSFLSDA--GGWQLW
LSPA_ACIAD      IDQWTKWIAS-THLNYA-------DPVPVLP-FLNWTLLHNYGAAFSFLSDA--GGWQHY
LSPA_COXBU      LDQLSKYLAN-HFLSLG-------HPVKILP-FLNFTLNYNTGAAFSFLGTE--NGWQII
LSPA_NEIMA      LDQWSKWAVL-SSFQYR-------ERVNVIPSFFDLTLVYNPGAAFSFLADQ--GGWQKY
LSPA_NEIMF      LDQWSKWAVL-SSFQYR-------ERVNVIPSFFDLTLVYNPGAAFSFLADQ--GGWQKY
LSPA_NEIMB      LDQWSKWAVL-SSFQYR-------ERVNVIPSFFDLTLVYNPGAAFSFLADQ--GGWQKY
LSPA_NEIG1      LDQWSKWAVL-SSFQYR-------ERVNVIPSFFDLTLVYNPGAAFSFLADQ--GGWQKY
LSPA_CHRVO      LDQISKLYFN-SRFQYG-------EIRPVVEGFFNFTLVYNPGAAFSFLHDA--GGWQKY
LSPA_RALSO      LDQLTKIAIL-KTFAYG-------ESRP-ITGFFNLVLAYNRGAAFSFLAAA--GGWQRW
LSPA_SERMA      SDQAVKWLVQ-QSMAYG-------EYVSVTP-FFNWVHLWNTGAAFSLFANG--GGWQRY
LSPA_BRUA2      IDQGIKYLVE-SRMFYG-------QQIDLLP-FLALFRTHNEGIAFSMLA-----WLHDG
LSPA_BRUAB      IDQGIKYLVE-SRMFYG-------QQIDLLP-FLALFRTHNEGIAFSMLA-----WLHDG
LSPA_BRUME      IDQGIKYLVE-SRMFYG-------QQIDLLP-FLALFRTHNEGIAFSMLA-----WLHDG
LSPA_BRUSU      IDQGIKYLVE-SRMFYG-------QQIDLLP-FLALFRTHNEGIAFSMLA-----WLHDG
LSPA_RHILO      LDQWIKHLVE-TGLPFQ-------EKLDLVP-FLALFRTYNTGIAFSMFS-----SFGDT
LSPA_RHIME      ADQFIKYLVE-AYLPFQ-------QGVPVMP-MLALYRTYNYGVAFSMLS-----GMEGW
LSPA_BACAN      IDQISKWLIV-KNMELG-------TSIPIIDNVLYITSHRNRGAAWGILENK-----MWF
LSPA_BACCZ      IDQISKWLIV-KNMELG-------TSIPIIDNVLYITSHRNRGAAWGILENK-----MWF
LSPA_BACHK      IDQISKWLIV-KNMELG-------TSIPIIDNVLYITSHRNRGAAWGILENK-----MWF
LSPA_BACC1      IDQISKWLIV-KNMELG-------TSIPIIDNVLYITSHRNRGAAWGILENK-----MWF
LSPA_BACSU      ADQLTKWLVV-KNMELG-------QSIPIIDQVFYITSHRNTGAAWGILAGQ-----MWF
LSPA_OCEIH      IDQLTKWLVV-SRMELG-------ESISVIDNFFYITSHRNTGAAWGILEGQ-----MLL
LSPA_BACHD      LDQWTKWLVV-RHMEIG-------ESIPLLDSVLYLTSHRNKGAAFGILEGQ-----MWL
LSPA_GEOKA      LDQWTKWLVV-RYMQLG-------ESIPIIDNVLYITSHRNRGAAWGMLEGQ-----FWL
LSPA_LISMF      LDQLTKWIVV-QNMEIG-------QKIEVIPGFLYWTSYRNDGAAWSILEGH-----MWF
LSPA_LISMO      LDQLTKWIVV-QNMEIG-------QKIEVIPGFLYWTSYRNDGAAWSILEGH-----MWF
LSPA_LISW6      LDQLTKWFVV-QNMEIG-------QKIEVIPGFLYWTSYRNDGAAWSILEGH-----MWF
LSPA_LISIN      LDQLTKWIVV-QNMEIG-------QKIEVIPGFLYWTSYRNDGAAWSILEGH-----MWF
LSPA_STAAC      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAAM      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAA8      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAAN      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAAS      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAAW      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAA3      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAAU      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAAR      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAAB      FDQVTKYIIA-TTMKIG-------DSFEVIPHFLNITSHRNNGAAWGILSGK-----MTF
LSPA_STAES      FDQVSKWLIT-ISMKVG-------DSYEIIPNFLNITSHRNNGAAWGILSGK-----MLF
LSPA_STAEQ      FDQVSKWLIT-ISMKVG-------DSYEIIPNFLNITSHRNNGAAWGILSGK-----MLF
LSPA_STAHJ      IDQVTKRIIA-TTMNIG-------DSYEVIPNFLNITSHRNNGAAWGILSGK-----MGF
LSPA_STACT      LDQVTKAVIA-KSMAIG-------DSYTVIPKFLYITSHRNNGAAWGILSGR-----MSF
LSPA_LACLM      ADQVFKNWVV-ANIQLG-------DTKKIWPDVLSLTYIKNDGAAWSSFSGQ-----QWF
LSPA_LACLS      ADQVFKNWVV-ANIQLG-------DTKKIWPDVLSLTYIKNDGAAWSSFSGQ-----QWF
LSPA_LACLA      ADQIFKNWIV-ANIQLG-------DTEKIWPNVLSLTYIKNDGAAWSSFSGQ-----QWF
LSPA_LACPL      IDQVIKAAIV-SHIALG-------ASTSIVTGLLSLTNLHNNGAAWSILEGK-----MWF
LSPA_LACS1      ADQGLKFWIS-VNIKLG-------TSQVILPNVLALTNVRNDGAAWSVLSGQ-----QWF
LSPA_LACSS      GDQLLKGWIV-ANVSYG-------ALHTVIPNILGLTYVQNDGAAWSMLAGQ-----QWF
LSPA_STRP3      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRPC      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRPB      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRPF      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRPM      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRP8      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRPG      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRP1      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRPD      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRP6      LDQLSKFWIV-SHIALG-------EVKPFIPGIVSLTYLQNNGAAFSILQDQ-----QWF
LSPA_STRA1      LDQLSKLWIV-KHIELN-------QIKEFIPNIVSLTYLRNYGAAFSILQNQ-----QWL
LSPA_STRA3      LDQLSKLWIV-KHIELN-------QIKEFIPNIVSLTYLRNYGAAFSILQNQ-----QWL
LSPA_STRA5      LDQLSKLWIV-KHIELN-------QIKEFIPNIVSLTYLRNYGAAFSILQNQ-----QWL
LSPA_STRMU      LDQLSKFFVV-KYIRLG-------TIVEFIPNLVSLTYLRNTGAAFSILENQ-----QWL
LSPA_STRR6      LDQLVKSYIV-QQIPLG-------EVRSWIPNFVSLTYLQNRGAAFSILQDQ-----QLL
LSPA_STRT1      LDQWVKHWVV-ANISLN-------QVIKAIPGVFSLTYLQNRGAAFSILQNQ-----KYF
LSPA_STRT2      LDQWVKHWVV-ANISLN-------QVIKAIPGVFSLTYLQNRGAAFSILQNQ-----KYF
LSPA_STRTD      LDQWVKHWVV-ANISLN-------QVIKAIPGVFSLTYLQNRGAAFSILQNQ-----KYF
LSPA_ENTFA      LDQWSKYLTV-QNISLG-------ETKEFIPGFLSLTHLRNTGAAWSLLEGK-----MIF
LSPA_LACGA      ADQGLKNYIV-TNFKIG-------DEHTVIPGILSFTYLQNDGAAWNIFSGQ-----MIL
LSPA_LACJO      ADQLLKNYIV-TNFKIG-------DEKTIIPGVLSFTYLQNDGAAWNIFSGQ-----MIL
LSPA_CALS4      LDQFTKYLAA-KYLMPI-------GSYPVIKHFFHLTYVENRGAAFGMLQNK-----TLF
LSPA_HUNT2      ADQLTKYIVV-RNIEFG-------DKISVIDNFFYLTHWRNTGAAWGIMQNG-----RYI
LSPA_CLOAB      VDRLTKIWAL-DKLKKV-------QDIPIIKNFFDLTYVENRGAAWGIFSGK-----TLV
LSPA_CLONN      LDRITKLWAL-KELSSG-------HEIEIIKNFFSFNYLENRGAAFGIFQGK-----TVL
LSPA_CLOTE      LDRVTKLWAI-KRLSIG-------EDIVVIKDFFSFSYLENRGAAFGIFKDK-----QLF
LSPA_CLOD6      LDQLSKIWVL-NNLVDV-------STIPIINNVFHLTYVENRGAAFGLLQNN-----QWI
LSPA_FUSNN      IDQYSKFIVD-STLSVG-------ETVPVIDGFFNLTYVQNRGVAFGLFQGK-----IDI
LSPA_DESAG      VDQWTKQWAA-STIPPL-------IGYTVIPGFFDLVNVRNRGAAFGFLNRSD-IEWQFW
LSPA_SOLUE      LDRFTKWLVE-TNVSVM-------DTYHVIPGFFDIVHSENRGVAFGILNDST-SEWRTT
LSPA_GEOMG      IDQATKILVD-RTLELY-------QSIPVVPGLFSITYMRNKGAAFSFLSN---FDYRRP
LSPA_GEOSL      LDQATKVLID-RTMDLY-------QSIPVIDGLFSITYLRNRGAAFSFLAD---FSYRLP
LSPA_SYNAS      LDQFTKFYVA-SHFWLH-------ESLPVIDGFFNITYIRNPGAAFGFLAGAP-LLFRGL
LSPA_TROW8      LDQVTKYLA---HAYLA-------RDFIVIPNLFRLTLAKNSGAAFSFGTGF------SW
LSPA_TROWT      LDQVTKYLA---HAYLA-------RDFIVIPNLFRLTLAKNSGAAFSFGTGF------SW
LSPA_MYCBO      LDIVTKVVA---VQLLPP-----GQPVSIIGDTVTWTLVRNSGAAFSMATGY------TW
LSPA_MYCTU      LDIVTKVVA---VQLLPP-----GQPVSIIGDTVTWTLVRNSGAAFSMATGY------TW
LSPA_MYCBP      LDIVTKVVA---VQLLPP-----GQPVSIIGDTVTWTLVRNSGAAFSMATGY------TW
LSPA_MYCA1      LDIVTKVLA---VKLLPP-----GQPVPIIGDTVTWTLVRNSGAAFSMATGY------TW
LSPA_MYCLE      LDIVTKVLA---VKFLLP-----GKSVSIIGDTVTWTLVRNSGAAFSMATGY------TW
LSPA_RHOJR      TDLLTKILA---VANIEP-----GRPVWLIGDIVSLRLVRNPGAAFSMATGM------TW
LSPA_STRCO      LDLGSKMLV---VAKLEH-----HEPIEIIGDWLRFAAIRNAGAAFGFGEAF------TI
LSPA_STRAW      FDLVSKLIV---VAKLEH-----HAPIEIIGDWLRFEAIRNAGAAFGFGEAF------TV
LSPA_LEIXX      MDQITKALV---VSNLSE-----GQQVAVLGQLLQLHFVKNPGAAFSIGSGS------TW
LSPA_SYNY3      LDQLSKLWV--SQAMDPV-----GTTWPLWSGVFHFTYVLNTGAAFSAFRGG------AG
LSPA_THEEB      SDRLTKAWIVATYALTVP-----PQTTPIIPGVFHITYVTNTGAAFSLFANG------SI
LSPA_SYNPX      VDQATKLLA---ASQLAD-----GRIVQLLPGLINGQLVHNTGAAFSLFRGS------VQ
LSPA_RHOPA      LDQVTKLWL--LYGFELA-----RKGVVQVLPFFDLVLAWNTGISYGWFSGQG----PTG
LSPA_SPHAL      LDQVTKWIV--TVPLSLE-----PKGQIELTSFFNLTWAENCGISLSMFASCT----DTT
LSPA_MYCGE      FIILLQVFILRNALNGE-----MDNTMVANSGFINIYVIRNKGVGFSLLQNQ-----TGL
LSPA_MYCPN      FVILFQVFMLRAALNGEKGINGANGTDVARSSFISIYVIGNKGVGFSLLADQ-----PGL
LSPA_MYCGA      FFVLLIVFVLRDYFLKL------GIGHSTSTGFITINVITNSGVGFSLFNQN-----PAV
LSPA_BIFLO      VDQLTKAWAM-AALSNG-------QTIRVIPGLLSFTLVRNPGASLGMGSGA--------
LSPA_CAUVC      LDQISKLWILGLLGREP-------GASLPLLGPIHLTMVHNYGMSFGLLRDS-----DWG
LSPA_CHLTE      LDRVTKLLAI-HYLRDGA------QSIVIIPDWLKLTYAENLGIAFSVRFLP------PT
LSPA_DEIRA      LDQWLKAWAL-AHLQLNA------PAIPVIPGVLDWELTFNTGAAWSMFSGS-----AVP
LSPA_PORGI      VDQVIKIWVK-TTMVLG--------QSHVVAPWFQIHFVENPGMAFGIELGSK---LFLS
LSPA_RHOBA      LDLWSKEAIFRWRGLPGT-----QDVYWIIEGYFGIETAVNIGAVFGLGAGQ-----GLV
LSPA_MYCPE      IVLLTSFLTRNSILNATQ------SYWELIPGFLVINITGNTGVSFGTLGDS-------N
                                                                            

LSPA_HELPY      GLKYLQILLILGLFIFLMRQRELFKNHAIEFGMVFGAGVSN-VLDRF-------------
LSPA_HELPH      GLKYLQILLILGLFIFLIRQIELFKTHAIEFGMVFGAGVSN-VLDRF-------------
LSPA_HELPJ      GLKYLQILLILGLFIFLMRQKELFKSHAIEFGMVFGAGVSN-VLDRF-------------
LSPA_HELAH      SLKYLQILLILGLFIFLMRQIELFKAHTIEFGMVFGAGVSN-ILDRF-------------
LSPA_WOLSU      WLKYIQLGMLGGILLFLAYDRSFFVAHYLPLSILLAAGFSN-ILDRF-------------
LSPA_SULDN      SLKYIQLVLVFGVFGYMLYLNQL--CYAIPAGLMLGGAFSN-IYDRF-------------
LSPA_BORBU      FFLAMPIFILIFVFYLSLKERN--CIARISLLLIFSGGVGN-VIDRLFRPS---------
LSPA_BORBP      FFIAMPIFILIFVFSLALKEKN--CITRISLLLIFSGGVGN-IIDRLFRPS---------
LSPA_BORAP      FFLAMPIFILIFIFSLSLKEKN--RIARISLLLIFSGGVGN-VIDRLFRPS---------
LSPA_TREPA      VLGIVPLIIMFLIVFSYFRTDAFCPVQRWAVSGIIGGGIGN-LIDRFLRPN---------
LSPA_TREDE      LLVFLPFLLLIALTGAYLKSAELTRAQRWFICGILGGGFGN-LIDRFFRSE---------
LSPA_LEPIC      IATGVAIVFLIGYRWKNHDLGN-----PWGWNLVMAGAFGN-FLDKFFVKIPGTGFRFGF
LSPA_LEPIN      IATGVAIVFLIGYRWKNHDLGN-----PWGWNLVMAGAFGN-FLDKFFVKIPGTGFRFGF
LSPA_LEPBJ      IATGIAIVFLIGYRWKNYDLGN-----PWGWNLVMAGAFGN-FLDKFFVKIPGTGFRFGF
LSPA_LEPBL      IATGIAIVFLIGYRWKNYDLGN-----PWGWNLVMAGAFGN-FLDKFFVKIPGTGFRFGF
LSPA_CHLCV      LFAIRIAIILGILAFLFLRKKRTSPSIRFSLILLCSGAIGN-VGDILFYRH---------
LSPA_CHLAB      LFFIRITIILGILAFLFLRKKTSSPAIRFSLILLCSGAIGN-VGDIVFYRH---------
LSPA_CHLFF      LLLIRIVIILGILAFLFLRKKKTSATTRFSLILLCSGAIGN-VGDIFFYNH---------
LSPA_CHLPN      LFLLRIFVILGLLAYLFFKKKSIQSTTQTALVLLCAGAIGN-VGDIIFYGH---------
LSPA_CHLTR      LLIFRVCVILGLALFLRIKYKSLHRRTRVALTLILAGALGN-VGDILLYGK---------
LSPA_CHLTA      LLIFRVCVILGLALFLRIKYKSLHRRTRVALTLILAGALGN-VGDILLYGK---------
LSPA_CHLMU      LLIFRVFVILCLFLFLGIKFRSLHIRTRIALTLILAGALGN-VGDILFHGK---------
LSPA_BUCAI      LSTVSILTILVMTRIITKLKKQETK-KITAYSLIIAGATGN-LIDRI-------------
LSPA_BUCAP      LLIFSIIIILAIIKIMIKFKKKDKN-KILSYSLILAGAIGN-LIDRI-------------
LSPA_BUCBP      LCLISSIAILIILKTMYNNTTIENFFYNIPSAFIISGAIGN-FIDRC-------------
LSPA_FRATO      FSTISLIAAIVLIYLIIKQPITEKI-NLFSFALILGGALGN-FYDRA-------------
LSPA_FRATT      FSTISLIAAIVLIYLIIKQPITEKI-NLFSFALILGGALGN-FYDRA-------------
LSPA_FRAT1      FSTISLIAAIVLIYLIIKQPITEKI-NLFSFALILGGALGN-FYDRA-------------
LSPA_FRATH      FSTISLIAAIVLIYLIIKQPITEKI-NLFSFALILGGALGN-FYDRA-------------
LSPA_FRATN      FSTISLIAAIVLIYLIIKQPITEKI-NLFSFALILGGALGN-FYDRA-------------
LSPA_RICCN      NAIFLITNTIIVCYLYYLMIRSKTIGSFAGYSFVIGGAVGN-LIDRF-------------
LSPA_RICFE      NAIFLITNTLIVCYLYYLMIRSKTIGSFAGYSFVIGGAVGN-LIDRF-------------
LSPA_RICPR      NTIFLITNMIIVCYLYYLMICSKTIGSFAGYSFVIGGAIGN-LIDRF-------------
LSPA_RICTY      NAIFLITNMIIVCYLYHLMICSKTIGSFVGYNFVIGGAIGN-LIDRF-------------
LSPA_RICBR      NIVFLITNTIIVCYLYYLMMSSKTIGGFAGYSFVIGGAIGN-LIDRS-------------
LSPA_WIGBR      RILIIVISIFILLFIFYMKNLCKDLLSNLGYSIIIGGSFGN-IFDRI-------------
LSPA_BLOFL      RGIFIWLIFFIIIIFIIFLFKCRLIYEHFAYSIVIGGSLGN-LYDRI-------------
LSPA_PELUB      YNSITILIGLIIIAIIFMMLKNDNIQRYF-FALIAGGAFGN-FYDRI-------------
LSPA_AQUAE      LPLLLITPVIALIITFLYALYSGDRIVAISMGLIGGGALGN-LYDRL-------------
LSPA_ECOLI      FFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SHISS      FFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SHIBS      FFAGIAIGISVILAVMMYRLKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_ECOK1      FFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_ECOUT      FFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_ECOL6      FFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SHIDS      FFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SHIFL      FFAGIAIGISVLLAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_ECO57      FFAGIAIGISVTLVVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_ECOL5      FFAGIAIGISVILVVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SHIF8      FFAGIAIGISVLLAVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SALTI      FFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SALPA      FFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SALTY      FFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_SALCH      FFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_KLEAK      FFAGIAVGICVVLAVLMYRSKATQKLNNIAYALIIGGALGN-LFDRL-------------
LSPA_YERPE      FFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGN-LYDRL-------------
LSPA_YERPS      FFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGN-LYDRL-------------
LSPA_YERPA      FFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGN-LYDRL-------------
LSPA_YERPN      FFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGN-LYDRL-------------
LSPA_YERE8      FFAGIAIGISVLLMVLMYRSTAKQRLLNCAYALIIGGALGN-LFDRM-------------
LSPA_PHOLL      FFAFIAVAISVVLMVMMYRASAKKKLSNIAYALIIGGALGN-LFDRL-------------
LSPA_SODGM      AFSAIAVVIAVVLLVMMYRSDKRARLSNAAYAMIIGGALGN-LFDRM-------------
LSPA_SHESM      LFTLVAVGFSTLLTVWLRKQSASLWKLNLAYTLVIGGALGN-LIDRL-------------
LSPA_SHESR      LFTLVAVGFSTLLTVWLRKQSASLWKLNLAYTLVIGGALGN-LIDRL-------------
LSPA_SHEON      LFTIVAVGFSSLLTVWLRKQSASLLKLNLAYTLVIGGALGN-LVDRL-------------
LSPA_VIBVU      LFTGIAFVVTGLLTYWMSKLPAAEKWNNVAYAMIIGGAIGN-VFDRM-------------
LSPA_VIBVY      LFTGIAFVVTGLLTYWMSKLPAAEKWNNVAYAMIIGGAIGN-VFDRM-------------
LSPA_VIBPA      LFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYAMIIGGAVGN-VFDRV-------------
LSPA_VIBCH      LFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGN-VFDRI-------------
LSPA_HAEIN      FFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALAN-MVDRA-------------
LSPA_HAEI8      FFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGGALAN-MVDRT-------------
LSPA_PASMU      FFIVLAIAISLMLCYFLAKNQATQKLQNIAYALIIGGALGN-MIDRL-------------
LSPA_HAES1      FFILLALVVSFMILFFLYKNQATQKLQNTGYALMVGGALAN-AADRA-------------
LSPA_HAEDU      LFLTLAIIISFILANVLRRNQIDQKRENMAYALIIGGAIGN-AIDRA-------------
LSPA_PSEAE      LFALIAIVVSASLVVWLKRLKKGETWLAIALALVLGGALGN-LYDRM-------------
LSPA_PSEAB      LFALIAIVVSAILVVWLKRLKKGETWLAIALALVLGGALGN-LYDRM-------------
LSPA_PSEF5      LFALIAIAVSAVLVVWLKRLGRNETWLAIALALVLGGALGN-LYDRI-------------
LSPA_PSEPF      LFALIAIAVSAVLVVWLKRLGRNETWLAIALALVLGGALGN-LYDRI-------------
LSPA_PSEFL      LFAVIAVVVSAVLVVWLKRLGRDDTWLAIALALVLGGALGN-LYDRI-------------
LSPA_PSEPK      LFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGAIGN-LYDRI-------------
LSPA_PSESM      LFALIAVVVSAVLVVWLKRLGRDDTWLAIALALVLGGALGN-LYDRV-------------
LSPA_XYLFA      LFIALALGISGLLTFWLSRTPRREWRSALPYALIIGGGIGN-VIDRF-------------
LSPA_XYLFT      LFIALALGISGLLTFWLSRTPRREWRSALPYALIIGGGIGN-VIDRF-------------
LSPA_XANAC      FFTALAVGISGLLAFWLSRTARGQWRSALPYALVIGGAIGN-VIDRL-------------
LSPA_XANC5      FFTALAVGISGLLAFWLSRTARGQWRSALPYALVIGGAIGN-VIDRL-------------
LSPA_XANOM      FFTALAMGISGLLAFWLSRTARGHWRSALPYALVIGGAIGN-VIDRL-------------
LSPA_XANOR      FFTALAMGISGLLAFWLSRTARGHWRSALPYALVIGGAIGN-VIDRL-------------
LSPA_XANC8      FFTALAVGISGLLAFWLSRTARGDWRSAVPYALVIGGAIGN-VIDRL-------------
LSPA_XANCP      FFTALAVGISGLLAFWLSRTARGDWRSAVPYALVIGGAIGN-VIDRL-------------
LSPA_ACIAD      LFTGLAGIVSIIFIFWLMRMPKNAMILPAAIALILGGALGN-LIDRM-------------
LSPA_COXBU      FFAAISFVVSIFLILWLSRTSRSEIMMLLGLSLIIGGALGN-FIDRL-------------
LSPA_NEIMA      FFLVLAVAVSAYLVRAILRDEF-ATLGKTGAAMIIGGALGN-VIDRL-------------
LSPA_NEIMF      FFLVLAVAVSAYLVRAILRDEF-ATLGKTGAAMIIGGALGN-VIDRL-------------
LSPA_NEIMB      FFLVLAVAVSAYLVRAILRDEF-ATLGKTGAAMIIGGALGN-VIDRL-------------
LSPA_NEIG1      FFLVLAVAVSAYLVRAILRDEF-AALGKIGAAMIIGGASGN-VIDRL-------------
LSPA_CHRVO      LFTILAFAVSGWLGWNIVKRRF-SGLMNLAAAFIMGGALGN-VIDRL-------------
LSPA_RALSO      FFTGLGVAAALFIVWLLKRHSG-QKLFCFALALILGGALGN-VIDRL-------------
LSPA_SERMA      FFIGIAVVVSIFLIKLI--LENRHKGEAIAYSLILGGAMGN-LIDRV-------------
LSPA_BRUA2      GLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGN-LIDRV-------------
LSPA_BRUAB      GLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGN-LIDRV-------------
LSPA_BRUME      GLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGN-LIDRV-------------
LSPA_BRUSU      GLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGN-LIDRV-------------
LSPA_RHILO      GLVVIAVLVVAFVLYLATRTPSGHVIARTGFALIIGGALGN-LIDRA-------------
LSPA_RHIME      FIVGIRLAVVTFVLWLWRRTPKDRFFAHLGYAMIIAGALGN-LVDRL-------------
LSPA_BACAN      FYIITVVFVVFIVFYMKKYAK-TDKLLGISLGLILGGAIGN-FIDRV-------------
LSPA_BACCZ      FYIITVVFVVFIVFYMKKYAK-TDKLLGISLGLILGGAIGN-FIDRV-------------
LSPA_BACHK      FYIITVVFVVFIVFYMKKYAK-TDKLLGISLGLILGGAIGN-FIDRV-------------
LSPA_BACC1      FYIITVVFVAFIVFYMKKYAK-TDKLLGISLGLILGGAIGN-FIDRV-------------
LSPA_BACSU      FYLITTAVIIGIVYYIQRYTK-GQRLLGVALGLMLGGAIGN-FIDRA-------------
LSPA_OCEIH      FYIITTIVIIGIIYFLHTHAK-GDKLLSVALVVILGGAIGN-FIDRI-------------
LSPA_BACHD      FYIITSIVVIGIVYYMEKEAK-HDRVFATALALILGGAIGN-FIDRI-------------
LSPA_GEOKA      FYLITVIVVAAIVIYIRRLKP-SERLAGVGLGLMLGGAIGN-FLDRV-------------
LSPA_LISMF      FYLITVVVIGIIIYIMQKYAK-GKRLFSISLAFILGGAIGN-FIDRV-------------
LSPA_LISMO      FYLITVVVIGIIIYIMQKYAK-GKRLFSISLAFILGGAIGN-FIDRV-------------
LSPA_LISW6      FYLITVIVIGIIIYIMQKYAK-GKRLFSISLAFILGGAIGN-FIDRV-------------
LSPA_LISIN      FYLITVIVIGIIIYIMQKYAK-GKRLFSISLAFILGGAIGN-FIDRI-------------
LSPA_STAAC      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAAM      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAA8      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAAN      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAAS      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAAW      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAA3      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAAU      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRI-------------
LSPA_STAAR      FFIITIIILIALVYFFIKDAQ-YNLFMQVAISLLFAGALGN-FIDRV-------------
LSPA_STAAB      FFIITIIILIALVYFFINDAQ-YNLFMQVAISLLFAGALGN-FIDRV-------------
LSPA_STAES      FYIITIIILIVLVIFYIKEAQ-FNLFMQVAISLLFAGALGN-FIDRV-------------
LSPA_STAEQ      FYIITIIILIVLVIFYIKEAQ-FNLFMQVAISLLFAGALGN-FIDRV-------------
LSPA_STAHJ      FYIITIVILIVLVLFYIKEAK-YNLFMQVAISLLFAGALGN-FIDRL-------------
LSPA_STACT      FFIVTIVVLGLLVFFYIKEAK-GNFLMQVAISLLFAGALGN-FIDRM-------------
LSPA_LACLM      FLVLTPIVLIVALWFLWKK-M-GQNWYFAGLTLIIAGALGN-FIDRV-------------
LSPA_LACLS      FLVLTPIVLIVALWFLWKK-M-GQNWYFAGLTLIIAGALGN-FMDRV-------------
LSPA_LACLA      FLILTPIVLVVALWFLWKK-M-AQNWYFIGLTLIIAGALGN-FIDRI-------------
LSPA_LACPL      FYLISVIALIVMGYLLWRL-R-GKWLYEVGISLMIAGTLGN-FIDRL-------------
LSPA_LACS1      FTVITIVALGLMGYFFWKL-R-SDNLYMLAISLLIAGTLGN-FIDRI-------------
LSPA_LACSS      FYIVTIIAVGVIGYLFYTSER-SEKLYRIGLTLMLAGALGN-FIDRL-------------
LSPA_STRP3      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRPC      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRPB      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRPF      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRPM      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRP8      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRPG      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRP1      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRPD      FVVITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRP6      FVAITVLVIGYAIYYLATHPH-LNIWKQLALLLIISGGIGN-FIDRL-------------
LSPA_STRA1      FTLITIFVVCVAIIYLMKHIN-GSYWLLISLTLIISGGLGN-FIDRL-------------
LSPA_STRA3      FTLITIFVVCVAIIYLMKHIN-GSYWLLISLTLIISGGLGN-FIDRL-------------
LSPA_STRA5      FTLITIFVVGVAIIYLMKHIN-GSYWLLISLTLIISGGLGN-FIDRL-------------
LSPA_STRMU      FTVITFIVLGVAFYYLIKQMQTQNFWLLASLLLIISGGLGN-FIDRL-------------
LSPA_STRR6      FAVITLVVVIGAIWYLHKHME-DSFWMVLGLTLIIAGGLGN-FIDRV-------------
LSPA_STRT1      FVILTVLVIGAALFYLVKNYQ-KSLWLVLSLILIISGGIGN-FIDRV-------------
LSPA_STRT2      FVILTVLVIGAALFYLVKNYQ-KSLWLVLSLILIISGGIGN-FIDRV-------------
LSPA_STRTD      FVILTVLVIGAALFYMVKNYQ-KSLWLVLSLILIISGGIGN-FIDRV-------------
LSPA_ENTFA      FYVITVIVSVVIIYLLIKNYK-KSIWYSVGLSFVLAGAIGN-FIDRV-------------
LSPA_LACGA      FYLISIAAIAVVVYYLFNPKY-KNWLFDTGLALVLGGIIGN-FIDRL-------------
LSPA_LACJO      FYLISIAAIAVVIYYLFNPKY-KNGLFDTGLALVLGGIIGN-FIDRL-------------
LSPA_CALS4      FIVITVVVGIVLIYSMI-KLPE-NSLYNYTLAMILGGAIGN-LIDRV-------------
LSPA_HUNT2      LVPVTVVLSILIVYFIF-KNS--NKFYRFSLSMILGGALGN-LIDRVF------------
LSPA_CLOAB      LSAVTLLVLSAIIVYMI-KYRPKSKLARISLSLVISGALGN-LYDRV-------------
LSPA_CLONN      LVLVTLLIMIGVIYYFI-KYRPTSRFMRIGVSFIVSGALGN-LYDRI-------------
LSPA_CLOTE      LISITMVAILLMMFYLF-INKTNPKILKISLSLIISGAIGN-LIDRI-------------
LSPA_CLOD6      FIIVALLATVFGLYYL--NTRKVHIFGRLGIILIISGALGN-LIDRV-------------
LSPA_FUSNN      VSILAVIAIGLILFYFCKNFKKISFLERIAYTMIFSGAIGN-MIDRL-------------
LSPA_DESAG      LFFAAAVTAVLAIIAMTRSAKS-NPYLFTGFGLIMGGAIGN-LIDRI-------------
LSPA_SOLUE      ILVVLAGAAVIFIAAMLWNAQRLDRASFWGLSLILGGAAGN-VFDRA-------------
LSPA_GEOMG      FFIAVTLVAMAAIAITFRKLRDDQRLAAVSLSLIFSGAVGN-LIDRV-------------
LSPA_GEOSL      FFILVSVVALGVIAVTFRKLRDDQHLAAAALALIFSGALGN-LIDRV-------------
LSPA_SYNAS      FFTSVTLIAAGLILFYLIKNRVSDLMMVIPLALVLAGAMGN-LVDRI-------------
LSPA_TROW8      LFFLLGIIALIFIGWFL--PRTTGS--IVFLALLQGGIAGN-VFDRLFKPPYF-------
LSPA_TROWT      LFFLLGIIALIFIGWFL--PRTTGS--IVFLALLQGGIAGN-VFDRLFKPPYF-------
LSPA_MYCBO      VLTLIATGVVVGIFWMG--RRLVSPWWALGLGMILGGAMGN-LVDRFFRAPGP-------
LSPA_MYCTU      VLTLIATGVVVGIFWMG--RRLVSPWWALGLGMILGGAMGN-LVDRFFRAPGP-------
LSPA_MYCBP      VLTLIATGVVVGIFWMG--RRLVSPWWALGLGMILGGAMGN-LVDRFFRAPGP-------
LSPA_MYCA1      VLTLIATGVVVGIFWMG--RRLVSPWWAVGLGMILGGAMGN-LVDRFFRAPGP-------
LSPA_MYCLE      VLTLIATGVVIGIFWMG--RRLVSSWWALGLGMILGGAMGN-LVDRFFRAPAP-------
LSPA_RHOJR      LLTLVAVGVVIGVVRIG--RTLRSPWWALGLGLVLGGALGN-LVDRFFRAPGV-------
LSPA_STRCO      IFTVIAAAVIVVIARLA--RKLHSLPWAIALGLLLGGALGN-LTDRIFRAPGV-------
LSPA_STRAW      IFTVIAAAVIVVIARLA--RKLYSLPWAIALGLLLGGALGN-LTDRIFRSPGV-------
LSPA_LEIXX      IFSLVGVGVLGFVIWYA--PRIRSTAWAILFGLLLGGLLGN-LTDRLFREPGF-------
LSPA_SYNY3      WLKWLSLAVSVGLIIFAGKVP-LRKLEQLGYGCILAGAVGN-GIDRFL------------
LSPA_THEEB      WLRWLSLIVSLGLITWAILGPRLDRWQQVGYGCLLGGALGN-GIDRFL------------
LSPA_SYNPX      WLGLLSLAVTTGLLIWVVRHRTPPFWQGMAVAFLLGGTLGN-GIDRWR------------
LSPA_RHOPA      QILMLAFKAVAIVALAIWMARSTTKLATIGLGLIIGGAIGN-AIDRLAYGAVV-------
LSPA_SPHAL      RWTLVAVTGIVAAAVAFWMTREQAKGDVIALALILGGALGN-IVDRVRFGYVV-------
LSPA_MYCGE      VYFLQGLLSVIALVFLVFMVK---YSYIFWITTLAFGSLGN-FFDRLTS-----------
LSPA_MYCPN      VYFLQGFLSFIALFFLVFSTS---YNYIFWITTLAFGSLGN-FFDRLTS-----------
LSPA_MYCGA      PYLLQSLLTIIFLITFIFSKN---KALIVLLPLITFGGLAN-VIDRSVPVTLSNGTV---
LSPA_BIFLO      TWVISLLAVVACVALAVAGVRTVSMKWSVAISFAFAGALGN-LIDRVM------------
LSPA_CAUVC      RWLLIGFSILVVIGLAVWVHKATRPLLAVGIGLIIGGAIGNNLIDRV-------------
LSPA_CHLTE      GLLFLTLAISAGVVWYVHKSNNRSPLFLTAFGLILGGGIGN-LIDRV-------------
LSPA_DEIRA      LALGRILVGLGILSYLLWKPQ--GRFLTVVLSMIAAGAIGN-SIDGLQ------------
LSPA_PORGI      LFRIVAMGFCIYLLAKLVRKREHTLAFLSCLSLIIAGGIGN-IIDSIFYGVIFSGSHGQI
LSPA_RHOBA      FAAISVFAAAAIIAWLFFFKAARSCWLTFALGCITGGIIGN-LYDRLGFWWKPGLPDQ--
LSPA_MYCPE      PSLVYFVQSIPIVLGFFVLLFSSNYLLDIGVSLVFFGGLSN-IIDRSIVDNYKYLSGIS-
                                                    .  .*   *               

LSPA_HELPY      -------------VHGGVVDYVYYHYGF-----------------DFAIFNFADVMIDVG
LSPA_HELPH      -------------VHGGVVDYVYYHYGF-----------------DFAIFNFADVMIDVG
LSPA_HELPJ      -------------VHGGVVDYVYYHYGF-----------------DFAIFNFADVMIDVG
LSPA_HELAH      -------------VHGGVVDYVYYHYGF-----------------DFAIFNFADVMIDVG
LSPA_WOLSU      -------------IHGGVVDYVYWHYGF-----------------EFAIFNFADVMIDVA
LSPA_SULDN      -------------IHGGVVDMVYWHCGF-----------------DFAVFNFADVMIDVA
LSPA_BORBU      ----------------GVVDFLDLKFYGIF------------GLDRWPTFNFADSYVVIG
LSPA_BORBP      ----------------GVVDFLDFKFYGIF------------GLDRWPTFNFADSYVVIG
LSPA_BORAP      ----------------GVVDFLDFKFYGIF------------GLDRWPTFNFADSYVVIG
LSPA_TREPA      ----------------GVLDFIDVKFFGIF------------GFERWPAFNIADAVIMTC
LSPA_TREDE      ----------------GVVDFIDVKFFGIL------------GMERWPTFNAADSFIVCC
LSPA_LEPIC      QPNMG--------EYIGVVDFLDFDWPDFL------------LFSRWPAFNVADSCVTIG
LSPA_LEPIN      QPNMG--------EYIGVVDFLDFDWPDFL------------LFSRWPAFNVADSCVTIG
LSPA_LEPBJ      QPNVG--------EYIGVVDFLDFDWPDFL------------LFSRWPAFNVADSCVTIG
LSPA_LEPBL      QPNVG--------EYIGVVDFLDFDWPDFL------------LFSRWPAFNVADSCVTIG
LSPA_CHLCV      -----------------VVDFISIGFKRW----------------YFPTFNFADIFISLG
LSPA_CHLAB      -----------------VVDFISIGYKRW----------------FFPTFNFADIFISLG
LSPA_CHLFF      -----------------VIDFISIGYNRW----------------SFPTFNFADIFISLG
LSPA_CHLPN      -----------------IVDFISFNYKQW----------------AFPTFNVADVLISLG
LSPA_CHLTR      -----------------VVDFLSLSYYSW----------------RFPSFNLADAFISIG
LSPA_CHLTA      -----------------VVDFLSLSYYSW----------------RFPSFNLADAFISIG
LSPA_CHLMU      -----------------VVDFLSINYYSW----------------SFPSFNLADAFISLG
LSPA_BUCAI      -------------FYGFVVDFIDIHIND----------------WHFATFNIADCSIFIG
LSPA_BUCAP      -------------NYGFVIDFIDLHFKS----------------WHFATFNIADFSIFIG
LSPA_BUCBP      -------------YLGYVIDFIDFHINN----------------WHFATFNIADVSIFIG
LSPA_FRATO      -------------FQGYVIDFLDFHIGN----------------YHWPSFNIADSAITCG
LSPA_FRATT      -------------FQGYVIDFLDFHIGN----------------YHWPSFNIADSAITCG
LSPA_FRAT1      -------------FQGYVIDFLDFHIGN----------------YHWPSFNIADSAITCG
LSPA_FRATH      -------------FQGYVIDFLDFHIGN----------------YHWPSFNIADSAITCG
LSPA_FRATN      -------------FQGYVIDFLDFHIGN----------------YHWPSFNIADSAITCG
LSPA_RICCN      -------------FRGAVFDFIHFHYQN----------------YSFPVFNLADCFIIIG
LSPA_RICFE      -------------FRGAVFDFIHFHYQN----------------YSFPVFNLADCFITIG
LSPA_RICPR      -------------CRGAVFDFIHFHYRN----------------YSFPVFNLADCFITLG
LSPA_RICTY      -------------CRGAVFDFIHFHYRN----------------YSFPVFNLADCFITLG
LSPA_RICBR      -------------FRGAVFDFIHFYYQD----------------YSFPVFNLADCFITLG
LSPA_WIGBR      -------------FYGSVIDFIDIYIYK----------------WHFPVFNFADISIFIG
LSPA_BLOFL      -------------VCGKVLDYIDLYVGK----------------YHWPVFNVADIEICVG
LSPA_PELUB      -------------VYTAVPDFIDLHFYG----------------FHWFVFNVADIFITIG
LSPA_AQUAE      -------------FLGMVRDFIHLHIGE----------------YYWPAFNIADASISIG
LSPA_ECOLI      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_SHISS      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_SHIBS      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_ECOK1      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_ECOUT      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_ECOL6      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_SHIDS      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_SHIFL      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_ECO57      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_ECOL5      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_SHIF8      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICVG
LSPA_SALTI      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICIG
LSPA_SALPA      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADTAICIG
LSPA_SALTY      -------------WHGFVVDMIDFYVGN----------------WHFATFNLADSAICIG
LSPA_SALCH      -------------WHGFVVDMIDFYVGN----------------WHFATFNLADSAICIG
LSPA_KLEAK      -------------WHGFVVDMIDFYVGD----------------WHFATFNLADSAICIG
LSPA_YERPE      -------------VHGAVNDFLDFYINN----------------WHFPTFNLADVAICIG
LSPA_YERPS      -------------VHGAVNDFLDFYINN----------------WHFPTFNLADVAICIG
LSPA_YERPA      -------------VHGAVNDFLDFYINN----------------WHFPTFNLADVAICIG
LSPA_YERPN      -------------VHGAVNDFLDFYINN----------------WHFPTFNLADVAICIG
LSPA_YERE8      -------------VHGAVIDFIDFHVNN----------------WHFPTFNIADTAICIG
LSPA_PHOLL      -------------VHGFVIDFIDFYVGD----------------WHFPTFNIADMAICIG
LSPA_SODGM      -------------VHGVVIDFIDFYVGN----------------WHWPTFNVADVGICIG
LSPA_SHESM      -------------MHGFVVDFIDFYWGK----------------SHYPAFNIADSAIFIG
LSPA_SHESR      -------------MHGFVVDFIDFYWGK----------------SHYPAFNIADSAIFIG
LSPA_SHEON      -------------MHGFVVDFIDFYWGK----------------SHYPAFNIADSAIFIG
LSPA_VIBVU      -------------VHGFVVDYLDFYWGT----------------YHWPAFNLADTAICLG
LSPA_VIBVY      -------------VHGFVVDYLDFYWGT----------------YHWPAFNLADTAICLG
LSPA_VIBPA      -------------IHGFVVDYLDFYWGN----------------YHWPAFNLADMAICLG
LSPA_VIBCH      -------------VHGFVVDYLDFYWGT----------------YHWPAFNLADSTICIG
LSPA_HAEIN      -------------YNGFVVDFFDFYWDI----------------YHYPVFNIADIAICIG
LSPA_HAEI8      -------------YNGFVVDFFDFYWDI----------------YHYPVFNIADIAICIG
LSPA_PASMU      -------------YHGFVVDFFDFYWDI----------------YHYPVFNVADIAISLG
LSPA_HAES1      -------------YHGFVVDFFDFYWQQ----------------WHYPVFNIADVAICIG
LSPA_HAEDU      -------------YRGYVVDFFDFYWHI----------------YHYPVFNIADVAIVMG
LSPA_PSEAE      -------------VLGHVVDFILVHWQNR---------------WYFPAFNLADSAITVG
LSPA_PSEAB      -------------VLGHVVDFILVHWQNR---------------WYFPAFNLADSAITVG
LSPA_PSEF5      -------------ALGHVIDFILVHWQNR---------------WYFPAFNFADSAITVG
LSPA_PSEPF      -------------ALGHVIDFILVHWQNR---------------WYFPAFNFADSAITVG
LSPA_PSEFL      -------------ALGHVIDFILVHWQNR---------------HYFPAFNFADSAITVG
LSPA_PSEPK      -------------VLGHVVDFILVHWQNR---------------HYFPAFNVADSAITVG
LSPA_PSESM      -------------VLGHVIDFILVHWQNR---------------WYFPAFNVADSAITVG
LSPA_XYLFA      -------------LHGHVVDFIQWYVGS----------------HYWPSFNLADSAIVAG
LSPA_XYLFT      -------------LHGHVVDFIQWYVGS----------------YYWPSFNLADSAIVAG
LSPA_XANAC      -------------MHGHVVDFIQWYIGS----------------HTWPSFNIADSAIVGG
LSPA_XANC5      -------------MHGHVVDFIQWYIGS----------------HTWPSFNIADSAIVGG
LSPA_XANOM      -------------MHGHVVDFIQWYIGS----------------HTWPSFNIADSAIVGG
LSPA_XANOR      -------------MHGHVVDFIQWYIGS----------------HTWPSFNIADSAIVGG
LSPA_XANC8      -------------MHGHVVDFIQWYVGE----------------HTWPSFNIADSAIVGG
LSPA_XANCP      -------------MHGHVVDFIQWYVGE----------------HTWPSFNIADSAIVGG
LSPA_ACIAD      -------------TLGYVVDFIHIYYQN----------------HHFPAFNIADSAITIG
LSPA_COXBU      -------------RWSYVTDFIDFHIKD----------------WHFATFNVADSAICVG
LSPA_NEIMA      -------------IHGHVVDFLL-FYWQN---------------WFYPAFNIADSFICVG
LSPA_NEIMF      -------------IHGHVVDFLL-FYWQN---------------WFYPAFNIADSFICVG
LSPA_NEIMB      -------------IHGHVVDFLL-FYWQN---------------WFYPAFNIADSFICVG
LSPA_NEIG1      -------------IHGHVVDFLL-FYWQN---------------WFYPAFNIADSFICVG
LSPA_CHRVO      -------------AYGHVIDFIMVHYYNE---------------WYYPAFNLADSFICVG
LSPA_RALSO      -------------VYGHVVDFLD-FHLRG---------------YHWPAFNVADCGICIG
LSPA_SERMA      -------------FRGYVVDSFDFYWRD----------------WHWPAFNLADIAIVLG
LSPA_BRUA2      -------------MHGYVVDYVLFHLPT----------------WSFAVFNLADAFITIG
LSPA_BRUAB      -------------MHGYVVDYVLFHLPT----------------WSFAVFNLADAFITIG
LSPA_BRUME      -------------MHGYVVDYVLFHLPT----------------WSFAVFNLADAFITIG
LSPA_BRUSU      -------------MHGYVVDYVLFHLPT----------------WSFAVFNLADAFITIG
LSPA_RHILO      -------------VYGHVIDYILFHTPV----------------WSFAIFNLADAFISVG
LSPA_RHIME      -------------LFGYVIDYILFYTAT----------------WSFAVFNLADSFITVG
LSPA_BACAN      -------------FRQEVVDFIHVYIFS----------------YNYPVFNIADSALCIG
LSPA_BACCZ      -------------FRQEVVDFIHVYIFS----------------YNYPVFNIADSALCIG
LSPA_BACHK      -------------FRQEVVDFIHVYIFS----------------YNYPVFNIADSALCIG
LSPA_BACC1      -------------FRQEVVDFIHVYIFS----------------YNYPVFNIADSALCIG
LSPA_BACSU      -------------VRQEVVDFIHVIIVN----------------YNYPIFNIADSSLCVG
LSPA_OCEIH      -------------FRQEVVDFANFYIFD----------------YNFPIFNVADSSLTIG
LSPA_BACHD      -------------FRGEVVDFVNTYIFT----------------YNFPIFNVADSALCVG
LSPA_GEOKA      -------------FRKEVVDFIHAYIGT----------------YSFPVFNVADSALTVG
LSPA_LISMF      -------------LHQEVVDFVQTVWGN----------------YYFPIFNVADAALSVG
LSPA_LISMO      -------------LHQEVVDFVQTVWGN----------------YYFPIFNVADASLSVG
LSPA_LISW6      -------------LHQEVVDFVQTVWGN----------------YYFPIFNVADASLSVG
LSPA_LISIN      -------------LHQEVVDFVQTVWGN----------------YYFPIFNVADAALSVG
LSPA_STAAC      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAAM      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAA8      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAAN      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAAS      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAAW      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAA3      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAAU      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAAR      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAAB      -------------LTGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAES      -------------LHGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAEQ      -------------LHGEVVDFIDTNIFG----------------YDFPIFNIADSSLTIG
LSPA_STAHJ      -------------VNGEVVDFVDTNIFG----------------YDFPIFNVADSSLTIG
LSPA_STACT      -------------LHGEVVDFIDTKIFS----------------YDFPIFNGADSSLTIG
LSPA_LACLM      -------------RQGFVVDMFQTEF------------------MDFPIFNIADILLSVG
LSPA_LACLS      -------------RQGFVVDMFQTEF------------------MNFPIFNIADILLSVG
LSPA_LACLA      -------------RQGFVVDMFQTEF------------------INFPIFNIADILLSVG
LSPA_LACPL      -------------RIGYVVDMFQLDF------------------INFPIFNFADSCLTVG
LSPA_LACS1      -------------RLGYVVDMFETLF------------------MNFPIFNVADMCLTFG
LSPA_LACSS      -------------HLKYVVDMFQLEF------------------INFPIFNVADTALTCG
LSPA_STRP3      -------------RLAYVIDMVHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRPC      -------------RLAYVIDMVHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRPB      -------------RLAYVIDMVHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRPF      -------------RLAYVIDMVHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRPM      -------------RLAYVIDMVHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRP8      -------------RLAYVIDMIHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRPG      -------------RLAYVIDMIHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRP1      -------------RLAYVIDMIHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRPD      -------------RLAYVIDMIHLDF------------------MDFAIFNVADSYLTVG
LSPA_STRP6      -------------RLAYVIDMVHLDF------------------VDFAIFNVADSYLTVG
LSPA_STRA1      -------------RLGYVVDMVHLDF------------------INFAIFNVADSYLTIG
LSPA_STRA3      -------------RLGYVVDMVHLDF------------------INFAIFNVADSYLTIG
LSPA_STRA5      -------------RLGYVVDMVHLDF------------------INFAIFNVADSYLTIG
LSPA_STRMU      -------------RLGYVVDMIHLDF------------------VDFAIFNVADSYLSVG
LSPA_STRR6      -------------SQGFVVDMFHLDF------------------INFAIFNVADSYLTVG
LSPA_STRT1      -------------HLGYVVDMVQLDF------------------IDFAIFNVADSYLTVG
LSPA_STRT2      -------------HLGYVVDMVQLDF------------------IDFAIFNVADSYLTVG
LSPA_STRTD      -------------HLGYVVDMVQLDF------------------IDFAIFNVADSYLTVG
LSPA_ENTFA      -------------RLGYVVDMLQTDF------------------MNFPIFNVADSTLVVG
LSPA_LACGA      -------------HLKYVIDMLQLDF------------------VQFNIFNIADSAITVG
LSPA_LACJO      -------------HLKYVIDMLQLDF------------------IQFNIFNIADSAITVG
LSPA_CALS4      -------------RLGYVVDFIDFKF-------------------FPAVFNVADSFIVVG
LSPA_HUNT2      -------------RTDGVVDFLDFQFGN----------------YHFPVFNVADTFVVVG
LSPA_CLOAB      -------------FYKYVVDLFSLHYKDI---------------YYYPVFNVADICVVVG
LSPA_CLONN      -------------FYKYVVDFILIHYKNV---------------YYYPTFNIADILVVVG
LSPA_CLOTE      -------------KYRYVVDFIFFHYKDK---------------YHFPIFNIADVLVSLG
LSPA_CLOD6      -------------RLGFVVDYFDFRI------------------IWEYVFNIADVFVVVG
LSPA_FUSNN      -------------FRAYVVDMLDFRG------------------IWSFIFNFADVWINIG
LSPA_DESAG      -------------RFRAVIDFLDFHIGG----------------YHWPAFNVADMGICVG
LSPA_SOLUE      -------------MFGKVTDFLDLYYRD----------------YHWHTFNVADSAIVVG
LSPA_GEOMG      -------------RLGEVIDFLDVYWKT----------------HHWPAFNVADSAICVG
LSPA_GEOSL      -------------RLGEVIDFLDVYWKT----------------YHWPAFNVADSAICVG
LSPA_SYNAS      -------------RFGEVIDFLDVYIGR----------------YHWPAFNIADTAISIG
LSPA_TROW8      -------------GNGEVVDFLNTPLFS-------------------GVVFNIADLFILA
LSPA_TROWT      -------------GNGEVVDFLNTPLLS-------------------GVVFNIADLFILA
LSPA_MYCBO      -------------LRGHVVDFLSVGWW--------------------PVFNVADPSVVGG
LSPA_MYCTU      -------------LRGHVVDFLSVGWW--------------------PVFNVADPSVVGG
LSPA_MYCBP      -------------LRGHVVDFLSVGWW--------------------PVFNVADPSVVGG
LSPA_MYCA1      -------------LRGHVVDFLSVGWW--------------------PVFNVADPSVVGG
LSPA_MYCLE      -------------LRGHVVDFLSIGWW--------------------PVFNVADPSVVVG
LSPA_RHOJR      -------------MQGHVVDFVSVGWW--------------------PVFNVADSGIVCG
LSPA_STRCO      -------------FEGAVVDFIAPKHF--------------------AVFNLADSAIVCG
LSPA_STRAW      -------------FEGAVVDFIAPKHF--------------------AVFNLADSAIVCG
LSPA_LEIXX      -------------GVGHVIDFLQIPLLT-------------------AIFNLADVAIVFS
LSPA_SYNY3      --------------FGHVIDFLDFRLIN------------------FPIFNLADVSINIG
LSPA_THEEB      --------------TGEVVDFLDFRWIQ------------------FPVFNVADIAINIG
LSPA_SYNPX      --------------LGHVIDFLALVPIN------------------FPIFNPADIAINLA
LSPA_RHOPA      -------------DFALLHAEIGGKIYN------------------WYVFNIADVAIVVG
LSPA_SPHAL      -------------DFADLHI---GDFRP------------------FMIFNVADACITIG
LSPA_MYCGE      -------------ANDSVLDYFIFQNGS-------------------SVFNFADCCITFG
LSPA_MYCPN      -------------GSGEVLDYFVFSGGN-------------------SVFNLADCCITFS
LSPA_MYCGA      -------------ETNSVLDYFQFFRSS-------------------AIFNFADICIVTG
LSPA_BIFLO      YADGF--------LDGKVVDFLN---------------------YGWSVGNVADIYLVVA
LSPA_CAUVC      -------------IYGYVVDFIDVSRLY-----------------FPWVFNIADSGISVG
LSPA_CHLTE      -------------MLGHVVDFIYFDLYHGALFGI--------PLDLWPIFNVADSCITIG
LSPA_DEIRA      --------------RGQVTDMIHSPLLSAVTEAI--------NGTRFPIFNIADMCVVGG
LSPA_PORGI      AQLFPSGGGYETWFHGRVVDMFYFPLIEGVFPSWLPFWGGEEFVFFHPVFNFADSCISIG
LSPA_RHOBA      -------------WQSGVRDWILWQASDQ---------------WKWPNFNIADSLLVTG
LSPA_MYCPE      -------------TNNAVVDYFQFPFIK-----------------NSAIFNFPDTFVIIG
                                 :                                      .   

LSPA_HELPY      VGVLLLKQFFFKQKQNKIKA----------------------------------------
LSPA_HELPH      VGVLLLRQFFFKQKQNKIKA----------------------------------------
LSPA_HELPJ      VGVLLLRQFFFKQKQNKIKGIITLFK----------------------------------
LSPA_HELAH      VGVLLIRQFFFKQKQNKIKA----------------------------------------
LSPA_WOLSU      V-ALFLWQTFFKQK----------------------------------------------
LSPA_SULDN      VVWILLLNFKPKFCKNHS------------------------------------------
LSPA_BORBU      MILFLVYDFFIKRKVLNK------------------------------------------
LSPA_BORBP      MILFLVYDFFIKRKVLNT------------------------------------------
LSPA_BORAP      MILFLVYDFFIKRKAFNT------------------------------------------
LSPA_TREPA      GLLLIISFIKQEKEISSQPSCNETGGVFRT------------------------------
LSPA_TREDE      GIGLGVNLILQGIK---QKKLKDS------------------------------------
LSPA_LEPIC      LTILIFTMKLEEEK----------------------------------------------
LSPA_LEPIN      LTILIFTMKLEEEK----------------------------------------------
LSPA_LEPBJ      LTILIFTMKLEEEK----------------------------------------------
LSPA_LEPBL      LTILIFTMKLEEEK----------------------------------------------
LSPA_CHLCV      TFIFVYKLYFPTKQKIK-------------------------------------------
LSPA_CHLAB      TLIFIYKLYFPTKQKIK-------------------------------------------
LSPA_CHLFF      TLIFVYKLYFPTKQKIK-------------------------------------------
LSPA_CHLPN      TLLLVYKFYFPTKQTEKKR-----------------------------------------
LSPA_CHLTR      TLLLIGHLYFTKESKKYF------------------------------------------
LSPA_CHLTA      TLLLIGHLYFTKESKKYF------------------------------------------
LSPA_CHLMU      TLLLVGHLYFSKEDKKYF------------------------------------------
LSPA_BUCAI      IIILMRINYST-------------------------------------------------
LSPA_BUCAP      MIMIIKKNYYNS------------------------------------------------
LSPA_BUCBP      SVLFIYHNKYFLKN----------------------------------------------
LSPA_FRATO      VVILIAASLFTKKKS---------------------------------------------
LSPA_FRATT      VVILIAASLFTKKKS---------------------------------------------
LSPA_FRAT1      VVILIAASLFTKKKS---------------------------------------------
LSPA_FRATH      VVILIAASLFTKKKS---------------------------------------------
LSPA_FRATN      VVILIAASLFTKKKS---------------------------------------------
LSPA_RICCN      VIILIEDYYSTKKVIEEKAKGNYDNAQIEAMAEKIRNTDKGGNDKIASLQN---------
LSPA_RICFE      VIILIEDYYSTKKVIEEKAKGNYDNAQIEAMAEKIRNAGHNGDDIVN-------------
LSPA_RICPR      VIILMEDYFSTKKVIEETSKGNYDNLQIEVMAEKIRHTDHDS--KI--------------
LSPA_RICTY      VIILIEDYFSTKKVIEETSKENFDNLQIEAMAAKIRNTDHVSNDKI--------------
LSPA_RICBR      VIILVEDYYSAKKNIEEKAKENYDKAQIEAMAEKIRNAPQGDNDKI--------------
LSPA_WIGBR      FLILIYNKKIFIVNT---------------------------------------------
LSPA_BLOFL      MMILIIRGGWNMR-----------------------------------------------
LSPA_PELUB      VFCLILVELFFNNKKTNEKN----------------------------------------
LSPA_AQUAE      IALLILKYFFTKPALKNLVNRTR-------------------------------------
LSPA_ECOLI      AALIVLEGFLPSRAKKQ-------------------------------------------
LSPA_SHISS      AALIVLEGFLPSRAKKQ-------------------------------------------
LSPA_SHIBS      AALIVLEGFLPSRAKKQ-------------------------------------------
LSPA_ECOK1      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_ECOUT      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_ECOL6      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_SHIDS      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_SHIFL      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_ECO57      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_ECOL5      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_SHIF8      AALIVLEGFLPSKAKKQ-------------------------------------------
LSPA_SALTI      AALIVLEGFLPKPTAKEQA-----------------------------------------
LSPA_SALPA      AALIVLEGFLPKPTAKEQA-----------------------------------------
LSPA_SALTY      AALIVLEGFLPKPTAKEQA-----------------------------------------
LSPA_SALCH      AALIVLEGFLPKPTAKEQA-----------------------------------------
LSPA_KLEAK      AALIVLEGFLPSSDKKTS------------------------------------------
LSPA_YERPE      AALVIFEGFLSPVEKNAVNNDE--------------------------------------
LSPA_YERPS      AALVIFEGFLSPVEKNAVNNDE--------------------------------------
LSPA_YERPA      AALVIFEGFLSPVEKNAVNNDE--------------------------------------
LSPA_YERPN      AALVIFEGFLSPVEKNAVNNDE--------------------------------------
LSPA_YERE8      AALVIFEGFISPAEKTAMNKGE--------------------------------------
LSPA_PHOLL      AGLVIIDSFLSPDEKTIKVG----------------------------------------
LSPA_SODGM      AVLIVLEGFCRPAGKTASQKG---------------------------------------
LSPA_SHESM      AVLIIWDSFFNSKSEQDKTEEVK-------------------------------------
LSPA_SHESR      AVLIIWDSFFNSKSEQDKTEEVK-------------------------------------
LSPA_SHEON      AVLIIWDSFFNSQSEQDKTEEVK-------------------------------------
LSPA_VIBVU      AAMIILDGFRKKEEEK--------------------------------------------
LSPA_VIBVY      AAMIILDGFRKKEEEK--------------------------------------------
LSPA_VIBPA      AAMIILDGFRKKDTAKA-------------------------------------------
LSPA_VIBCH      AAMIILDGFRAKKSAPSQS-----------------------------------------
LSPA_HAEIN      AGLLVLDAFKSEKKKVQDKQVEKCGQK---------------------------------
LSPA_HAEI8      AGLLALDAFKSEKKKVQDKQVEKCGQK---------------------------------
LSPA_PASMU      AGLMILDAFKNRHEPEQRTE----------------------------------------
LSPA_HAES1      AGLLAIDAFKQNDKKESKQN----------------------------------------
LSPA_HAEDU      AGLLILETFLDKKKKSD-------------------------------------------
LSPA_PSEAE      AVMLALDMFRSKKSGEAAHG----------------------------------------
LSPA_PSEAB      AVMLALDMFRSKKSGEAAHG----------------------------------------
LSPA_PSEF5      AVMLALDMFKSKKTGEAVHD----------------------------------------
LSPA_PSEPF      AVMLALDMFKSKKTGEAVHD----------------------------------------
LSPA_PSEFL      AIMLALDMFKSKKTGETVND----------------------------------------
LSPA_PSEPK      AVMLALDMFKSKKSEDPVHD----------------------------------------
LSPA_PSESM      AIMLALDMFKSKKTGETVND----------------------------------------
LSPA_XYLFA      AIGIGLLSLFDSKHSPKTP-----------------------------------------
LSPA_XYLFT      AIGIGLLSLFDSKHSPKTP-----------------------------------------
LSPA_XANAC      AIGIAVFGLFDKSDKQQPGTGNLR------------------------------------
LSPA_XANC5      AIGIAVFGLFDKSGKQEPGTGNLR------------------------------------
LSPA_XANOM      AIGIAVFGLFDKAGKQAS------------------------------------------
LSPA_XANOR      AIGIAVFGLFDKAGKQAS------------------------------------------
LSPA_XANC8      AIGIALFGLFDGKRSRKAG-----------------------------------------
LSPA_XANCP      AIGIALFGLFDGKRSRKAG-----------------------------------------
LSPA_ACIAD      TILLLIDTFFLEKQRIQRAEVKHD------------------------------------
LSPA_COXBU      VFLLIVHMLLTPSSKP--------------------------------------------
LSPA_NEIMA      AVLAVLDNIVHRKTQEEKY-----------------------------------------
LSPA_NEIMF      AVLAVLDNIVHRKTQEEKY-----------------------------------------
LSPA_NEIMB      AVLAVLDNIVHRKTQEEKY-----------------------------------------
LSPA_NEIG1      AVLAVLDNIVHRKDSKKT------------------------------------------
LSPA_CHRVO      AALMVADSMKKPSR----------------------------------------------
LSPA_RALSO      AVLLIIDELRRVRR----------------------------------------------
LSPA_SERMA      ALLFVSSSLLGKKANTNAEPDGSD------------------------------------
LSPA_BRUA2      AGLIILEEFLGWRRE----RISH-------------------------------------
LSPA_BRUAB      AGLIILEEFLGWRRE----RISH-------------------------------------
LSPA_BRUME      AGLIILEEFLGWRRE----RISH-------------------------------------
LSPA_BRUSU      AGLIILEEFLGWRRE----RISH-------------------------------------
LSPA_RHILO      AALVVFDELIGWRREPSNAKPSKAKPSKD-------------------------------
LSPA_RHIME      AGAIILDELLQAKKE----RSLKL------------------------------------
LSPA_BACAN      VVLIIIQTLLE-GKKTKE------------------------------------------
LSPA_BACCZ      VVLIIIQTLLE-GKKTKE------------------------------------------
LSPA_BACHK      VVLIIIQTLLE-GKKTKE------------------------------------------
LSPA_BACC1      VVLIIIQTLLE-GKKTKE------------------------------------------
LSPA_BACSU      VMLLFIQMLLDSGKKKKEQ-----------------------------------------
LSPA_OCEIH      VILFLIATILE-EKRQKGKSKS--------------------------------------
LSPA_BACHD      VGILFLKMIRDERKAKKEKNA---------------------------------------
LSPA_GEOKA      VILLFVHMFFFATPEKGNE-----------------------------------------
LSPA_LISMF      VVLMLVYVFVDDRKTKGIK-----------------------------------------
LSPA_LISMO      VVLMLVYVFVDDRKTKGIK-----------------------------------------
LSPA_LISW6      VVLMLVYVFVDDRKTKGIK-----------------------------------------
LSPA_LISIN      VVLMLVYVFVDDRKTKGIK-----------------------------------------
LSPA_STAAC      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAAM      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAA8      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAAN      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAAS      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAAW      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAA3      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAAU      VILIIIALLKDTS-NKKDKEVK--------------------------------------
LSPA_STAAR      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAAB      VILIIIALLKDTS-NKKEKEVK--------------------------------------
LSPA_STAES      VIFVIIALIKDAIINKKEV-----------------------------------------
LSPA_STAEQ      VIFVIITLIKDAIINKKEV-----------------------------------------
LSPA_STAHJ      VLFIIIALLKDA--NSKE------------------------------------------
LSPA_STACT      VILVLIALLFDSR-KSKV------------------------------------------
LSPA_LACLM      FVVLFIAILTDKETK---------------------------------------------
LSPA_LACLS      FVVLFIAILTDKETK---------------------------------------------
LSPA_LACLA      FVLLFIAILTDKETK---------------------------------------------
LSPA_LACPL      VIFILIGVLRDDSFEK--------------------------------------------
LSPA_LACS1      VIIVIIALIKDEKDE---------------------------------------------
LSPA_LACSS      VICVFIAILLKEKVTHD-------------------------------------------
LSPA_STRP3      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRPC      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRPB      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRPF      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRPM      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRP8      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRPG      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRP1      VILLLICLWKEEDYGN--------------------------------------------
LSPA_STRPD      VILLVICLWKEEDYGN--------------------------------------------
LSPA_STRP6      VILLVICLWKEEDYGD--------------------------------------------
LSPA_STRA1      IICLMIALWKEESNGNHN------------------------------------------
LSPA_STRA3      IICLMIALWKEESNGNHN------------------------------------------
LSPA_STRA5      IICLMIALWKEESNGNHN------------------------------------------
LSPA_STRMU      VALLIIALWKEEKNGN--------------------------------------------
LSPA_STRR6      VIILLIAMLKEEINGN--------------------------------------------
LSPA_STRT1      VLLLILILWKEENGSHH-------------------------------------------
LSPA_STRT2      VLLLILILWKEENGSHH-------------------------------------------
LSPA_STRTD      VLLLILILWKEENGSHH-------------------------------------------
LSPA_ENTFA      VICIFIYLILDEKAAKEGKNGTN-------------------------------------
LSPA_LACGA      IVLVFIYLIFMSEKD---------------------------------------------
LSPA_LACJO      IILVFIYLIFISEKD---------------------------------------------
LSPA_CALS4      AIILGY--LMIFK-GGIR------------------------------------------
LSPA_HUNT2      TLLLAYYTLFIYK-EDKK------------------------------------------
LSPA_CLOAB      TIMIAIFIVLKDDKKDGKV-----------------------------------------
LSPA_CLONN      TIMLAIFLLR-----EGK------------------------------------------
LSPA_CLOTE      TILLIIFIIKEDGYEDRKIFS---------------------------------------
LSPA_CLOD6      TVFLCIYVLFFESKSR--------------------------------------------
LSPA_FUSNN      VVLIIVEHIFFNRKKRVK------------------------------------------
LSPA_DESAG      AFFVCLAVYKHK------------------------------------------------
LSPA_SOLUE      SCLLLIDLLRPKRQAANVS-----------------------------------------
LSPA_GEOMG      VALLALDMIRDERRQSKDN-----------------------------------------
LSPA_GEOSL      VALLAVDMIREERRKAP-------------------------------------------
LSPA_SYNAS      VLFLVVDMIQKQKEKS--------------------------------------------
LSPA_TROW8      GVFGTFLFLKGSK-----------------------------------------------
LSPA_TROWT      GVFGTFLFLKGSK-----------------------------------------------
LSPA_MYCBO      AILLVILSIFGFDFDTVGRRHADGDTVGRRKADG--------------------------
LSPA_MYCTU      AILLVILSIFGFDFDTVGRRHADGDTVGRRKADG--------------------------
LSPA_MYCBP      AILLVILSIFGFDFDTVGRRHADGDTVGRRKADG--------------------------
LSPA_MYCA1      AILLVVLSIFGYDFDTVGRRKKADQSRD--------------------------------
LSPA_MYCLE      AILLVVLSIFGFDFDTVGRRKAEFDIAGQRKAEQR-------------------------
LSPA_RHOJR      AILLVVLTLIGLEPD--GTRKGVEK-----------------------------------
LSPA_STRCO      GILIVILSFRGLDPD--GTVHKD-------------------------------------
LSPA_STRAW      GILIVLLSFRGLDPD--GTVHKD-------------------------------------
LSPA_LEIXX      MGLFLLLTLRGIGLDGRRQRDEGAGVSSASPAGDESAADKPENLSA--------------
LSPA_SYNY3      IAALLWASFFPVSSRKVD------------------------------------------
LSPA_THEEB      IVCLLWSAWHPR------------------------------------------------
LSPA_SYNPX      VLCFLVDLWSSRTSSRHG------------------------------------------
LSPA_RHOPA      VAALLYDSLIGLPAAKAP------------------------------------------
LSPA_SPHAL      VLLLVARALLLGEKAGQADAKPSVD-----------------------------------
LSPA_MYCGE      FIGLFFCFLIQMFKEFKHSKNQ--------------------------------------
LSPA_MYCPN      FIGLFLSFLIQFFKEMKQTKS---------------------------------------
LSPA_MYCGA      FALIFLTFVVDIFLDLKKKNKKTVSTTNKQLHGWKSIPLEERSKWNDWADHKCVFCNQQM
LSPA_BIFLO      GVVLVILILMGEPFSHKDLIEQSDESLQSEPEADAK------------------------
LSPA_CAUVC      VALLLLDSFLSEENKLSHQTE---------------------------------------
LSPA_CHLTE      ACMIVLFHEKIFTRKHA-------------------------------------------
LSPA_DEIRA      TILLLVASLLPERKREKAVPEA--------------------------------------
LSPA_PORGI      LILLLVCYPRTVSLLLDGKKTLPEGTTEDSEPTKRE------------------------
LSPA_RHOBA      AIMLLVQSFFFPPPPHGEADGNELPGRRAPDEPTEGTKPAAS------------------
LSPA_MYCPE      MIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEPIKKPIVIQKS-----
                                                                            

LSPA_HELPY      ------------------------------------------------------------
LSPA_HELPH      ------------------------------------------------------------
LSPA_HELPJ      ------------------------------------------------------------
LSPA_HELAH      ------------------------------------------------------------
LSPA_WOLSU      ------------------------------------------------------------
LSPA_SULDN      ------------------------------------------------------------
LSPA_BORBU      ------------------------------------------------------------
LSPA_BORBP      ------------------------------------------------------------
LSPA_BORAP      ------------------------------------------------------------
LSPA_TREPA      ------------------------------------------------------------
LSPA_TREDE      ------------------------------------------------------------
LSPA_LEPIC      ------------------------------------------------------------
LSPA_LEPIN      ------------------------------------------------------------
LSPA_LEPBJ      ------------------------------------------------------------
LSPA_LEPBL      ------------------------------------------------------------
LSPA_CHLCV      ------------------------------------------------------------
LSPA_CHLAB      ------------------------------------------------------------
LSPA_CHLFF      ------------------------------------------------------------
LSPA_CHLPN      ------------------------------------------------------------
LSPA_CHLTR      ------------------------------------------------------------
LSPA_CHLTA      ------------------------------------------------------------
LSPA_CHLMU      ------------------------------------------------------------
LSPA_BUCAI      ------------------------------------------------------------
LSPA_BUCAP      ------------------------------------------------------------
LSPA_BUCBP      ------------------------------------------------------------
LSPA_FRATO      ------------------------------------------------------------
LSPA_FRATT      ------------------------------------------------------------
LSPA_FRAT1      ------------------------------------------------------------
LSPA_FRATH      ------------------------------------------------------------
LSPA_FRATN      ------------------------------------------------------------
LSPA_RICCN      ------------------------------------------------------------
LSPA_RICFE      ------------------------------------------------------------
LSPA_RICPR      ------------------------------------------------------------
LSPA_RICTY      ------------------------------------------------------------
LSPA_RICBR      ------------------------------------------------------------
LSPA_WIGBR      ------------------------------------------------------------
LSPA_BLOFL      ------------------------------------------------------------
LSPA_PELUB      ------------------------------------------------------------
LSPA_AQUAE      ------------------------------------------------------------
LSPA_ECOLI      ------------------------------------------------------------
LSPA_SHISS      ------------------------------------------------------------
LSPA_SHIBS      ------------------------------------------------------------
LSPA_ECOK1      ------------------------------------------------------------
LSPA_ECOUT      ------------------------------------------------------------
LSPA_ECOL6      ------------------------------------------------------------
LSPA_SHIDS      ------------------------------------------------------------
LSPA_SHIFL      ------------------------------------------------------------
LSPA_ECO57      ------------------------------------------------------------
LSPA_ECOL5      ------------------------------------------------------------
LSPA_SHIF8      ------------------------------------------------------------
LSPA_SALTI      ------------------------------------------------------------
LSPA_SALPA      ------------------------------------------------------------
LSPA_SALTY      ------------------------------------------------------------
LSPA_SALCH      ------------------------------------------------------------
LSPA_KLEAK      ------------------------------------------------------------
LSPA_YERPE      ------------------------------------------------------------
LSPA_YERPS      ------------------------------------------------------------
LSPA_YERPA      ------------------------------------------------------------
LSPA_YERPN      ------------------------------------------------------------
LSPA_YERE8      ------------------------------------------------------------
LSPA_PHOLL      ------------------------------------------------------------
LSPA_SODGM      ------------------------------------------------------------
LSPA_SHESM      ------------------------------------------------------------
LSPA_SHESR      ------------------------------------------------------------
LSPA_SHEON      ------------------------------------------------------------
LSPA_VIBVU      ------------------------------------------------------------
LSPA_VIBVY      ------------------------------------------------------------
LSPA_VIBPA      ------------------------------------------------------------
LSPA_VIBCH      ------------------------------------------------------------
LSPA_HAEIN      ------------------------------------------------------------
LSPA_HAEI8      ------------------------------------------------------------
LSPA_PASMU      ------------------------------------------------------------
LSPA_HAES1      ------------------------------------------------------------
LSPA_HAEDU      ------------------------------------------------------------
LSPA_PSEAE      ------------------------------------------------------------
LSPA_PSEAB      ------------------------------------------------------------
LSPA_PSEF5      ------------------------------------------------------------
LSPA_PSEPF      ------------------------------------------------------------
LSPA_PSEFL      ------------------------------------------------------------
LSPA_PSEPK      ------------------------------------------------------------
LSPA_PSESM      ------------------------------------------------------------
LSPA_XYLFA      ------------------------------------------------------------
LSPA_XYLFT      ------------------------------------------------------------
LSPA_XANAC      ------------------------------------------------------------
LSPA_XANC5      ------------------------------------------------------------
LSPA_XANOM      ------------------------------------------------------------
LSPA_XANOR      ------------------------------------------------------------
LSPA_XANC8      ------------------------------------------------------------
LSPA_XANCP      ------------------------------------------------------------
LSPA_ACIAD      ------------------------------------------------------------
LSPA_COXBU      ------------------------------------------------------------
LSPA_NEIMA      ------------------------------------------------------------
LSPA_NEIMF      ------------------------------------------------------------
LSPA_NEIMB      ------------------------------------------------------------
LSPA_NEIG1      ------------------------------------------------------------
LSPA_CHRVO      ------------------------------------------------------------
LSPA_RALSO      ------------------------------------------------------------
LSPA_SERMA      ------------------------------------------------------------
LSPA_BRUA2      ------------------------------------------------------------
LSPA_BRUAB      ------------------------------------------------------------
LSPA_BRUME      ------------------------------------------------------------
LSPA_BRUSU      ------------------------------------------------------------
LSPA_RHILO      ------------------------------------------------------------
LSPA_RHIME      ------------------------------------------------------------
LSPA_BACAN      ------------------------------------------------------------
LSPA_BACCZ      ------------------------------------------------------------
LSPA_BACHK      ------------------------------------------------------------
LSPA_BACC1      ------------------------------------------------------------
LSPA_BACSU      ------------------------------------------------------------
LSPA_OCEIH      ------------------------------------------------------------
LSPA_BACHD      ------------------------------------------------------------
LSPA_GEOKA      ------------------------------------------------------------
LSPA_LISMF      ------------------------------------------------------------
LSPA_LISMO      ------------------------------------------------------------
LSPA_LISW6      ------------------------------------------------------------
LSPA_LISIN      ------------------------------------------------------------
LSPA_STAAC      ------------------------------------------------------------
LSPA_STAAM      ------------------------------------------------------------
LSPA_STAA8      ------------------------------------------------------------
LSPA_STAAN      ------------------------------------------------------------
LSPA_STAAS      ------------------------------------------------------------
LSPA_STAAW      ------------------------------------------------------------
LSPA_STAA3      ------------------------------------------------------------
LSPA_STAAU      ------------------------------------------------------------
LSPA_STAAR      ------------------------------------------------------------
LSPA_STAAB      ------------------------------------------------------------
LSPA_STAES      ------------------------------------------------------------
LSPA_STAEQ      ------------------------------------------------------------
LSPA_STAHJ      ------------------------------------------------------------
LSPA_STACT      ------------------------------------------------------------
LSPA_LACLM      ------------------------------------------------------------
LSPA_LACLS      ------------------------------------------------------------
LSPA_LACLA      ------------------------------------------------------------
LSPA_LACPL      ------------------------------------------------------------
LSPA_LACS1      ------------------------------------------------------------
LSPA_LACSS      ------------------------------------------------------------
LSPA_STRP3      ------------------------------------------------------------
LSPA_STRPC      ------------------------------------------------------------
LSPA_STRPB      ------------------------------------------------------------
LSPA_STRPF      ------------------------------------------------------------
LSPA_STRPM      ------------------------------------------------------------
LSPA_STRP8      ------------------------------------------------------------
LSPA_STRPG      ------------------------------------------------------------
LSPA_STRP1      ------------------------------------------------------------
LSPA_STRPD      ------------------------------------------------------------
LSPA_STRP6      ------------------------------------------------------------
LSPA_STRA1      ------------------------------------------------------------
LSPA_STRA3      ------------------------------------------------------------
LSPA_STRA5      ------------------------------------------------------------
LSPA_STRMU      ------------------------------------------------------------
LSPA_STRR6      ------------------------------------------------------------
LSPA_STRT1      ------------------------------------------------------------
LSPA_STRT2      ------------------------------------------------------------
LSPA_STRTD      ------------------------------------------------------------
LSPA_ENTFA      ------------------------------------------------------------
LSPA_LACGA      ------------------------------------------------------------
LSPA_LACJO      ------------------------------------------------------------
LSPA_CALS4      ------------------------------------------------------------
LSPA_HUNT2      ------------------------------------------------------------
LSPA_CLOAB      ------------------------------------------------------------
LSPA_CLONN      ------------------------------------------------------------
LSPA_CLOTE      ------------------------------------------------------------
LSPA_CLOD6      ------------------------------------------------------------
LSPA_FUSNN      ------------------------------------------------------------
LSPA_DESAG      ------------------------------------------------------------
LSPA_SOLUE      ------------------------------------------------------------
LSPA_GEOMG      ------------------------------------------------------------
LSPA_GEOSL      ------------------------------------------------------------
LSPA_SYNAS      ------------------------------------------------------------
LSPA_TROW8      ------------------------------------------------------------
LSPA_TROWT      ------------------------------------------------------------
LSPA_MYCBO      ------------------------------------------------------------
LSPA_MYCTU      ------------------------------------------------------------
LSPA_MYCBP      ------------------------------------------------------------
LSPA_MYCA1      ------------------------------------------------------------
LSPA_MYCLE      ------------------------------------------------------------
LSPA_RHOJR      ------------------------------------------------------------
LSPA_STRCO      ------------------------------------------------------------
LSPA_STRAW      ------------------------------------------------------------
LSPA_LEIXX      ------------------------------------------------------------
LSPA_SYNY3      ------------------------------------------------------------
LSPA_THEEB      ------------------------------------------------------------
LSPA_SYNPX      ------------------------------------------------------------
LSPA_RHOPA      ------------------------------------------------------------
LSPA_SPHAL      ------------------------------------------------------------
LSPA_MYCGE      ------------------------------------------------------------
LSPA_MYCPN      ------------------------------------------------------------
LSPA_MYCGA      MINSNEVICSNEECAYIDLINIAKPISVEKQENCLICNSEMIKKVDDKQASFLACSRFNE
LSPA_BIFLO      ------------------------------------------------------------
LSPA_CAUVC      ------------------------------------------------------------
LSPA_CHLTE      ------------------------------------------------------------
LSPA_DEIRA      ------------------------------------------------------------
LSPA_PORGI      ------------------------------------------------------------
LSPA_RHOBA      ------------------------------------------------------------
LSPA_MYCPE      ------------------------------------------------------------
                                                                            

LSPA_HELPY      ---------------
LSPA_HELPH      ---------------
LSPA_HELPJ      ---------------
LSPA_HELAH      ---------------
LSPA_WOLSU      ---------------
LSPA_SULDN      ---------------
LSPA_BORBU      ---------------
LSPA_BORBP      ---------------
LSPA_BORAP      ---------------
LSPA_TREPA      ---------------
LSPA_TREDE      ---------------
LSPA_LEPIC      ---------------
LSPA_LEPIN      ---------------
LSPA_LEPBJ      ---------------
LSPA_LEPBL      ---------------
LSPA_CHLCV      ---------------
LSPA_CHLAB      ---------------
LSPA_CHLFF      ---------------
LSPA_CHLPN      ---------------
LSPA_CHLTR      ---------------
LSPA_CHLTA      ---------------
LSPA_CHLMU      ---------------
LSPA_BUCAI      ---------------
LSPA_BUCAP      ---------------
LSPA_BUCBP      ---------------
LSPA_FRATO      ---------------
LSPA_FRATT      ---------------
LSPA_FRAT1      ---------------
LSPA_FRATH      ---------------
LSPA_FRATN      ---------------
LSPA_RICCN      ---------------
LSPA_RICFE      ---------------
LSPA_RICPR      ---------------
LSPA_RICTY      ---------------
LSPA_RICBR      ---------------
LSPA_WIGBR      ---------------
LSPA_BLOFL      ---------------
LSPA_PELUB      ---------------
LSPA_AQUAE      ---------------
LSPA_ECOLI      ---------------
LSPA_SHISS      ---------------
LSPA_SHIBS      ---------------
LSPA_ECOK1      ---------------
LSPA_ECOUT      ---------------
LSPA_ECOL6      ---------------
LSPA_SHIDS      ---------------
LSPA_SHIFL      ---------------
LSPA_ECO57      ---------------
LSPA_ECOL5      ---------------
LSPA_SHIF8      ---------------
LSPA_SALTI      ---------------
LSPA_SALPA      ---------------
LSPA_SALTY      ---------------
LSPA_SALCH      ---------------
LSPA_KLEAK      ---------------
LSPA_YERPE      ---------------
LSPA_YERPS      ---------------
LSPA_YERPA      ---------------
LSPA_YERPN      ---------------
LSPA_YERE8      ---------------
LSPA_PHOLL      ---------------
LSPA_SODGM      ---------------
LSPA_SHESM      ---------------
LSPA_SHESR      ---------------
LSPA_SHEON      ---------------
LSPA_VIBVU      ---------------
LSPA_VIBVY      ---------------
LSPA_VIBPA      ---------------
LSPA_VIBCH      ---------------
LSPA_HAEIN      ---------------
LSPA_HAEI8      ---------------
LSPA_PASMU      ---------------
LSPA_HAES1      ---------------
LSPA_HAEDU      ---------------
LSPA_PSEAE      ---------------
LSPA_PSEAB      ---------------
LSPA_PSEF5      ---------------
LSPA_PSEPF      ---------------
LSPA_PSEFL      ---------------
LSPA_PSEPK      ---------------
LSPA_PSESM      ---------------
LSPA_XYLFA      ---------------
LSPA_XYLFT      ---------------
LSPA_XANAC      ---------------
LSPA_XANC5      ---------------
LSPA_XANOM      ---------------
LSPA_XANOR      ---------------
LSPA_XANC8      ---------------
LSPA_XANCP      ---------------
LSPA_ACIAD      ---------------
LSPA_COXBU      ---------------
LSPA_NEIMA      ---------------
LSPA_NEIMF      ---------------
LSPA_NEIMB      ---------------
LSPA_NEIG1      ---------------
LSPA_CHRVO      ---------------
LSPA_RALSO      ---------------
LSPA_SERMA      ---------------
LSPA_BRUA2      ---------------
LSPA_BRUAB      ---------------
LSPA_BRUME      ---------------
LSPA_BRUSU      ---------------
LSPA_RHILO      ---------------
LSPA_RHIME      ---------------
LSPA_BACAN      ---------------
LSPA_BACCZ      ---------------
LSPA_BACHK      ---------------
LSPA_BACC1      ---------------
LSPA_BACSU      ---------------
LSPA_OCEIH      ---------------
LSPA_BACHD      ---------------
LSPA_GEOKA      ---------------
LSPA_LISMF      ---------------
LSPA_LISMO      ---------------
LSPA_LISW6      ---------------
LSPA_LISIN      ---------------
LSPA_STAAC      ---------------
LSPA_STAAM      ---------------
LSPA_STAA8      ---------------
LSPA_STAAN      ---------------
LSPA_STAAS      ---------------
LSPA_STAAW      ---------------
LSPA_STAA3      ---------------
LSPA_STAAU      ---------------
LSPA_STAAR      ---------------
LSPA_STAAB      ---------------
LSPA_STAES      ---------------
LSPA_STAEQ      ---------------
LSPA_STAHJ      ---------------
LSPA_STACT      ---------------
LSPA_LACLM      ---------------
LSPA_LACLS      ---------------
LSPA_LACLA      ---------------
LSPA_LACPL      ---------------
LSPA_LACS1      ---------------
LSPA_LACSS      ---------------
LSPA_STRP3      ---------------
LSPA_STRPC      ---------------
LSPA_STRPB      ---------------
LSPA_STRPF      ---------------
LSPA_STRPM      ---------------
LSPA_STRP8      ---------------
LSPA_STRPG      ---------------
LSPA_STRP1      ---------------
LSPA_STRPD      ---------------
LSPA_STRP6      ---------------
LSPA_STRA1      ---------------
LSPA_STRA3      ---------------
LSPA_STRA5      ---------------
LSPA_STRMU      ---------------
LSPA_STRR6      ---------------
LSPA_STRT1      ---------------
LSPA_STRT2      ---------------
LSPA_STRTD      ---------------
LSPA_ENTFA      ---------------
LSPA_LACGA      ---------------
LSPA_LACJO      ---------------
LSPA_CALS4      ---------------
LSPA_HUNT2      ---------------
LSPA_CLOAB      ---------------
LSPA_CLONN      ---------------
LSPA_CLOTE      ---------------
LSPA_CLOD6      ---------------
LSPA_FUSNN      ---------------
LSPA_DESAG      ---------------
LSPA_SOLUE      ---------------
LSPA_GEOMG      ---------------
LSPA_GEOSL      ---------------
LSPA_SYNAS      ---------------
LSPA_TROW8      ---------------
LSPA_TROWT      ---------------
LSPA_MYCBO      ---------------
LSPA_MYCTU      ---------------
LSPA_MYCBP      ---------------
LSPA_MYCA1      ---------------
LSPA_MYCLE      ---------------
LSPA_RHOJR      ---------------
LSPA_STRCO      ---------------
LSPA_STRAW      ---------------
LSPA_LEIXX      ---------------
LSPA_SYNY3      ---------------
LSPA_THEEB      ---------------
LSPA_SYNPX      ---------------
LSPA_RHOPA      ---------------
LSPA_SPHAL      ---------------
LSPA_MYCGE      ---------------
LSPA_MYCPN      ---------------
LSPA_MYCGA      KCYYTKSCKQIENNA
LSPA_BIFLO      ---------------
LSPA_CAUVC      ---------------
LSPA_CHLTE      ---------------
LSPA_DEIRA      ---------------
LSPA_PORGI      ---------------
LSPA_RHOBA      ---------------
LSPA_MYCPE      ---------------