CLUSTAL format seed alignment for MF_00162

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GSHB_AGRFC      --MAKIKNVAIQMDHVSGINIAGDSTFAISLEAQARGYRLFHYTPERLSMRDGKIYATVE
GSHB_RHIME      --MAGIVNVGVQMDHVSGITIAGDSTFAMSLEAQARGYRLFHYTPDKLSLRDGRVYATAQ
GSHB_BRUSU      ----MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYAPDRLSMRDGVVSARVE
GSHB_RHILO      ----MKLKIAVQMDHISTVSIAGDTSFALSLEAQRRGHQLFHYTPDRLSLRDGKVFARIE
GSHB_BRADU      ----MKLNVAVQMDPIARINIKGDSTFALLLEAQKRGHGLSYYTPDKLSMIGEELVAPVQ
GSHB_CAUVC      ----MSLRVAVQMDPILGINIDTDTSFLMMMEAQSRGHKLWFYTPDKLSQEDGRVFARAQ
GSHB_BUCAI      MSKKISLKIGILMDSIESINIKKDSSFAILLEAQKRNHIIHYMEMNDLYLRKEQAFARTR
GSHB_BUCAP      MRKKKNLKIGIVMDSITLINIKKDSSFAILLEAQKRQHEIYYMEMNDLYLRKGQSYATTK
GSHB_BUCBP      ----MTINLGIIMDPISSINIKKDSSFAILLEAQNRKYKIYYMELKDLYLKDNKPYSHTK
GSHB_WIGBR      -----MIKLGIIMDPISSIKIKKDTSFSIMLEAQKRNYFLYYIEMKDIYYEVGEVYANSY
GSHB_ECOLI      -----MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTR
GSHB_SALTY      -----MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTR
GSHB_YERPE      -----MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMGDLYMRGGDGRARTR
GSHB_PHOLL      -----MIKLGIVMDPISSINIKKDTSFAMLLEAQRRSWELHYMEMSDLYLHQGEARARTR
GSHB_VIBPA      -----MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLDQGKAIADTK
GSHB_VIBVY      ----MMIKLGIVMDPISSINIKKDSSFAMMLEAQRRGWEIHYMEMNDLHLDQGVAIADTK
GSHB_VIBCH      -----MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVALADTK
GSHB_SHEON      -----MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAIVNGVAMGNMR
GSHB_PSEAE      ----MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLYQKAGVARGRMR
GSHB_PSEPK      ----MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQQDLYQGEGKARARMR
GSHB_PSESM      ----MSVRLGIVMDPIERISYKKDSSLAMLLAAQDRGWTLFYMEQKDLYQNAGQARARMK
GSHB_XANCP      ----MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLHYVRPGGLSLHEGRAVAQVA
GSHB_XYLFT      ----MPLDVVVVMDPITGIKIAKDTTFALLLEAQRRSHRLHYVHPGSLSLNEGRTFAQTA
GSHB_COXBU      ----MNLKVGVLMDPIANIAIHKDTTFAMLLALQARQHEVYYLEPADIFLRNEKILGSMR
GSHB_NEIMA      ------MKVLFIADPMASFKTYKDTTYAMMREMAKRGWRLFHTLSGELSVKNGLVVADAS
GSHB_NEIMB      -----MMKVLFIADPMASFKTYKDTTYAMMREMAKRGWRLFHTLSGELSVNGGLVTAQAS
GSHB_CHRVO      ------MRILFIADPLEHFKIYKDTTFAMMEEAHRRGHAISFAEAHQLSVEGGRLQVDAC
GSHB_RALSO      ------MRILFIVDPLSTFKIYKDSTFAMMREAAARGYAIYTCQQSQLTLSGNVVETVAT
GSHB_BORPE      ------MHVLFIIDPLPLLKAYKDSSVAMMQALQARGHTLSVALQGDLYIDAGEVRTRFA
GSHB_NITEU      ------MKLAFILDPLDSIKIGKDSSYAMMREAAVRHHQLYTLQQNDLAWKDHQVIGFAR
GSHB_NOSS1      ------MKLAFIIDPIHQLDPCHDTSVALMEAAQILGHEVWVTQANWLSVVDSKAWAILQ
GSHB_THEVB      ------MDIAFIIDPIASLDPGHDTSVALMEAAQAAGARVWVTEISQLLIREGQVWAALT
GSHB_SYNY3      ------MKLAFIIDPLEKLDPGHDSTVAIMEAAQKLGHEVFVTSVGDLAVINGQAWAKLA
GSHB_SYNE7      ------MKLAFLIDPIAALDPTHDSTVALMEAAQLRGHEIWIGEISDLSVHVGEPLGLLR
GSHB_GLOVI      ------MKILFIVDPLETLKPGHDTSVALMQAAARRGHSVWAAEVGDLQVHHHRAAAQVR
GSHB_PARMW      ------MRQLFVLDPLSQIRPEKDSTAALMQAAQRAGDDIWSCTPSDLIARGDEPMAVAL
GSHB_PROMM      ------MRQLFVLDPLQCIQPAKDSSAALMQAAQRASIEVWACTPADLQARGDQLSAIAV
GSHB_PROMA      ------MKQLFILDPIELINPAKDSSAALMQAAHRASLDIWVCTPADLQAKGAKARVVAK
GSHB_PROMP      ------MKFLFVVDPIKNINPLKDSSAALMQASSKKKIEVWICTPQDLEARGDEVWASSW
GSHB_ANACE      -------MLKVAFQMDEDVVVGRDVSVKLVEEAQRRGHEVFFYRPTSLAFVCGELVAEAF
                          .  :    .    * :  :          :       :            

GSHB_AGRFC      QMELRDIKGD---------HFSLSEPERVDL-STMDVIHLRQDPPFDMAYITSTHLLERI
GSHB_RHIME      QMQLRDVRGD---------HFTLGEDERIDL-STMDVILLRQDPPFDMAYITSTHLLERL
GSHB_BRUSU      KMEVRDVKGD---------HYTLGEPVRRDL-TEMDVILLRQDPPFDMNYITTTHLLERI
GSHB_RHILO      EMQVRDEKGS---------HYSLGEKVRTDL-SEMDVVLLRQDPPFDMNYITTTHILERI
GSHB_BRADU      LLTVRDEPGD---------HFTLGEPKREAL-NGFDVVLLRQDPPFDLAYITSTHFLERI
GSHB_CAUVC      PVEVFADKGA---------HARLGETVMLDMKDDIDVVLMRQDPPFDMAYITATHFLEKV
GSHB_BUCAI      LIKLIKNTQK---------WYQFIKQQ-SISLSELDVILMRKDPPFNTEFIYSTYILERA
GSHB_BUCAP      SIEIQKNQNN---------YFKFIQKK-DISLNELDAILMRKDPPFNTEFIYATYILERA
GSHB_BUCBP      LLRIKNNKKQ---------WFTLEQQK-DVSLSNLDVILMRKNPPINRAYIYATYILEQA
GSHB_WIGBR      LISVKYDEKK---------WYSFKKKY-TINLKELDVILMRKDPPFDIEFLYITYILEHI
GSHB_ECOLI      TLNVKQNYEE---------WFSFVGEQ-DLPLADLDVILMRKDPPFDTEFIYATYILERA
GSHB_SALTY      TLSVEQNYDK---------WYEFGSEQ-EIKLADLDVILMRKDPPFDTEFIYATYILERA
GSHB_YERPE      RLNVKQDKDN---------WFSFGAEQ-DLPLYDLDVILMRKDPPFDTEFIYATYILERA
GSHB_PHOLL      LLQVENHPQQ---------WYQFDREQ-DLALETLDVILMRKDPPFDTEYIYATYILERA
GSHB_VIBPA      VVELKEDPNG---------WYEFKSEQ-MIELSELDAVLMRKDPPFDTEYIYATYILERA
GSHB_VIBVY      VVQLKEDPNG---------WYEFTSEQ-TIELSELDAVLMRKDPPFDTEYIYATYILERA
GSHB_VIBCH      VVELKEDPSG---------WYQFKSEQ-TIALSELDAILMRKDPPFDTEYIYATYILERA
GSHB_SHEON      PLKVMNDANH---------WFELGEAK-DTPLSELNVVLMRKDPPFDTEYIYATYMLERA
GSHB_PSEAE      PLKVFNDASR---------WFELEAES-DQPLHELDVILMRKDPPFDNEFVYSTYLLEQA
GSHB_PSEPK      PLKVFADPAR---------WFELGEEQ-DSPLAELDVILMRKDPPFDMEFVYSTYLLEQA
GSHB_PSESM      PLKVFADPAK---------WFEFEAEI-DAGLDDLDVILMRKDPPFDMEFIYTTYLLEQA
GSHB_XANCP      PLSVREDKAS---------WFTLGAFT-ELVFGPGQVVLMRKDPPVDAEFIYDTQVLAVA
GSHB_XYLFT      PLQVRDNKTD---------WYTLGEFS-ETQLGQGQIILMRKDPPVNAEFIYDTQLLSIA
GSHB_COXBU      RLQVADDPSQ---------WFNLSESE-IKPLHALDVLLMRKDPPFNMSYVYLTYLLELA
GSHB_NEIMA      AFEFLGAQDDH-----DKNWFAAADKV-QTALKAFDAVIMRTDPPFDMQYLYATQLLTLA
GSHB_NEIMB      AFEFLGAKNDD-----DHAWFKSADKV-QTALEAFDAVIMRTDPPFDMQYLYATQLLTLA
GSHB_CHRVO      DLAVTDERPD---------WYKLGPKL-RQPLTAFSAVVMRKDPPFDMEYLYASQLFTLA
GSHB_RALSO      PLALTGDE---------HDWYR-SGDPRLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIA
GSHB_BORPE      PIALRDGADLH-----GHDWWRETGAADEAPLARFDAVVMRKDPPFDMEYVYSTHLLEYA
GSHB_NITEU      PLTLLDPPEG------DHRWYEEGAIE-EIPLSGFDAVLMRKDPPFDTEYIYSTYLLELA
GSHB_NOSS1      QVELVPVQLIDGRWVAASPWYTLNTRS-FSSLETMDAVFMRTDPPVNDAYLYATYVLDYV
GSHB_THEVB      PIQLSPVQLVDGQWQIPQPWFELGALE-WRPLNTFRAVWMRKDPPVNTAYLYATYCLDLV
GSHB_SYNY3      AVRLQPVILVDGHWQVSQPWSELSKSQ-WMALTECQAVFMRKDPPVTVQYLYATFILELL
GSHB_SYNE7      PLKIEPVQWLGDRWQVANPWFTAGEAK-RRSLHDFAAVFMRKDPPVTTAYLYATYLLDLV
GSHB_GLOVI      TLTIHPGR---------TPFYTVEAVG-FYPLSEADVIWMRKDPPVTSAYLWATQVLDLV
GSHB_PARMW      PVTP-------------DPWIAVGAPE-RQSLAGFDVIWMRKDPPVDEAYLYATHLLEVA
GSHB_PROMM      PVVA-------------EPWISTGEPR-SLPLTDFACIWMRKDPPVDEGYLYATHLLELA
GSHB_PROMA      TIVP-------------EPWKSLGEAQ-NLSLNEFHCIWMRKDPPVDEAFLYATHLLEVA
GSHB_PROMP      RAEV-------------CPWVSFKENK-CIPLAEFNCIWMRKDPPVNEGYLYATHLLEVA
GSHB_ANACE      SVRVGADSLH-------------FHDKTRLPLGKLDMLFVRQNPPFDMRYVTTTYLLERL
                                                     : :* :**.   ::  :  :   

GSHB_AGRFC      HP------KTLVVNDPAWVRNSPEKIFVTEF-ADLMPKTLITKDVSEIARFRNEMGDIIL
GSHB_RHIME      HP------KTLVVNDPAWVRNSPEKIFVTEF-PDLMPKTLITRDPDEIARFRQEMGDIIL
GSHB_BRUSU      HP------KTLVVNDPAWVRNSPEKIFVTEF-PDLMPETLITKDPQEVMDFRREFGDIIL
GSHB_RHILO      HP------KTLVVNDPAWVRNSPEKIFVTEF-ADLMPDTLITKDPLEVAAFRKEFGDIIV
GSHB_BRADU      HP------KTLVVNDPASVRNAPEKLFVMNF-PQLMPPTLISRDLDEINAFRDKHGAVVM
GSHB_CAUVC      HP------HTLVVNNPAEVRNAPEKLFVTDF-PGVQPPTLITSDHEAIYDFRARHGDIVL
GSHB_BUCAI      EE-----TGVLIINKPKSLRDCNEKIFTSWF-PDLITDTLVTRNIFQIRQFWEKYQDIII
GSHB_BUCAP      EE-----KGVLVINKPKSLRDCNEKIFISWF-SRFTTDTLVTRKLSKIHNFWKEKNDIIL
GSHB_BUCBP      ER-----NGSYIINKPSSLRSYNEKLFTTTHFPQYIPKTLITSNSTKIHNFIKTYKDIII
GSHB_WIGBR      EN-----FGVLIINKPKSLRDYNEKISTLSF--KYSPKTLISCSKKAIYSFQEKFGDIIL
GSHB_ECOLI      EE-----KGTLIVNKPQSLRDCNEKLFTAWF-SDLTPETLVTRNKAQLKAFWEKHSDIIL
GSHB_SALTY      EE-----EGTLIVNKPQSLRDCNEKLYTAWF-ADLTPETLVTRNKAQLKAFWEKHGDIIM
GSHB_YERPE      ED-----KGTLVVNKPQSLRDCNEKLFTAWF-PELTPDTLVSRSKDHIRKFHQEHGDIIL
GSHB_PHOLL      EE-----KGTLIVNKPQSLRDCNEKLFTAWF-PELTPDTLVTRNAAHLREFHQKHGDVIF
GSHB_VIBPA      EE-----QGALIVNKPQSLRDCNEKLFTAWF-PELTPTTIVTRKAEKIKAFREEHGDVIL
GSHB_VIBVY      EE-----QGTLIVNKPQSLRDCNEKLFTAWF-PELTPTTIVTRKAEKIKAFRQEHGDIIL
GSHB_VIBCH      ED-----EGVLVVNKPQSLRDCNEKLFTAWF-PELTPITMVTRKAEKIKAFREQHGDVIL
GSHB_SHEON      EE-----QGVLIVNKPQSLRDANEKLFTAWF-SEFTPETIVTRDANRIRAFHQAKGDIIL
GSHB_PSEAE      ER-----AGALVVNRPQSLRDCNEKFFATQF-TQCTPPTMVSRRSDILREFAAEHRDIIL
GSHB_PSEPK      EN-----DGVLVVNRPQSLRDCNEKMFATLF-PQCTTPTLVSRRPDIIREFTAKHADVIL
GSHB_PSESM      ES-----AGVLVVNKPQSLRDCNEKLFATLF-PQCTPPTLVSRRADILREFAEQQGDVIL
GSHB_XANCP      QR-----AGAQVVNDPQGLRDYNEKLAALLF-PQCCPPTLVSRDAAALKAFVLAHGQAVL
GSHB_XYLFT      QA-----AGAQVINHPQGLRDLNEKIAAQLF-PQCCPPTLISRDMRALKMFVQKQEQAIL
GSHB_COXBU      EK-----QGLFVVNKPASLRDANEKLFTGWF-PHCTPKTLVTSRKAILQEFIREQKEVVI
GSHB_NEIMA      EQ-----QGAKVFNSGQAMRDFNEKLAILNF-SRFTAPTLVTTRSADVRAFLKEHGDIII
GSHB_NEIMB      EQ-----QGAKVFNSGQAMRDFNEKLAILNF-SRFIAPTLVTTRSADVRTFLKEHGDIII
GSHB_CHRVO      EA-----QGVKVFTSGQALRDFNEKLAILHF-PELISPTLISGEAHRLRAFVNQHQDVIL
GSHB_RALSO      ER-----QGARVFNKPQAIRDHSEKLAIAQF-REFTAPTIVTRDAKRLREFHAEQGDVIF
GSHB_BORPE      QQ-----QGARVFNSGAAIRNHPEKLAITEF-PDLTTPTLVTRDMARIRAFHAAQGDVIV
GSHB_NITEU      ER-----QGAYVVNSPRGIRDHNEKLAITEF-PRFTPPSLVTSQEQLILEFLAEHEDIIL
GSHB_NOSS1      DQ-----RKTLVINNPNGIRGANEKMYALQF-TKAIPETIVSADKDFIRQFVEAKGATVL
GSHB_THEVB      DP-----QTTLVLNSPAGLRHANEKMYALQF-TSVIPKTIVTADKQRIREFVQQQGMAVL
GSHB_SYNY3      AP-----TKTMVINSPQGLREANEKMYTLQF-AAVMPPTVVSLDKGLIRQFLEEHGAAVL
GSHB_SYNE7      DP-----KKTRVVNSPEGLRHANEKMYALQF-QSVVPRTLVSSNKAEIRAFLDELRAAVL
GSHB_GLOVI      NAGRGDGRTTFVLNRPSGLRNDNEKLYALHF-PDLVPETRVCTHRQDILDFVDIHGRAVI
GSHB_PARMW      ER-----AGVRVLNRPSALRAWNEKLGALRF-SRWMAPTLVAGRVSELMAFAREQGDVVL
GSHB_PROMM      ER-----AGVCVLNRPAALRAWNEKLGALRF-NNLMAPTLVASRVSELAAFAREQEEVVL
GSHB_PROMA      ER-----AGVLVLNKPASLRAWNEKLGALRF-SKLMAPTLVASRVNELKEFAKEQGEVVL
GSHB_PROMP      ER-----KGVKVINKPSSLRAWNEKLGALRY-SHLMAPTIVASKVKDLINFAQINHDVVV
GSHB_ANACE      DI--------LMINNPKAIRDHPEKLLPLSF-PKFIPPTLITESVSEISAFYAEYGDIVL
                           :..    :*   **:    .     . : :      :  *       :.

GSHB_AGRFC      KPLYGNGGAGVFHSARDDRNFSSLLEMFGQMFREPYIAQEYLPDVRKGDKRILLVDGEPV
GSHB_RHIME      KPLYGNGGAGVFHSARDDRNFSSLLEMFAQMFREPYIAQEYLPAVRKGDKRILLVDGEPV
GSHB_BRUSU      KPLYGNGGAGVFHLADGDRNLTSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPV
GSHB_RHILO      KPLYGNGGAGIFHLHEADRNLASLLEMFGQLFREPYIVQRYLKDVRKGDKRIILIDGEPV
GSHB_BRADU      KPLHGHGGAAVFRVMPQDMNFGSLFDMFTVTFKEPWVIQQFIPEVKHGDKRIILVNGEFA
GSHB_CAUVC      KPLYGGGGSGVARLLADDPNLDALLELHAMIGREQVIAQKFVPAVSKGDKRVLLVDGEPV
GSHB_BUCAI      KPLDAMGGANIFRIKKNDPNFSVIVENMTNYERKYCMVQNYLPEIKLGDKRILIINGKPI
GSHB_BUCAP      KPLDAMGGKGVFRIKKDDPNFSVIVETLTNYEKKYCMIQTYLPEVQFGDKRILIVNGKPI
GSHB_BUCBP      KPLHGMAGLSIFRIKEHDPNTSVIIETMTKYETIPCISQNYITDIQKGDKRILIINGIPF
GSHB_WIGBR      KPINKMGGDSVFYVKKNDPNVSVIIDQLTNYGNSFCLIQEYIKEILNGDRRIIMINGSPL
GSHB_ECOLI      KPLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPV
GSHB_SALTY      KPLDGMGGASIFRVKEGDPNIGVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPV
GSHB_YERPE      KPLDGMGGTSIFRVKQDDPNLSVIIETLTELSSRFCMAQNFLPAIKEGDKRVLVVDGEPV
GSHB_PHOLL      KPLDGMGGASIFRLKKDDPNVGVIIETLTEHGNRFCMAQNFLPAIKEGDKRVLIVDGEPV
GSHB_VIBPA      KPLDGMGGASIFRVKENDPNVSVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPM
GSHB_VIBVY      KPLDGMGGASIFRVKENDPNVSVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPM
GSHB_VIBCH      KPLDGMGGASIFRVKEGDPNLSVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPM
GSHB_SHEON      KPLDGMGGTSIFRVKQDDPNLGVIIETLTQYGNQYAMAQAFIPEITKGDKRILVVDGEPV
GSHB_PSEAE      KPLDGMGGSSIFRHREGDPNLSVILETLTQHGSQQIMAQRYLPEIKDGDKRILMIDGEPV
GSHB_PSEPK      KPLDGMGGTSIFRHRAGDPNLSVILETLTALGTQQIMAQAYLPAIKDGDKRILMIDGEPV
GSHB_PSESM      KPLDGMGGASIFRHRAGDPNLSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPV
GSHB_XANCP      KPLDGMGGRSIFRSGTGDPNLNVILETLTDGGRKLTLAQRFIPDITAGDKRILLVDGEPV
GSHB_XYLFT      KPLDGMGGHSIFRSSNGDPNLNVILETLTDGGRTLAIAQRYLQQIIEGDKRILLIDGVPI
GSHB_COXBU      KPLGAMAGESIFYLTVNDPNIPVVIETMTANGHQLVMAQRFIPEVKSGDKRIILIDGEPI
GSHB_NEIMA      KPLDGMGGMGIFRLTEKDPNIGSILETLMQLDSRTIMAQRYIPEIVHGDKRILIIGGEVV
GSHB_NEIMB      KPLDGMGGMGIFRLTEKDPNIGSILETLMQLDSRTIMAQRYIPEIVHGDKRILIIGGEVV
GSHB_CHRVO      KPLDSMGGDSIFRVKPDDPNLSVIIETITWRGKRTVMAQRYIPEIRDGDKRILVIDGVPV
GSHB_RALSO      KPLDGMGGAGIFRVGADGMNLGSVIETLTHNGTRTVMAQQYIPAIRDGDKRILLIGGSPV
GSHB_BORPE      KPLDDMGGTGIFRLQRSEPNLNAILETLTDNGTRTIMAQRYIPEIVKGDKRILLIGGEPM
GSHB_NITEU      KPLDGMGGAGIFRIQNTDHNIGVIIETLTRYGTRTIMAQRFLPEIREGDKRILLIAGRPV
GSHB_NOSS1      KPLGNKAGEGILFLQAGDRNFNSIVELSTQQGRLPVMVQTYLPEAKEGDKRIILLNGEPI
GSHB_THEVB      KPLGGKGGEGILFLQAGDRNLNSMIEISTQRGQLPVMLQEYLPAAKEGDKRIILLNGEPI
GSHB_SYNY3      KPLGGKAGEGILFLDPGDRNFNSLVEISTQHGKEPVMVQRFLPEAKEGDKRIILLDGDPI
GSHB_SYNE7      KPLGGKAGEGILFLDPGDRNFNSLVEISTQQGQLPVMVQQYLPEAKDGDKRIILVNGEPL
GSHB_GLOVI      KPLDGKGGEGIFLLARADRNLNAIIEASTAYGTRHVMVQRYLEESRQGDKRIVLLAGEPI
GSHB_PARMW      KPLGGRAGLGVIRVQAEAPGLKALLELVTEQERLPVMAQRFLPDVTEGDKRILLVDGDPL
GSHB_PROMM      KPLGGRAGQGLVRVAGAAPGLEALLELVTDQEQLPVMVQRFLPAVIEGDKRILLVDGEPL
GSHB_PROMA      KPLGGKGGQGVIRVADAALGLDALLELVTSQEQMPVMMQKFLPKVIEGDKRILLVNGEPL
GSHB_PROMP      KPLGGKGGQGVIRLTKDSPGIKAMIELITSQEQLPVMMQKFIPEVKEGDKRIIIVNGEPI
GSHB_ANACE      KPLYDYGGNGVCRIC-GRADVGAISSAMVERYEAPLVAQQFIDDISS-DKRVVLLGGRPI
                **:   .*  :        .   : .          : * ::      *:*:::: *   

GSHB_AGRFC      G-AINRVPAENDARSNMHAGGRPEPTELTAREQEICRRIGPALRERGFLFVGIDVIGDYM
GSHB_RHIME      G-AINRVPAEHDSRSNMHVGGRAEATDLTAREREICTRIGPALKERGFLFVGIDVIGDYL
GSHB_BRUSU      G-ALNRVPSETDARSNMHVGGRPEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYM
GSHB_RHILO      G-AINRVPAEHDSRSNMHVGGRAEKTELTEREREICARIGPSLRERGFILVGIDVIGDYM
GSHB_BRADU      G-AVNRVPAADDLRSNMVRGGAAQETELTPREREICATVGPALRERGLLFVGIDVINGNL
GSHB_CAUVC      G-AINRVPASGQVRSNLRVGGRAEAVELTARDLELCKIIAPELKRRGLLFVGIDVIGEYL
GSHB_BUCAI      PWCVARIARIGETRANLAAGGEGKIQSLSETDWKIANYLSPTLKKRGLILVGLDVIGDKL
GSHB_BUCAP      PWSLTRIPKHGETRANLAVGGEGRVQKLNDKDWEIANYLAPILKKRGLILVGLDVIGDKL
GSHB_BUCBP      PWCLARIPKKHENRGNLSIGGYGNTQKLSKNDWEIALSIAPTLNKKGIFFAGIDIIGTKL
GSHB_WIGBR      PYCLVRIPNDKEIRGNLAAGASFDILPLRKIDYEISNNISSFLKDKGLIFVGLDIIGNYL
GSHB_ECOLI      PYCLARIPQGGETRGNLAAGGRGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRL
GSHB_SALTY      PYCLARIPQGGETRGNLAAGGRGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRL
GSHB_YERPE      PYCLARIPAQGETRGNLAAGGRGEARPLSESDWEIARTVAPILKQKGLIFVGLDIIGDRL
GSHB_PHOLL      PYCLARIPAQGETRGNLAAGGRGEARPLSESDWAIARAVAPTLQEKGLIFVGLDIIGDKL
GSHB_VIBPA      PYCLARIPAKGETRGNLAAGGTGEARPLSETDMKIAQAVAPTLKEKGLIFVGLDVIGDKL
GSHB_VIBVY      PYCLARIPAKGETRGNLAAGGSGEPRPLSETDLKIANAVAPTLKEKGLIFVGLDVIGDKL
GSHB_VIBCH      PYCLARIPAKGETRGNLAAGGRGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKL
GSHB_SHEON      PYALARIPKKGETRGNLAAGGSGVAQPLSDSDWKIARAIGPELKKRGLIFVGLDVIGDKL
GSHB_PSEAE      PYCLARIPAQGETRGNLAAGGRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYL
GSHB_PSEPK      DYCLARIPASGETRGNLAAGGRGEARPLTERDRWIAAQVGPTLREKGLLFVGLDVIGDYL
GSHB_PSESM      PYCLARIPAAGETRGNLAAGGRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHL
GSHB_XANCP      DYCLARIPQGDEFRGNLAAGGRGEGRPLSERDRWIAAQVGPEMKRRGMRFVGLDVIGDYL
GSHB_XYLFT      DHCLARIPQGDEFRGNMAAGGRGESRPLNERDRWIAAQVGPEMRRRGMRFVGIDVIGDYL
GSHB_COXBU      PYTLARIPPKGDFRGNLARGAKGEGRELTDRDRWICEQVGPTLRKKGLWFVGLDIIGDYL
GSHB_NEIMA      PYALARIPQNGETRGNLAAGGRGVAQELSERDREIAETLAPELKRRGILLAGLDVIGSNL
GSHB_NEIMB      PYALARIPQNGETRGNLAAGGRGVAQELGGRDREIAETLAPELKRRGILLAGLDVIGSNL
GSHB_CHRVO      DHCLARIPAAGETRGNLAAGGRGEARPLSARDREIAETVGPELKKRGILLAGLDVIGNYL
GSHB_RALSO      PHALARVPMAGEVRGNLAAGGTGRAQLLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYL
GSHB_BORPE      PYSLARIPLAGETRGNLAAGGRGVAQPLSERDLHLARTVADRLAGRGLLLVGLDVIGDYI
GSHB_NITEU      DYALARIPKPGETRGNLAAGGTGVARPLSARDREIAEELGQILYARGLMLVGLDVIGNHL
GSHB_NOSS1      G-ALNRLASGSDFRNNMATGGTVAKTEITPREEEICSQIAANLRQDGLIFVGIDVIGGYL
GSHB_THEVB      G-AVNRIPTGDEFRGNMATGGRVAAAEITERDRQICQTLAPALRRDGLYFVGIDVIGGYL
GSHB_SYNY3      G-AVNRIPSGAEFRGNMAVGGQVAPTTITSREIEICALLKPKLQADGLYFVGIDVIGGYL
GSHB_SYNE7      G-AVNRVPTGREFRGNMAVGGRVEAVPITDRDREICAAVAPRLRQDGLFFVGIDVIGGYL
GSHB_GLOVI      G-ALLRVPREDDVRGNMAAGGRVVKTTLTERDREICRVVGPRLVADGHYFVGIDVIGAYL
GSHB_PARMW      G-AVNRRPSEGEFRSNLAVGGQAEATELSEPERQICAALAPALRAEGLFFVGIDVIGGML
GSHB_PROMM      G-AVNRRPKAGDFRSNLAMGGRPEPTELDSRELQICAELAPVLREQGLFFVGIDVIDGLL
GSHB_PROMA      G-AINRLPKCGDFRSNLALGGQAEATNLSKREKEICEELGPSLKSEGLFFVGIDVIGGML
GSHB_PROMP      G-SINRIPQGGDFRSNLAMGGKAEKTNLTAKEKKICTELSQHFKDEGLFFVGIDVINEML
GSHB_ANACE      GAVRRKVTAMGEIRTNLRVGATPEATELSDREREICHDVGMLLSSVDILFAGIDILGGHL
                     : .   : * *:  *.      :   :  :.  :   :   .  :.*:*::.  :

GSHB_AGRFC      TEINVTSPTGIREVRKFGG-ADVASLLWDAIEKKRDAQDF-------
GSHB_RHIME      TEINVTSPTGIREVKKFGG-ADVASLLWDAIEKKRA-----------
GSHB_BRUSU      TEINVTSPTGIREIERFDG-TNIAALFWDAVEARR------------
GSHB_RHILO      TEINVTSPTGVREVQRFGG-ADIASLFWDAVEGKRK-----------
GSHB_BRADU      TEINVTSPTGIRAIARLGG-PDVAAKVWDTIEQKRAK----------
GSHB_CAUVC      TEINVTSPTGAQQLKRFTG-VNAAEVLWNRIEDIRANGG--------
GSHB_BUCAI      TEINVTSPTCICEIESQKN-ISITGMLLDYIEKKVCL----------
GSHB_BUCAP      TEINVTSPTCICEIEEKKN-ISITGILIDYIEDKIYK----------
GSHB_BUCBP      TEINITSPTCIQEIEQDTG-ISISTIILDNLEKNLKKRKTNRYL---
GSHB_WIGBR      TEINITSPTGINEIESVYK-VSISGILLDSIEKLLNIKH--------
GSHB_ECOLI      TEINVTSPTCIREIEAEFP-VSITGMLMDAIEARLQQQ---------
GSHB_SALTY      TEINVTSPTCVREIEAEYP-ISITGMLMDAIEARLAK----------
GSHB_YERPE      TEINVTSPTCVREIEAAFPEISITGMLMDAIERRLADKKA-------
GSHB_PHOLL      TEINVTSPTCAREIEAAFPDISITGMLMNAIEERLEK----------
GSHB_VIBPA      TEINVTSPTCIREIEAAFD-ISITGKLMDAIERRVKGE---------
GSHB_VIBVY      TEINVTSPTCIREIEAAFD-ISITGKLMDAIERRLQAQA--------
GSHB_VIBCH      TEINVTSPTCIREIEAAYD-ISITGKLMDAIERRLKATAM-------
GSHB_SHEON      TEINVTSPTCIREIQAAFD-VDITGMLFDAIETRLGQ----------
GSHB_PSEAE      TEINVTSPTCIREIDQAFD-TRIGDKLMDAIAAQLAAR---------
GSHB_PSEPK      TEINVTSPTCIREIDAAYN-TDIGGKLMDAIDRKLKAR---------
GSHB_PSESM      TEINVTSPTCIREIDNAFG-TNIGGLLMDAIEKKLQARKG-------
GSHB_XANCP      TEVNVTSPTCVRELDAQFG-LNIAGLLFDAIEAGTAQ----------
GSHB_XYLFT      TEINVTSPTCLRELDAQCG-LNIAGQLFDAIETGG------------
GSHB_COXBU      TEINVTSPTGVRELQAQFD-VDIAGQFIAFLETKYATTTDIE-----
GSHB_NEIMA      TEVNVTSPTGFQEIMKQKG-FDVAAMFADAVAEWSVR----------
GSHB_NEIMB      TEVNVTSPTGFQEIMKQKG-FDVAAMFADAVAAWSVR----------
GSHB_CHRVO      TEVNVTSPTCFREIMDQTG-VNVAGLYIDALERRCQH----------
GSHB_RALSO      TEVNVTSPTCFQEITQQTG-FNVAGMFIDALERAAGKASGGLGRKLA
GSHB_BORPE      TEVNVTSPTCFVEITEQTG-FNVPEMFAVALESAAG-----------
GSHB_NITEU      TEINVTSPTGMREISDQTG-TNVAGLMIDALEQNIARKNR-------
GSHB_NOSS1      TEVNVTSPTGIREIDRLDG-TRLAHQVIQWVEKNLQIQN--------
GSHB_THEVB      TEVNVTSPTGVREIDRLNG-TRLGQQVMAWLFS--------------
GSHB_SYNY3      TEVNVTSPTGIREIDRLEG-VRLGEKVICWLEKQF------------
GSHB_SYNE7      TEVNVTSPTGIREIDRLNG-VSIGDQTIAALEALVNQG---------
GSHB_GLOVI      TEINVTSPTGICEIDVLDG-VVLEDEIVDWLVEYTRPALARNL----
GSHB_PARMW      SEINVTSPTGVREVERLMQ-EPLADQTIERLRSLV------------
GSHB_PROMM      SEINVTSPTGIREVERLKG-VPLADQVIARLLVSLG-----------
GSHB_PROMA      SEINVTSPTGVREVEKLMN-IPLADQVIERLLANFS-----------
GSHB_PROMP      SEINVTSPTGLREIETLSN-KSVSDKVIEKLLEII------------
GSHB_ANACE      IEVNVTSPCGILEINQVYG-KTLERDCWDYFEYALLHRSP-------
                 *:*:***     :                .