CLUSTAL format seed alignment for MF_00163

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DEF_AGRFC       --------------------------------------MTIKPLIILPD----PVLRQQS
DEF_BRUME       --------------------------------------MSVKPLIILPD----PVLRQVS
DEF1_NOSS1      -------------------------MPSEIAVEKKKLKNPPLQLHYLGD----RVLRQPA
DEF_AQUAE       ---------------------------------------MVRDIVIYPN----EILKKPT
DEF1_BACSU      --------------------------------------MAVKKVVTHPA----EVLETPA
DEF_BORBU       -----------------------------------------MEMVFYPN----DLLRVKT
DEF2_NOSS1      ------------------------------------MNPELLPIIQLGN----PTLRQKA
DEF_BACHD       -------------------------------------MLTMKDIVREGN----PVLREVA
DEF2_GEOSE      -------------------------------------MITMKDIIKEGH----PTLRKVA
DEF2_BACSU      -------------------------------------MITMENIVRDGH----PALRETA
DEF_CHLMU       ---------------------------------------MIRDLEYYDS----PILRKVA
DEF_CHLTR       ---------------------------------------MIRDLEYYDS----PILRKVA
DEF_CHLPN       ---------------------------------------MIRRLEYYGS----PILRKKS
DEF1_CLOPE      --------------------------------------MAIRNLRFNDD----EILRKKC
DEF_BUCAI       --------------------------------------MSLLKILYYPD----IRLRILA
DEF_ECOLI       --------------------------------------MSVLQVLHIPD----ERLRKVA
DEF_SALTI       --------------------------------------MSVLQVLHIPD----ERLRKVA
DEF_SALTY       --------------------------------------MSVLQVLHIPD----ERLRKVA
DEF_YERPE       --------------------------------------MSVLQVLHYPD----ERLRKIA
DEF1_VIBCH      --------------------------------------MSVLQVLTFPD----DRLRTVA
DEF_HAEIN       --------------------------------------MTALNVLIYPD----DHLKVVC
DEF_PASMU       --------------------------------------MARLNVLVYPD----ERLKIIA
DEF_NEIMA       --------------------------------------MALLNILQYPD----ERLHTVA
DEF_PSEAE       --------------------------------------MAILNILEFPD----PRLRTIA
DEF1_RALSO      --------------------------------------MALLNILQYPD----PRLHKVA
DEF_XYLFA       --------------------------------------MALLPILEFPD----PRLRTKA
DEF_HELPY       --------------------------------------MALLEIIHYPS----KILRTIS
DEF_HELPJ       --------------------------------------MALLEIIHYPS----KILRTIS
DEF_CAUVC       --------------------------------------MAIRRILTVDNAADLATLKKIS
DEF_RHILO       --------------------------------------MPIKPLIILPD----PILRQVS
DEF_RHIME       --------------------------------------MTIKPLIILPD----PVLRQVS
DEF1_RICCN      --------------------------------------MSILPIVTAPD----ERLKQKS
DEF_RICPR       --------------------------------------MSIFSIVTAPD----ERLKQKS
DEF2_VIBCH      --------------------------------------MAVLEILTAPD----PRLRVQS
DEF_CAMJE       ---------------------------------------MVRKIITYPN----PRLFLNS
DEF1_CLOAB      --------------------------------------MAIRSIRKYGD----ELLRKKS
DEF_CALS4       --------------------------------------MAIRYIRKIGD----PVLRKKA
DEF_MICDP       -------------------------MPSEIAVEKKKLKNPPLQLHYLGD----RVLRQPA
DEF_SYNY3       -------------------------MTATILVEKQKVDRPPLELHYLGD----KVLRQPA
DEF2_CLOAB      --------------------------------------MALRQIRLSED----EILRKKS
DEF_THETH       ---------------------------------------MVYPIRLYGD----PVLRRKA
DEF_DEIRA       --------------------MTAPDSSSAPAPLAFGGKPRVYPMRLYGD----PILRRKA
DEF_CLOB8       ---------------------------------------MIKPIVK--D---ILFLGQKS
DEF2_RICCN      ------------------------MKNENNISLPQYVTLNIQTLNSSED----KTIRIKA
DEF_MYCLE       --------------------------------------MAIAPIRIVGD----PVLHTPT
DEF_MYCTU       --------------------------------------MAVVPIRIVGD----PVLHTAT
DEF2_STRCO      ----------------------------MRQGSIPGAHGRVRPLGLLGD----PVLHARC
DEF3_STRCO      ---------------MPSVFVQGRPTASYPPFAPEAGRGAVRRVTEVGE----EVLHRPC
DEF4_STRCO      MAQQDTDQQHPGVLPVDDEGFVVDSQDCEEREADWRGRGTSRPITVVGN----PVLHKEC
DEF2_CLOPE      --------------------------------------MAVKKIVQIGH----EALKKVS
DEF2_RALSO      ---------------------------------------MIRPILKMGD----SRLLRVA
DEF1_STRCO      ------------------MGTPSDRVPLAERVEELLAVGGPLPIVAAGD----PVLRRAA
DEF_LEPIN       --------------------------------------MSVRKILRMGD----PILRKIS
DEF_TREPA       -----------------------------------------MELKFLGE----PCLTTVS
DEF_FUSNN       ---------------------------------------MVYKIKKYGE----DVLKQIA
DEF_THEMA       ----------------------------------------MYRIRVFGD----PVLRKRA
DEF_LACLA       -------------------------------------MISMDDIIREGY----PTLREVA
DEF_STRPN       -------------------------MSAIERITKAAHLIDMNDIIREGN----PTLRAIA
DEF_STRP1       -------------------------MSAQDKLIKPSHLITMDDIIREGN----PTLRAVA
DEF_STAAM       -------------------------------------MLTMKDIIRDGH----PTLRQKA
DEF_LISIN       -------------------------------------MLTMDDIVREGH----PALREVA
DEF_LISMO       -------------------------------------MLTMDDIVREGH----PALREVA
DEF_MYCGE       --------------------------------------MTFQPTKTWLVFDDNALINKPT
DEF_MYCPN       ---------------MTKILPVSTISIFRIILILPQINMELLPTKAWLVLDDVKEINEPT
DEF_MYCPU       -----------------------------------MLTMFKVEIVQLPK----KVLRQKS
DEF_UREPA       -----------------------MYNIKFLDLLNSNLKPNPQWIFKDPH----PILREVT
                                                                       :    

DEF_AGRFC       KLI--EQ-----VD---------AEVLRLADDMLETM------------YDA-PGIGLAA
DEF_BRUME       KPV--ER-----FD---------DQLRKFASDMFDTM------------YDA-PGIGLAA
DEF1_NOSS1      KRI--TK-----VD---------DETRQLIRDMLQTM------------YSS-DGIGLAA
DEF_AQUAE       EKV--DV-----ID---------KEVKNLIRDMFDTM------------YEA-EGVGLAA
DEF1_BACSU      ETV--TV-----FD---------KKLKKLLDDMYDTM------------LEM-DGVGLAA
DEF_BORBU       KQI--EN-----ID---------DKIRDYAKKMIELM------------DIS-GGVGLAA
DEF2_NOSS1      AWV--EN----IHD---------ATIQQLIDDLIATV------------AKA-NGVGIAS
DEF_BACHD       KPV--PV----PLS---------DEDKQTAKRMLEFLINSQNPEIAEKYSLR-PGVGLAA
DEF2_GEOSE      EPV--PL----PPS---------EEDKRILQSLLDYVKMSQDPELAAKYGLR-PGIGLAA
DEF2_BACSU      EPV--EL----PPT---------DAEKQQLADMIEFVKNSQNPELAEKYKLR-PGVGLAA
DEF_CHLMU       API--DE-----IT---------DELRQLVLDMSETM------------TFY-KGVGLAA
DEF_CHLTR       APV--TE-----IT---------DELRQLVLDMSETM------------AFY-KGVGLAA
DEF_CHLPN       SPI--AE-----IT---------DEIRNLVSDMCDTM------------EAH-RGVGLAA
DEF1_CLOPE      RVV--DD-----IN---------DRIKVLVEDMIETM------------YEN-NGVGLAS
DEF_BUCAI       KPV--KE-----IN---------KKIQKIANDMIDTM------------YQE-EGIGLAA
DEF_ECOLI       KPV--EE-----VN---------AEIQRIVDDMFETM------------YAE-EGIGLAA
DEF_SALTI       KPV--EE-----VN---------AEIQRIVDDMFETM------------YAE-EGIGLAA
DEF_SALTY       KPV--EE-----VN---------AEIQRIVDDMFETM------------YAE-EGIGLAA
DEF_YERPE       APV--KE-----VN---------GEIQRIVDDMFETM------------YAE-EGIGLAA
DEF1_VIBCH      KPV--EQ-----VT---------PEIQQIVDDMLETM------------YAE-EGIGLAA
DEF_HAEIN       EPV--TK-----VN---------DAIRKIVDDMFDTM------------YQE-KGIGLAA
DEF_PASMU       KPV--VE-----VN---------DEIREIVDNMFETM------------YLE-EGIGLAA
DEF_NEIMA       KPV--EQ-----VD---------ERIRKLIADMFETM------------YES-RGIGLAA
DEF_PSEAE       KPV--EV-----VD---------DAVRQLIDDMFETM------------YEA-PGIGLAA
DEF1_RALSO      KPV--AV-----VD---------DRIRKLVADMAETM------------YDA-PGIGLAA
DEF_XYLFA       VRVGVAE----VVS---------SSFQTLLDDMFETM------------YAA-PGIGLAA
DEF_HELPY       KEV--VS-----FD---------SKLHQQLDDMHETM------------IAS-EGIGLAA
DEF_HELPJ       KEV--VS-----FD---------SKLHQQLDDMHETM------------IAS-EGIGLAA
DEF_CAUVC       TPV--EA-----VT---------DELRALMDDMLETM------------YDA-PGIGLAA
DEF_RHILO       KPV--ER-----VD---------APLRKLADDMLATM------------YDA-PGIGLAA
DEF_RHIME       TPV--ET-----ID---------ADIRRLADDMLETM------------YDA-PGIGLAA
DEF1_RICCN      QPV--LE-----FT---------DQTRKFMDDMLKTM------------YHE-DGAGLAA
DEF_RICPR       KPV--LE-----CT---------DQTRKFMHDMLETM------------YNA-DGAGLAA
DEF2_VIBCH      KQV--TD-----V----------ASVQTLIDDLLDTL------------YATDNGIGLAA
DEF_CAMJE       EIV--NK-----FD---------TELHTLLDDMYETM------------IAS-NGVGLAA
DEF1_CLOAB      RKV--EK-----ID---------KRLLTLIDDMFETM------------YNA-DGVGLAA
DEF_CALS4       KPV--TE-----IN---------SHIITILEDMAETM------------YLN-DGVGLAA
DEF_MICDP       KRI--AK-----VD---------DELRQLIRDMLQTM------------YSK-DGIGLAA
DEF_SYNY3       KRI--AK-----VD---------DSIRKLAKEMLQTM------------YSA-NGIGLAA
DEF2_CLOAB      RPV--EV-----VD---------DKIRQILDDMLDTL------------QNTENGAAIAA
DEF_THETH       RPV--ED-----FS----------GIKRLAEDMLETM------------FEA-KGVGLAA
DEF_DEIRA       RNL--TA-----ADTLHVPGFEPQTVREVADTMLETM------------FEE-RGVGLAA
DEF_CLOB8       EEA--TK------N---------DMV--VIDDLIDTL-----------RANLEHCVGLAA
DEF2_RICCN      KTL--NF----PLS--------SEDLRDI--SILEK-----------KYDQEENCAGLAA
DEF_MYCLE       APV--QVAADGSLP---------ANLNGLISTMYDTM------------DAA-HGVGLAA
DEF_MYCTU       TPV--TVAADGSLP---------ADLAQLIATMYDTM------------DAA-NGVGLAA
DEF2_STRCO      AEV--TD-----FG---------PELAALVEDLFATM------------YAA-HGVGLAA
DEF3_STRCO      RDV--TE-----FG---------PDLAALIDDMFRTM------------YVA-EGAGLAA
DEF4_STRCO      EDV--TD-----FG---------EEFQQLVADMFASQ------------RTA-EGVGLAA
DEF2_CLOPE      EPV--KD-----VN----------EVKGLIQDLKDTL------------ATV-EGIGLAA
DEF2_RALSO      KPV--QR-----FQ--------TPELTALIEDMFDTM------------DAA-RGAGLAA
DEF1_STRCO      EPY--DG----QVA--------PALFERFVEALRLTM------------HAA-PGVGLAA
DEF_LEPIN       EPV--TE---DEIQ--------TKEFKKLIRDMFDTM------------RHA-EGVGLAA
DEF_TREPA       EPV--SE-----VD---------EQLRAFISGMFRVM------------RGA-GGVGLAA
DEF_FUSNN       KEVELSE-----IN---------DEFRQFLDDMVETM------------YET-DGVGLAA
DEF_THEMA       KPV--TK-----FD---------ENLKKTIERMIETM------------YHY-DGVGLAA
DEF_LACLA       NDV--TL----PLS--------DEDII-LGEKMLQFLHNSQDPVMAEKMGLR-GGVGLAA
DEF_STRPN       EEV--TF----PLS--------DQEII-LGEKMMQFLKHSQDPVMAEKMGLR-GGVGLAA
DEF_STRP1       KEV--SL----PLC--------DEDIL-LGEKMMQFLKHSQDPVMAEKLGLR-AGVGLAA
DEF_STAAM       AEL--EL----PLT--------KEEKETLIA-MREFLVNSQDEEIA-KRYGLRSGVGLAA
DEF_LISIN       TEV--TF----PLS---------DEEKKLGHDMLEFLINSQDEELAEK-YGLRGGVGIAA
DEF_LISMO       TEV--TF----PLS---------DEEKKLGRDMLEFLINSQDEDLAEK-YGLRGGVGIAA
DEF_MYCGE       EAV--NF----PID---------EQIETCIKKMIAYVDASYDGKA--QEYDIIPGIGIAA
DEF_MYCPN       KPV--QF----PLD--------QASL-DCIAKMMAYVDASYNGDA--EKYGIIPGIGIAA
DEF_MYCPU       KNV--NI----PLN--------KTNI-ELAEKMIYHIDDSQGPN----TKFR-PGVGVAA
DEF_UREPA       QDIEGNE-----LS--------KDDIYYL-KKMVRYIDVCYHNQA--KKYKIRSGIAIAA
                                                :                       .:*:

DEF_AGRFC       IQIGVPRRMLVI-DVAREGE---------------EKTPVVFINPEI---LKVSDDIS--
DEF_BRUME       IQVGEPIRMLVI-DLAKEGE---------------PKAPHIFVNPTI---VQSSDKRS--
DEF1_NOSS1      PQVGINKQLIVI-DCEPDNP---------------ANPPLILINPTI---KQVSREIC--
DEF_AQUAE       NQIGVPLSVMVI-DTSPKED--------------APPLKLVLINPEI---KEGEGKI---
DEF1_BACSU      PQIGILKRAAVV-EIGDDRG------------------RIDLVNPEI---LEKSGEQ---
DEF_BORBU       PQVGLDLALFVV-RENKMA------------------RPLVFINPSI---IETSYEFS--
DEF2_NOSS1      PQVAQSYRLFIV-ASRPNPR----------YPHAPEMEPTAMINPKI---VGHSTEI--V
DEF_BACHD       PQIGLSKQMIAV-HTTDENE---------------KEYSLVLFNPKI---ISESVEMTHL
DEF2_GEOSE      PQINVSKRMIAV-HVTDENG---------------TLYSYALFNPKI---VSHSVQQCYL
DEF2_BACSU      PQINIKKRMIAV-HAEDASG---------------KLYSYALFNPKI---VSHSVEKSYL
DEF_CHLMU       PQVGHSVALFIM-GVEKELD---------DGELIFCDFPKVFINPVI---TQKSEQLVY-
DEF_CHLTR       PQVGQSISLFIM-GVERELE---------DGELVFCDFPRVFINPVI---TQKSEQLVY-
DEF_CHLPN       PQVGKNVSLFVM-CVDRETE---------DGELIFSESPRVFINPVL---SDPSETP--I
DEF1_CLOPE      PQVGILKRIFVV-DAMDGAG------------------SRVFINPEI---LEKSGEQ---
DEF_BUCAI       TQVNIPLQIIVV-NTMEQK-----------------KNNLVLINPKI---IKKEGD---I
DEF_ECOLI       TQVDIHQRIIVI-DVSENRD-----------------ERLVLINPEL---LEKSGET---
DEF_SALTI       TQVDIHQRIIVI-DVSENRD-----------------ERLVLINPEL---LEKSGET---
DEF_SALTY       TQVDIHQRIIVI-DVSENRD-----------------ERLVLINPEL---LEKSGET---
DEF_YERPE       TQVDVHQQIIVI-DISENRD-----------------QRLVLINPEL---LEKSGET---
DEF1_VIBCH      TQVDIHQRIVVI-DISETRD-----------------QPMVLINPEI---IEKRGED---
DEF_HAEIN       PQVDILQRIITI-DVEGDK-----------------QNQFVLINPEI---LASEGET---
DEF_PASMU       TQVNIHQRIITI-DVEGTKE-----------------NQYVLINPEI---IDSCGET---
DEF_NEIMA       TQVDVHERVVVM-DLTEDR-----------------SEPRVFINPVI---VEKDGET---
DEF_PSEAE       TQVNVHKRIVVM-DLSEDK-----------------SEPRVFINPEF---EPLTEDMD--
DEF1_RALSO      TQVDVHERVITI-DVSESRD-----------------ELRVFINPEI---VWASEARK--
DEF_XYLFA       TQVNVHQRFMVI-DVSEEK-----------------NVPMVFINPEI---VTREGDQ---
DEF_HELPY       IQVGLPLRMLII-NLPQEDG------------VQHKEDCLEIINPKF---IETGGSM---
DEF_HELPJ       IQVGLPLRMLII-NLPQEDG------------VQHKEDCLEIINPKW---IETKGS---I
DEF_CAUVC       VQVGEPVRVIVM-DLAREGE---------------DKAPRYFVNPEI---LASSEDLQ--
DEF_RHILO       IQIGEPLRMLVI-DLAKEDE---------------TPAPHVFINPEI---LESAEARS--
DEF_RHIME       IQIGVPKRLLVL-DVTKEGE---------------EKQPLVFINPKV---VRSSEERS--
DEF1_RICCN      VQVGVLKRILVI-DIQDHDS----------VARPKDFYPLFIVNPEI---IEKAEELV--
DEF_RICPR       VQVGILLRILVI-DIKEYDP----------VERPKDFYPLFIVNPEI---IEKSTELV--
DEF2_VIBCH      PQVGREEAIVVI-DLSDNRD-----------------QPLVLINPKV---VSGSNKE---
DEF_CAMJE       IQVDIPLRVLLV-NIFDEND------------EQKKEDLLEIINPEI---IPLDEEMI--
DEF1_CLOAB      PQVGILKRLVVI-DVGEG--------------------PVVLINPEI---LETSGKA---
DEF_CALS4       NQVGILRRLVVI-DVGEG--------------------LLELINPEI---VYEEGEQ---
DEF_MICDP       PQVGIHKQLIVI-DLEPDNP---------------ANPPLVLINPTI---KQVSKEIC--
DEF_SYNY3       PQVGINKQLLVV-DCEQDKP---------------DEPPLIMINPQI---TRTSEELC--
DEF2_CLOAB      PQVGILKQLVVI-ATGEDI--------------------IKLVNPKI---VKKEGEQ---
DEF_THETH       PQIGLSQRLFVAVEYADEPE-----GEEERPLRELVRRVYVVANPVI------TYREGLV
DEF_DEIRA       PQIGLPVRMFVAVEYADDEE---ENEGQETPLRSRVLREYVMLNPVV----KVINKKKDK
DEF_CLOB8       NMIGVKKRILVF-TVGN--------------------LIVPMINPVI---LKKEKPY---
DEF2_RICCN      PQIGISKCIIIF-AVHEDAE-----LKKWHPDLKDTMPKTIWINPSY---KPIGIDKH--
DEF_MYCLE       NQIGYGLRVFVY-DCAEDC-------------RQTARRRGVVINPILETSEIPETMPDPD
DEF_MYCTU       NQIGCSLRLFVY-DCAADRA-------------MTARRRGVVINPVLETSEIPETMPDPD
DEF2_STRCO      NQVGEAVRVFVY-DCPDDED---------------ERHLGHVVNPRL---VETGGVV--V
DEF3_STRCO      NQVGVDLRLFVY-DCPDDEG---------------VRHVGHLVNPVLD--ALDPAARRLL
DEF4_STRCO      NQIGVSKKVFVY-DCPDDEG---------------VRHVGVVCNPRLV--ELPADRRRLD
DEF2_CLOPE      PQIAVNKRVVYI-NFGDGE------------------NEYVLINPEV---TGVSKETY--
DEF2_RALSO      PQIGVDLQVVIF-GFDRNDR----------YPDAPAVPKTVLINPTI---EPLSDAME--
DEF1_STRCO      PQVGVGLRVAVI-EDPAPVP-----DEVRVARGRVPQPFRVLVNPSY---EPAGAGRA--
DEF_LEPIN       PQIGILKQIVVV-GSEDNER----------YPGTPDVPERIILNPVI---TPLTKDTS--
DEF_TREPA       PQVGRTVRVFVV-DVE--------------------HHVRAFINPQI---TAASEEQS--
DEF_FUSNN       PQIGVSKRIFVC-D--DGNG-----------------VLRKVINPII---VPLTEETQ--
DEF_THEMA       PQVGISQRFFVM-DVGN--------------------GPVAVINPEI---LEIDPETE--
DEF_LACLA       NQLGLLKKVIAV-LIPNEPE--VDEDGNEIPPKEAYKMREIMYNAKV---VSHSVQDAAV
DEF_STRPN       PQLDISKRIIAV-LVPNIVE-------EGETPQEAYDLEAIMYNPKI---VSHSVQDAAL
DEF_STRP1       PQIDVSKRIIAV-LVPNLPD------KEGNPPKEAYSWQEVLYNPKI---VSHSVQDAAL
DEF_STAAM       PQINISKRMIAV-LIPDDGS--------------GKSYDYMLVNPKI---VSHSVQEAYL
DEF_LISIN       PQLAVTKRFLAI-HVHDEKD---------------RLYSYVLYNPKI---RSHSVQQACL
DEF_LISMO       PQLAVTKRFLAI-HVHDEKD---------------RLYSYVLYNPKI---RSHSVQQACL
DEF_MYCGE       NQIGYWKQLFYI-HLNDLN----------------KEKKCLLINPKI---IDQSENKAFL
DEF_MYCPN       NQIGYWKQMFYI-HLMDGG----------------VEHKCLLINPKI---INLSANKSFL
DEF_MYCPU       VQYGILKNVFYV-CVPNDSRLTQRDSSQEVKPEDKYLFRDVIFNPEV---IWKSDEMVAI
DEF_UREPA       NQVGWNKRATYI-HFNDEA----------------KEHHYLLINPHI---IKRSSEIAYL
                                                           *.               

DEF_AGRFC       TYEEGCLSIPD----YY-AEVERPASLTVQYVGR-DGKQ-QTVEADGLLATCLQHEIDHL
DEF_BRUME       TYEEGCLSIPD----YY-AEVERPATVKVNYFDA-DGKP-QSMEADGLMATCLQHEIDHL
DEF1_NOSS1      SAQEGCLSIPG----VY-MDVKRPEVVEVAYKDE-NGRP-QTLKATDLLGRCIQHEMDHL
DEF_AQUAE       KYKEGCLSFPG----LS-VEVERFQKVKVNALNE-HGEP-VELTLEGFPAIVFQHELDHL
DEF1_BACSU      TGIEGCLSFPN----VY-GDVTRADYVKVRAFNR-QGKP-FILEARGFLARAVQHEMDHL
DEF_BORBU       SYKEGCLSIPG----VY-YDLMRPKAVVINFHDE-NGKS-FTIENSDFLARIIQHEMDHL
DEF2_NOSS1      EGWEGCLSVPG----IR-GLVPRHQAIEVEYTDR-YGNL-QKQTLTDFVARIFQHEFDHL
DEF_BACHD       EGGEGCLSVDRE---VQ-GIVPRHARITVKAINE-NNEE-VRLKLKGFPAIVFQHEIDHL
DEF2_GEOSE      TTGEGCLSVDRD---VP-GYVLRYARITVTGTTL-DGEE-VTLRLKGLPAIVFQHEIDHL
DEF2_BACSU      TSGEGCLSVDEA---IP-GYVPRYARIRVKGTTL-EGEN-IDIRLKGFPAIVFQHEIDHL
DEF_CHLMU       -GNEGCLSIPG----LR-GEVARPDKITVTAKNL-DGQP-FSMTLEGFLARIVMHETDHL
DEF_CHLTR       -GNEGCLSIPG----LR-GEVARPDKITVSAKNL-DGQQ-FSLALEGFLARIVMHETDHL
DEF_CHLPN       IGKEGCLSIPG----LR-GEVFRPQKITVTAMDL-NGKI-FTEHLEGFTARIIMHETDHL
DEF1_CLOPE      TDEEGCLSLPG----RH-KPVKRANKIKIKALDV-NGNE-FVLDAEGFLARAIQHEYDHL
DEF_BUCAI       SIEEGCLSIPE----YQ-ASIPRSNYIQVQAVNL-DGEK-IEIEAKSILSICIQHEIDHL
DEF_ECOLI       GIEEGCLSIPE----QR-ALVPRAEKVKIRALDR-DGKP-FELEADGLLAICIQHEMDHL
DEF_SALTI       GIEEGCLSIPE----QR-ALVPRAEKVKIRALDR-NGNP-FELEADGLLAICIQHEMDHL
DEF_SALTY       GIEEGCLSIPE----QR-ALVPRAEKVKIRALDR-DGNP-FELEADGLLAICIQHEMDHL
DEF_YERPE       GIEEGCLSIPE----QR-ALVPRAEKVKIRALDR-DGKP-FELETDGLLAICIQHEMDHL
DEF1_VIBCH      GIEEGCLSVPG----AR-ALVPRAAEVTVKALDR-NGQE-YQFDADDLLAICVQHELDHL
DEF_HAEIN       GIEEGCLSIPG----FR-ALVPRKEKVTVRALDR-DGKE-FTLDADGLLAICIQHEIDHL
DEF_PASMU       GIEEGCLSLPG----FR-GFVPRKEKVTIKALDR-HGEE-YTLSAEGLLAICIQHEIDHL
DEF_NEIMA       TYEEGCLSVPG----IY-DTVTRAERVKVEALNE-KGEK-FTLEADGLLAICVQHELDHL
DEF_PSEAE       QYQEGCLSVPG----FY-ENVDRPQKVRIKALDR-DGNP-FEEVAEGLLAVCIQHECDHL
DEF1_RALSO      VWDEGCLSVPD----IY-DKVERPDRVRVRALNE-KGES-FELETDGLLAVCIQHEMDHL
DEF_XYLFA       VFQEGCLSVPG----IH-ADVTRALSIVVRFLDR-HGDE-QQLTAEGLLAVCIQHEMDHL
DEF_HELPY       MYREGCLSVPG----FY-EEVERFEKVKIEYQNR-FAEV-KVLEASELLAVAIQHEIDHL
DEF_HELPJ       MYREGCLSVPG----FY-EEVERFEKVKIEYQNR-FAEV-KILEASELLAVAIQHEIDHL
DEF_CAUVC       GYEEGCLSVPE----YY-DEVERPSKVTLRYMNY-QGET-VVEEAEGLFAVCIQHEMDHL
DEF_RHILO       VYEEGCLSIPD----YY-AEVERPASVRVKYLDR-DGKL-QEMEAEGLMATCLQHEIDHL
DEF_RHIME       VYEEGCLSIPD----YY-AEVERPAAITVEYVDR-EGKE-QAVEAEGLLATCLQHEIDHL
DEF1_RICCN      TANEGCISLPE----QR-IEVARPESIKIRYLDY-HGKS-RELKANDWLARVIQHEYDHL
DEF_RICPR       TANEGCISLPK----QR-IEVTRPESVKIRYLDY-HGKS-QELKANDWLARVIQHEYDHL
DEF2_VIBCH      MGQEGCLSVPD----YY-ADVERYTSVVVEALDR-EGKP-LRIETSDFLAIVMQHEIDHL
DEF_CAMJE       TCTEGCLSVPD----FF-EEVKRYNHILLKYQDR-FGEF-KELEAKGFLAVAIQHENDHL
DEF1_CLOAB      VDVEGCLSIPE----RQ-GEVERPTYVKAKALNE-KGEE-IVIEAEDLFARAICHETDHL
DEF_CALS4       IGPEGCLSIPG----VF-GEVKRPQKVKVRYLDR-EGNV-KEIVGEDLLARALCHEIDHL
DEF_MICDP       VAQEGCLSIPN----VY-MDVKRPEVVEIAYKDE-NGRP-KTLKATDLLARCIQHEMDHL
DEF_SYNY3       VVEEGCLSVPN----VY-MDVTRPRAIEVTYKDE-HGRP-QKRLFAELTARVIQHEMDHL
DEF2_CLOAB      EVVEGCLSIPN----VY-GKLKRPKKVTVEALNE-NGEK-ITLTGEGFLAKCFCHEIDHL
DEF_THETH       EGTEGCLSLPG----LYSEEVPRAERIRVEYQDE-EGRG-RVLELEGYMARVFQHEIDHL
DEF_DEIRA       SYQEGCLSIPG----IYEDGVPRARQVRVDYTDL-DGQP-RSIEAEDYLARVFQHETDHL
DEF_CLOB8       ETEESCLSLIG----FR--KTKRYETIEVTYLDR-NFNK-KKQVFNGFTAQIIQHEMDHF
DEF2_RICCN      EDYEGCFSVEN----AT-GPVARFKKIHYHAYDI-NGNQ-IQGIAEGFLARVIQHEIDHL
DEF_MYCLE       TDNEGCLSVPG----ES-FPIGRAQWARVTGLDA-DGNP-VTTEGTGLFARMLQHETGHL
DEF_MYCTU       TDDEGCLSVPG----ES-FPTGRAKWARVTGLDA-DGSP-VSIEGTGLFARMLQHETGHL
DEF2_STRCO      RGPEGCLSLPG----LE-AGTERYDEAVVTGFTV-AGEP-VTVRGTGFFARCLQHECDHL
DEF3_STRCO      DEGEGCLSVPG----AV-MAVPRPDRAVVRGLDK-DGVP-LLVEGTGYFARCLAHETDHV
DEF4_STRCO      DSNEGCLSVPT----AY-APLARPDYAEVTGQDE-KGNP-VKVRGTGYFARCLQHETDHL
DEF2_CLOPE      EDYEGCLSYVM----HE-GLVERPRAVRIQALNE-KGEL-KVYEAQDLLARCFLHEIDHL
DEF2_RALSO      DGWEGCLSVPG----LR-GVVPRYTRLRYTGYDQ-HGHA-IDRIAEGFHARVVQHECDHL
DEF1_STRCO      AFFEGCLSVPG----WQ-AVVARHAEVRLRAHDE-HGRA-VDEVFAGWPARIVQHETDHL
DEF_LEPIN       GFWEGCLSVPG----MR-GYVERPNQIRMQWMDE-KGNQ-FDETIDGYKAIVYQHECDHL
DEF_TREPA       SYEEGCLSIPH----IY-ERVLRPRRVSVQYLDE-NGKR-CAVDADGILARVIQHEYDHL
DEF_FUSNN       EFEEGCLSVPG----IY-KKVERPKRVLLKYLNE-YGKE-VEEIAENFLAVVVQHENDHL
DEF_THEMA       VAEEGCLSFPE----IF-VEIERSKRIKVKYQNT-RGEY-VEEELEGYAARVFQHEFDHL
DEF_LACLA       EGGEGCLSVDRE---VP-GYVVRHARVTVEYYNK-EGEK-KKIRLKDFPAICVQHEIDHT
DEF_STRPN       GEGEGCLSVDRN---VP-GYVVRHARVTVDYFDK-DGEK-HRIKLKGYNSIVVQHEIDHI
DEF_STRP1       SDGEGCLSVDRV---VE-GYVVRHARVTVDYYDK-EGQQ-HRIKLKGYNAIVVQHEIDHI
DEF_STAAM       PTGEGCLSVDDN---VA-GLVHRHNRITIKAKDI-EGND-IQLRLKGYPAIVFQHEIDHL
DEF_LISIN       SGGEGCLSVDRE---VP-GYVVRSERVTIDAFDE-NGTP-LKLRFKGYPAIVVQHEIDHL
DEF_LISMO       SGGEGCLSVDRE---VP-GYVVRSERVTIDAFDE-NGTP-LKLRFKGYPAIVIQHEIDHL
DEF_MYCGE       ESGEGCLSVKKQH----KGYVIRSEWITIKGYDWFEKKE-ITIKATGLFGMCLQHEFDHL
DEF_MYCPN       KSGEGCLSVPKMH----QGYVIRHEWITITGFDWLQQKE-ITITATGLFGMCLQHEFDHL
DEF_MYCPU       SQGEGCLSVDESWPNQE-GLVRRHMEIKVKGYSYFQKKE-MIWHVKGYVAIVFQHELDHL
DEF_UREPA       NPGEGCLSVDDDR----SGYVIRNKKVHVKAYDL-ISEQFIDQEFSGIIAICIQHEIGHL
                   *.*:*              *                          .    ** .* 

DEF_AGRFC       NGVLFIDHISRLKRDMVIKKFTKAARAKI--------------------
DEF_BRUME       NGVLFIDHISKLKRDMVIKKFKKLASQRASKKVL---------------
DEF1_NOSS1      NGVVFVDRVDNSLTLAQELSKNGFSYQAVKPVA----------------
DEF_AQUAE       KGITFVDRLKGWRRRMALEKYQKLLKSRK--------------------
DEF1_BACSU      DGVLFTSKISKYYTEDELADMEG--------------------------
DEF_BORBU       NGVLFIDYYEEKLKNKLLKPYMRERGLKAK-------------------
DEF2_NOSS1      DGVLFIDRVESNLNTITEEEYQELVTKNTK-------------------
DEF_BACHD       NGIMFYDRIEGWVDPYKREINPSL-------------------------
DEF2_GEOSE      NGIMFYDRINPADPFQVPDGAIPIGR-----------------------
DEF2_BACSU      NGVMFYDHIDKENPFKEPENAIAIER-----------------------
DEF_CHLMU       HGVLYIDRMSDKDKTKQFKNNLEKIRRKYSILRGL--------------
DEF_CHLTR       HGVLYIDRMSDKDKTKQFKNNLEKIRRKYSILRGL--------------
DEF_CHLPN       NGVLYIDLMEEPKDPKKFKASLEKIKRRYNTHLSKEELVS---------
DEF1_CLOPE      EGVLFIDHEL---------------------------------------
DEF_BUCAI       KGKLFIDYLSKFKRERIQKKFEKINKKNKKFSIKE--------------
DEF_ECOLI       VGKLFMDYLSPLKQQRIRQKVEKLDRLKARA------------------
DEF_SALTI       VGKLFIDYLSPLKQQRIRQKVEKLDRLNARA------------------
DEF_SALTY       VGKLFIDYLSPLKQQRIRQKVEKLDRLNARA------------------
DEF_YERPE       IGKLFVDYLSPLKRQRIRQKLEKMAKLNARAN-----------------
DEF1_VIBCH      AGKLFVDYLSPLKRNRIKEKLEKIKRFNEKK------------------
DEF_HAEIN       NGILFVDYLSPLKRQRIKEKLIKYKKQIAKS------------------
DEF_PASMU       NGIVFADYLSPLKRQRMKEKLLKLQKQLARQK-----------------
DEF_NEIMA       MGIVFVERLSQLKQGRIKTKLKKRQKHTI--------------------
DEF_PSEAE       NGKLFVDYLSTLKRDRIRKKLEKQHRQQA--------------------
DEF1_RALSO      MGKVFVEYLSPLKQNRIKIKLKKHQLERAR-------------------
DEF_XYLFA       DGKLFIDYLSPLKRDMVRRKLEKQRRRAS--------------------
DEF_HELPY       NGVLFVDKLSILKRKKFEKELKELQKKQKHE------------------
DEF_HELPJ       NGVLFVDKLSILKRKKFEKELKELQKKQKHK------------------
DEF_CAUVC       EGVLFIDHLSRLRRDRAMAKVKKARRAA---------------------
DEF_RHILO       NGVLFIDHISKLKRDMVVKKFKKLAKDKAPGKLVG--------------
DEF_RHIME       NGVLFIDYISKLKRDMVIRRFTKAAKTRGAKAI----------------
DEF1_RICCN      EGKLMIDYLSNLKRDVVLRKLKKLKNNIV--------------------
DEF_RICPR       EGKLMVDYLSNLKRDVVLRKLKKLKNNIV--------------------
DEF2_VIBCH      SGNLFIDYLSPLKQQMAMKKVKKHVKNRAR-------------------
DEF_CAMJE       NGHLFIEKISFAKRQKFDKEFKKKKKNHKKEK-----------------
DEF1_CLOAB      NGVLFVDKLAESEGN----------------------------------
DEF_CALS4       EGVLFVDKVIRFLDKEELEGVKEV-------------------------
DEF_MICDP       NGVVFVDRVDNSLTLAQELSKNGFSYQAVKPVA----------------
DEF_SYNY3       NGVMFVDRVDNPLALAESLKKEGFSMQAVKPVA----------------
DEF2_CLOAB      DGILFTDLVTEYIK-----------------------------------
DEF_THETH       DGILFFERLPKPKREAFLEANRAELVRFQKEARALLKELSQG-------
DEF_DEIRA       DGKLFLDHLPADITEDHRKDLLRIQQASKNFLAQLSEWDKAQRHLKENL
DEF_CLOB8       EGIII--------------------------------------------
DEF2_RICCN      NGKVFLDYVAP-KKIMTKEEYLEMRKKAMEQENIKS-------------
DEF_MYCLE       DGFLYLDYLIGRHARSAKRAIKSRHWGVPGLSWMPGEVPDPFGP-----
DEF_MYCTU       DGFLYLDRLIGRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH-----
DEF2_STRCO      EGRVYADRLTGRRHRKLMRQVARASWHR---------------------
DEF3_STRCO      NGHVYLDRLSGRERKAALRQSADRREEVFARRAANAAAFAA--------
DEF4_STRCO      YGYLYIDRLSKRERKDALRQMAENEPRYPVVAND---------------
DEF2_CLOPE      EGIMYVDRAKEM-----YELVEK--------------------------
DEF2_RALSO      QGILYPMRVQDFTRFGFTEILFPELPAHHND------------------
DEF1_STRCO      DGTLYLDRAE-LRSLASNAAMAELWSQPTPRRAASALGFELPGPAA---
DEF_LEPIN       QGILYVDRLKDTKLFGFNETLDSSHNVLD--------------------
DEF_TREPA       DGILFLDRIDEKRRDDALRRYAALRGTIR--------------------
DEF_FUSNN       DGILFIEKISPMAKRLIAKKLANIKKETKRIKEENE-------------
DEF_THEMA       NGVLIIDRISPAKRLLLRKKLMDIARTVKR-------------------
DEF_LACLA       NGVMFYDHINMNDPWEIKDGMIIVK------------------------
DEF_STRPN       NGIMFYDRINEKDPFAVKDGLLILE------------------------
DEF_STRP1       NGVLFYDRINAKNPFETKEELLILD------------------------
DEF_STAAM       NGVMFYDHIDKNHPLQPHTDAVEV-------------------------
DEF_LISIN       NGVMFYDHINKENPSYLPPDVDVFG------------------------
DEF_LISMO       NGIMFYDHINKENPSYLPPDVDVFG------------------------
DEF_MYCGE       QGRFFYQRINPLNPWFKKPEWKVINPTLKTSNG----------------
DEF_MYCPN       QGRFYYHRINPLNPLFTNKEWKVINPALPSDSE----------------
DEF_MYCPU       NGMLFIDRIDP-KRLWDKSGIKVL-------------------------
DEF_UREPA       DAGLYYDNINQQQPFYADPSWTKIGR-----------------------
                 .