CLUSTAL format seed alignment for MF_00164

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLMS_NOSS9      MCGIVGYI---GTQAATDILLAGLEKLEYRGYDSAGIATVWEG----EINCVRAKGKLHN
GLMS_SYNY3      MCGIVGYI---GTQTAVNILIEGLERLEYRGYDSAGIATVTEG----KIESVRAKGKLFN
GLMS_CYACA      MCGIIGYV---GEGSCRDVLINGLDKLSYRGYDSAGIAFIKNS----KINVVRSKGRIEK
GLMS_CHLPN      MCGIFGYL---GNQDGVSIVLEGLAKLEYRGYDSAGLAAVVEQ----ELFIRKTVGRVQE
GLMS_CHLTR      MCGIFGYL---GEKNAVPLVLEGLSKLEYRGYDSAGIATLVEG----RLFVEKAVGPVSQ
GLMS_METMP      MCGIIGYI--GNE-KASKILLKGLKRLEYRGYDSCGIAT--ID---DTIKLKKNTGKVLE
GLMS_PYRHO      MCGIIGYI--GPR-KASDVIVEGLKRLEYRGYDSAGIATC-YE---GKIFIKKGAGKIDE
GLMS_METTH      MCGIVACI--LKDGSAAPVLLECVRRLEYRGYDSVGIAT--SD---PMIRIKKDSGKIDE
GLMS_SULAC      MCGIIGIVSSKEDKKIADKVISALKRLEYRGYDSVGVASLDN----NKLEVRKAKGTVEE
GLMS_AERPE      MCGIIGLAFAEGNS-VAGALVRGLKRLEYRGYDSMGVAVIEPP---GRLVVRKAAGKIGE
GLMS_AQUAE      MCGIVGYV---GRDLALPIVLGALERLEYRGYDSAGVALI-ED---GKLIVEKKKGKIRE
GLMS_THET8      MCGIVGYV---GFRNATDVLLDGLRRLEYRGYDSAGIAVR-TP---EGLKVVKRSGKLSA
GLMS_THEMA      MCGIVGMV---GENLKLEDLVTSLQKLEYRGYDSAGIAYL-GD---S-FGVYKKKGRIDV
GLMS_MYCLE      MCGLVGYV---GQRPACGVVMDALRRMEYRGYDSSGIALINGSAKSGNLTVRRRAGRLSN
GLMS_MYCTU      MCGIVGYV---GRRPAYVVVMDALRRMEYRGYDSSGIALVDG----GTLTVRRRAGRLAN
GLMS_MYCS2      MCGIVGYV---GHRPARDIVVDALRRMEYRGYDSAGIALIDGN---GGLTVRRRAGRLAN
GLMS_STRCO      MCGIVGYV---GPQSALDVVMAGLKRLEYRGYDSAGVAVLAD----GGLATAKRAGKLVN
GLMS_HALSA      MCGITGYI---GTDPTGRIVHEGLQNLEYRGYDSAGIALAGG----GSLSVHKTGGEVGD
GLMS_HELPJ      MCGIVGYI---GDSEKKSILLEGLKELEYRGYDSAGLAVLSA----NRLEVFKTQGKLEN
GLMS_HELPY      MCGIVGYI---GDSEKKSVLLEGLKELEYRGYDSAGLAVLSN----DRLEVFKTQGKLEN
GLMS_CAMJE      MCGIVGYI---GNNEKKQIILNGLKELEYRGYDSAGMAVMQE----GELSFFKAVGKLEN
GLMS_ECOLI      MCGIVGAI---AQRDVAEILLEGLRRLEYRGYDSAGLAVVDAE---GHMTRLRRLGKVQM
GLMS_HAEIN      MCGIVGAV---AQRDVAEILINGLHRLEYRGYDSAGVAVINKQ---NELQRIRCLGKVKA
GLMS_BUCAI      MCGIVAAV---TQRNIANFLIDGIKKLEYRGYDSSGLAVIDNK---NNIVRIRCVGKVNE
GLMS_TREPA      MCGIVGMV---AGRDVSGLLLEGLRRLEYRGYDSAGIAVVGSD---CALRLLRCEGRVQS
GLMS_ACIFR      MCGIVGGV---SKTDLVPMILEGLQRLEYRGYDSAGLAILGAD---ADLLRVRSVGRVAE
NODM_RHILV      MCGIVGIV---GHKPVSERLIEALGRLEYRGYDSSGVATIFE----GELHRRRAEGKLGN
NODM_RHIML      MCGIVGIV---GHQPVSERLVEALEPLEYRGYDSAGVATMDA----GTLQRRRAEGKLGN
GLMS_STRA3      MCGIVGVV---GNTNATDILIQGLEKLEYRGYDSAGIFVVGD----NKSQLVKSVGRIAE
GLMS_STRA5      MCGIVGVV---GNTNATDILIQGLEKLEYRGYDSAGIFVVGD----NKSQLVKSVGRIAE
GLMS_STRP3      MCGIVGVV---GNRNATDILMQGLEKLEYRGYDSAGIFVANA----NQTNLIKSVGRIAD
GLMS_STRP8      MCGIVGVV---GNRNATDILMQGLEKLEYRGYDSAGIFVANA----NQTNLIKSVGRIAD
GLMS_STRP1      MCGIVGVV---GNRNATDILMQGLEKLEYRGYDSAGIFVANA----NQTNLIKSVGRIAD
GLMS_STRP6      MCGIVGVV---GNRNATDILMQGLEKLEYRGYDSAGIFVANG----DKLSLVKSVGRIAD
GLMS_STRMU      MCGIVGVV---GNRNATDILMQGLEKLEYRGYDSAGIYVINQP---ENGRLIKSVGRIAD
GLMS_LACLA      MCGIVGVV---GSKNATDILMQGLEKLEYRGYDSAGIFVNGQE---TAAKLVKSVGRIAD
GLMS_STRPN      MCGIVGVV---GNTNATDILIQGLEKLEYRGYDSAGIFVLDG----ADNHLVKAVGRIAE
GLMS_STRR6      MCGIVGVV---GNTNATDILIQGLEKLEYRGYDSAGIFVLDG----ADNHLVKAVGRIAE
GLMS_LISIN      MCGIVGYI---GTNNAKGILLEGLEKLEYRGYDSAGIALQNK----DLVTVVKEKGRIAD
GLMS_LISMF      MCGIVGYI---GTNNAKSILLEGLEKLEYRGYDSAGIALQNK----DLVTVVKEKGRIAD
GLMS_LISMO      MCGIVGYI---GTNNAKGILLEGLEKLEYRGYDSAGIALQNK----ELVTVVKEKGRIAD
GLMS_OCEIH      MCGIVGYI---GQNDTKEILLTGLEKLEYRGYDSAGIATLND----NGVHVTKVKGRIAT
GLMS_BACSU      MCGIVGYI---GQLDAKEILLKGLEKLEYRGYDSAGIAVANE----QGIHVFKEKGRIAD
GLMS_LACPL      MCGIVGVT---GKDSAVSILLNGLEKLEYRGYDSAGIYVNDQD---GHDYLVKEKGRIDD
                ***: .             :   :  :.****** *:               :  * :  

GLMS_NOSS9      LRSKLE------LIETPAQIGIGHTRWATHGKPEEYNAHPHVDTAMPVAV-QNGIIENYR
GLMS_SYNY3      LKEKLE------NHSNFSRLGIGHTRWATHGKPEEHNAHPHLDNQQRIAVVQNGIIENYQ
GLMS_CYACA      LKEKINDNF---QKFEIGNIGIGHTRWATHGEPTEINAHPHLDAEGQFAVVQNGVIENYV
GLMS_CHLPN      LSNLFQER------EIPTASVIGHTRWATHGVPTEINAHPHVDEGRSCAVVHNGIIENFK
GLMS_CHLTR      LCSAVSS-------DIHSQAAIGHTRWATHGEPSRFNAHPHVDMDASCALVHNGIIENFQ
GLMS_METMP      VSKKENFE------DMTGFIGIGHSRWATHGGITKNNAHPHYDCSEKICIAHNGIISNYK
GLMS_PYRHO      LVKKLNFL------ELPGNIGIGHTRWATHGIPNDTNAHPHTDCTGKIVVVHNGIIENFQ
GLMS_METTH      VDAELDLA------DLPGTMGIAHVRWATHGLPTAENAHPHTDCSGEIAVVHNGIIENYL
GLMS_SULAC      VISKKKVS------EMSGYIFLGHTRWATHGPPTDYNAHPHVDCSGKIAVIHNGTIKNYK
GLMS_AERPE      VVRRTGVL------SLRGRVGIGHTRWATHGPPNDVNAHPHTDCGGRVAVVHNGVIRNYA
GLMS_AQUAE      LVKALWGK------DYKAKTGIGHTRWATHGKPTDENAHPHTDEKGEFAVVHNGIIENYL
GLMS_THET8      LAEAVGKT------PLQGALGIGHTRWATHGAPTDPNAHPHTTEDGRIALIHNGIFENYL
GLMS_THEMA      LKNGLKQKL-----NDRFFVGIAHTRWATHGEPNDMNAHPHMDCKEEIAVVHNGIIENYR
GLMS_MYCLE      LESVLAEMVPA---SLAGNVGLGHIRWATHGRPTDRNAHPHRDATGKIAVVHNGIIENFP
GLMS_MYCTU      LEEAVAEMPST---ALSGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIAVVHNGIIENFA
GLMS_MYCS2      LEATLAETDSNDGDGLGGSTGLGHTRWATHGRPTDRNAHPHRDAAGKIAVVHNGIIENFA
GLMS_STRCO      LDKELSEHPLP-----AAATGIGHTRWATHGGPTDANAHPHLDNAGRVAVVHNGIIENFA
GLMS_HALSA      LPVPSRE---------DGTRGIGHTRWSTHGEPTRENAHPHTDCTGDVAVVHNGIIENYA
GLMS_HELPJ      LRTELKNKEF-----LNFGVSIAHTRWATHGKPSSANAHPHFT--ENLALVHNGIIENYA
GLMS_HELPY      LKLELKNKEF-----LDFGVSIAHTRWATHGKPSSANAHPHFT--ENLALVHNGIIENYA
GLMS_CAMJE      LANKCTDFES-----QGYGFAIGHTRWATHGKPTEINAHPHLG--QYSCVIHNGIIENYK
GLMS_ECOLI      LAQAAEEHP------LHGGTGIAHTRWATHGEPSEVNAHPHVS--EHIVVVHNGIIENHE
GLMS_HAEIN      LDEAVSEKP------LIGGTGIAHTRWATHGEPSETNAHPHSS--GTFAVVHNGIIENHE
GLMS_BUCAI      LIKKTNKKK------ILGSIGVAHTRWATHGKVSKENTHPHIS--SNIIVVHNGIIENNS
GLMS_TREPA      LCALLGQSP------LCGTMGIAHTRWATHGKPCAANAHPHCS--ESVAIVHNGIVENHR
GLMS_ACIFR      LTAAVVERG------LQGQVGIGHTRWATHGGVRECNAHPMISH-EQIAVVHNGIIENFH
NODM_RHILV      LKTRLKEAP------LSGTVGIAHTRWATHGAPTECNAHPHFT--DGVAVVHNGIIENFS
NODM_RHIML      LREKLKEAP------LSGTIGIAHTRWATHGAPTERNAHPHFT--EGVAVVHNGIIENFA
GLMS_STRA3      LQAKVGD-------SVSGTTGIGHTRWATHGKPTEGNAHPHTSGSGRFVLVHNGVIENYL
GLMS_STRA5      IQAKVGD-------SVSGTTGIGHTRWATHGKPTEGNAHPHTSGSGRFVLVHNGVIENYL
GLMS_STRP3      LRAKIGI-------DVAGSTGIGHTRWATHGQSTEDNAHPHTSQTGRFVLVHNGVIENYL
GLMS_STRP8      LRAKIGI-------DVAGSTGIGHTRWATHGQSTEDNAHPHTSQTGRFVLVHNGVIENYL
GLMS_STRP1      LRAKIGI-------DVAGSTGIGHTRWATHGQSTEDNAHPHTSQTGRFVLVHNGVIENYL
GLMS_STRP6      LRSKIGI-------DVAGSTGIGHTRWATHGQATVENAHPHTSASSRFVLVHNGVIENYL
GLMS_STRMU      LRAKIGI-------DVAGSTGIGHTRWATHGQATEENAHPHASATGRLVLVHNGVIENYL
GLMS_LACLA      LRGKLGI-------DVSGTAGIGHTRWATHGKPTEDNAHPHTSTSGRFILVHNGVIENFV
GLMS_STRPN      LSAKTA--------GVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENYL
GLMS_STRR6      LSAKTA--------GVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENYL
GLMS_LISIN      LASLVPS-------DAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTIVHNGVIENYT
GLMS_LISMF      LASLVPS-------DAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTMVHNGVIENYT
GLMS_LISMO      LASLVPS-------DAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTIVHNGVIENYT
GLMS_OCEIH      LREDVDT-------TIDSTMGIGHTRWATHGVPSVMNAHPHQSTSERFTIVHNGVIENYN
GLMS_BACSU      LREVVDA-------NVEAKAGIGHTRWATHGEPSYLNAHPHQSALGRFTLVHNGVIENYV
GLMS_LACPL      LRKEVGE-------AVHGSTGIGHTRWATHGEPSVANAHPQVSADGRFYLVHNGVIENFE
                :                    :.* **:***     *:**         : :** . *  

GLMS_NOSS9      ELREELKAKGHVFRSETDTEVIPHLIAEILKNFSASSSSSDFLEAVSQAVNRL-EGAFAL
GLMS_SYNY3      TLRDQLKEKGYQFYSETDTEVIPILIADILKDLPSDDPDEALLEAIGKAVHQL-EGAFAI
GLMS_CYACA      QLKNYLTVNGTYFLSDTDAEVIPHLIAYKQKHLKLQ-----IVEAILCALSEL-KGNFST
GLMS_CHLPN      ELRRELTAQGISFASDTDSEIIVQLFSLYYQE------SQDLVFSFCQTLAQL-RGSVAC
GLMS_CHLTR      KLKEELEEQGVVFSSDTDTEVIVQLFARRYKE------TRDLIQSFSWTLKRL-QGSFAC
GLMS_METMP      ELKELLISKGHIFKSETDTEVIPHLIEEEIKDFKEI-TEKTYINAIQNTIKKL-NGTYAL
GLMS_PYRHO      ELKRELLKRGHVFRSDTDTEVIAHLIEENLR------ITGNFEDAFRMSLLRL-RGSYAL
GLMS_METTH      EVKEELESEGHIFRSETDTEVIPHLIEKYMD------EGMDLEAATATALRKL-RGAYAI
GLMS_SULAC      ELREELQTLGHVFKSDTDTEIIPHLIEEFMK------RGMDAYSAFRNSIKTL-EGSYAV
GLMS_AERPE      SLRRELEARGHRLVSETDTELVAHLIEEYLG------RGYSFLEALSLLGRVL-RGSYAL
GLMS_AQUAE      ELKEELKKEGVKFRSETDTEVIAHLIAKNYR--------GDLLEAVLKTVKKL-KGAFAF
GLMS_THET8      ELKEALEARGHRFRSETDTEVLAHLLEETYR--------GDLLEALREALKAV-RGAYA-
GLMS_THEMA      EIREFLEQRGHVFSSETDTEVIAHLVEEEFE--------GDLLDAVLKAVKKL-KGAYAI
GLMS_MYCLE      SLRHELEIAGVEFVSDTDTEVAVHLVAQAYCAGE---TAGDFVGSVLAVLRRL-QGHFTL
GLMS_MYCTU      VLRRELETAGVEFASDTDTEVAAHLVARAYRHGE---TADDFVGSVLAVLRRL-EGHFTL
GLMS_MYCS2      PLRAELEAAGVEFASDTDTEVAVHLVARQYTQGD---TAGDFPASVLAVLQRL-EGHFTL
GLMS_STRCO      PLRAELAERGHELPSETDTEVVAHLLAEEYSA------CADLAEAMRLVCGRL-EGAFTL
GLMS_HALSA      ALADELR-ADHVFHSDTDTEVVPHLIETHLADG------VSLLTAVQRTTERL-TGSYAL
GLMS_HELPJ      SLKKELENKGHAFLSQTDTEVIAHLLEETLKSE------GDLLKAFEKSISLL-KGSYAI
GLMS_HELPY      SLKKELENKGHAFLSQTDTEVIAHLLEETLKSE------SDLLKAFEKSISLL-KGSYAI
GLMS_CAMJE      EIKDKLEKEGVSFLSQTDTEVIVQLFEFYARNL------G-VFEAWQKTIKEL-RGAFAT
GLMS_ECOLI      PLREELKARGYTFVSETDTEVIAHLVNWELKQG------GTLREAVLRAIPQL-RGAYGT
GLMS_HAEIN      ELRELLKSRGYVFLSQTDTEVIAHLVEWEMRTT------DSLLDAVKKAVKQL-TGAYGM
GLMS_BUCAI      TLRGFLKKQGYIFSSDTDTEVIAHLLHWEQNKKK-----DSLIKVIQNSIKKL-DGNYSM
GLMS_TREPA      SLREMLVTRGYFFHSQTDSEVLAHLLHWELRYT------AHLLLAVKKVLTQV-RGTYGL
GLMS_ACIFR      ALRAHLEAAGYTFTSETDTEVIAHLVHH-YRQTA-----PDLFAATRRAVGDL-RGAYAI
NODM_RHILV      KLKDALAEVGTKFQTDTDTEVIAHLLTKFRRDG------MGCLEAMHAMLKCV-EGAFAL
NODM_RHIML      ELKDELAAGGAEFQTETDTEVVAHLLAKYRRDG------LGRREAMHAMLKRV-KGAYAL
GLMS_STRA3      QIKETYL-TKHNLKGETDTEIAIHLVEHFVEEDN-----LSVLEAFKKALHII-EGSYAF
GLMS_STRA5      QIKETYL-TKHNLKGETDTEIAIHLVEHFVEEDN-----LSVLEAFKKALHII-EGSYAF
GLMS_STRP3      HIKTEFL-AGHDFKGQTDTEIAVHLIGKFVEEDK-----LSVLEAFKKALSII-EGSYAF
GLMS_STRP8      HIKTEFL-AGHDFKGQTDTEIAVHLIGKFVEEDK-----LSVLEAFKKALSII-EGSYAF
GLMS_STRP1      HIKTEFL-AGHDFKGQTDTEIAVHLIGKFVEEDK-----LSVLEAFKKSLSII-EGSYAF
GLMS_STRP6      QMKEEYL-AGHEFKGQTDTEIAVHLIGKFVEEDG-----LSVLEAFKNALSII-EGSYAF
GLMS_STRMU      QIKENYL-AGHNLKGETDTEIAVHLIGQFVT-DG-----LSVLESFKKALHII-EGSYAF
GLMS_LACLA      ELKNEFL-MNDTFKGQTDTEIAVHLIAKFAEEEG-----LSTLEAFKKALSLI-QGSYAF
GLMS_STRPN      EIKEEYL-AGHHFKGQTDTEIAVHLIGKFAEEEG-----LSVLEAFKKALHII-RGSYAF
GLMS_STRR6      EIKEEYL-AGHHFKGQTDTEIAVHLIGKFAEEDG-----LSVLEAFKKALHII-RGSYAF
GLMS_LISIN      LLKEEYL-KNHSFISDTDTEVIVQLIELFAEK-------LSTKEAFKKALSLL-HGSYAI
GLMS_LISMF      LLKEEYL-KNHSFVSDTDTEVIVQLIELFAAE-------LSTKEAFKKALSLL-HGSYAI
GLMS_LISMO      LLKEEYL-KNHSFVSDTDTEVIVQLIELFAAE-------LSTKEAFKKALSLL-HGSYAI
GLMS_OCEIH      DIKNEYL-ADVSFISETDTEVIVQLIEKLHEKY------QDTKKAFSEAMSLL-KGSYAI
GLMS_BACSU      QLKQEYL-QDVELKSDTDTEVVVQVIEQFVNGG------LETEEAFRKTLTLL-KGSYAI
GLMS_LACPL      DLKQTYL-SDVTFKSQTDTEVIVQLVDRFVTKEG-----LSTLAAFRKTLGLLGHSSYGF
                 :          :  :**:*:   :.                          :  .    

GLMS_NOSS9      AVVCADYPDELIVVRQQAPLVIGF-GQGEFFCASDTPAIVAYTRAVLPLENGEIARLTP-
GLMS_SYNY3      AVLDAHCPEQLIVARQQAPLILGF-GQGEFFCASDVTALVHHTTTVLSLENGEIARLTP-
GLMS_CYACA      VIIARDMPDSIFVYQNKTALTLGK-GSNFYSVSSDPIALIPYTKNFIQLHDRELGIISI-
GLMS_CHLPN      ALIHKDHPHTILCASQESPLILGL-GKEETFIASDSRAFFKYTRHSQALASGEFAIVSQG
GLMS_CHLTR      ALMHQDHPEVLLCAAHESPLILGL-GEDEVFISSDIHAFLKYSGCTQTLASGELAVLRIG
GLMS_METMP      LILNQDFPEMLVGVRNESPLILGI-KKDECFIGSDISAFLEYTKLAMPLNDRDIVILRKE
GLMS_PYRHO      VVLFADDPERLYIARKDSPLIIGI-GKGEMFMASDIPAFLAYTRRAVFLDDGEYGIVSK-
GLMS_METTH      AAVSSREPGRIVGARKESPLIVGV-GEGEYFLASDVPAILNHTSRVIYLDDGEMVILDGD
GLMS_SULAC      LAVIHGE-KRIFFAKRDNPLVIGL-GEKENYIASDIPAFLSYTKRILVIKDGELGFITTS
GLMS_AERPE      ALLHLGEPDKVYFLRYKSPLVVGL-GEGVNAVASDITAVLDVARDVIVLEDGEFGWISPE
GLMS_AQUAE      AVITVHEPNRLIGVKQGSPLIVGL-GEGENFLASDIPAILPYTKKIIVLDDGEIADLTPD
GLMS_THET8      VVVAHEDHEEIVAARTVSPLVVGL-GEGENFLASDVPALLPYTRRVLFLHDGDVVRLTRE
GLMS_THEMA      AVVHKNVPDTIVAARKGSPLVAGI-GSGVGILASDVTPLLRFTKDVVFLEDGDVMVLRKD
GLMS_MYCLE      VFANADEPGTIVAARRSTPLVLGI-GDGEMFVGSDVAAFIEHTRQAVELGQDQAVVITAD
GLMS_MYCTU      VFANADDPGTLVAARRSTPLVLGI-GDNEMFVGSDVAAFIEHTREAVELGQDQAVVITAD
GLMS_MYCS2      VFASADDPGTIVAARRSTPLVLGI-GDGEMFVGSDVAAFIEHTRDAVELGQDQAVVLTAD
GLMS_STRCO      VAVHADAPDVVVGARRNSPLVVGV-GEGEYFLASDVAAFIAHTRDAVELGQDQVVELRRD
GLMS_HALSA      AITAAGHDGIVVARS-DSPLLLGH-GDTGTFVASDATAFIEHTNRVTYLRNGDIAHLTET
GLMS_HELPJ      LMLHKRAKESLFYAKSSSPLIVGK-GKEGVFFASSLSVLAPKVDQFVILEENSVGQISLE
GLMS_HELPY      LMLHKRAKESLFYAKSSSPLVVGK-GKEGVFFASSLSVLAPKVDQFVILEENSVGRISLE
GLMS_CAMJE      LLVTKKDPNHVYFAKNAAPLIIGKNANKEWYFSSGDAPLIGSCDEVMYLEDLSLGYASKD
GLMS_ECOLI      VIMDSRHPDTLLAARSGSPLVIGL-GMGENFIASDQLALLPVTRRFIFLEEGDIAEITRR
GLMS_HAEIN      VVMDSRHPEHLVAARSGSPLVIGL-GIGENFLASDQLALLSVTRRFIFLEEGDIAEITRR
GLMS_BUCAI      VVIDQNNPSKLIAARSGSPLIIGL-GTEENFIASDQIALLHVTKRFIYLEEGDIAIVARK
GLMS_TREPA      LCMDAASPGRLIAARSGSPLAVGL-GCGENFVTSDPLALAHVTQRFLYLEEGDIADVHRD
GLMS_ACIFR      AVISSGDPETVCVARMGCPLLLGV-ADDGHYFASDVAALLPVTRRVLYLEDGDVAMLQRQ
NODM_RHILV      AILFEDDPATIMVARNGPPLVIGH-GDGEMFLGSDAIALAPFTNDITYLNDGDWAVVGKT
NODM_RHIML      AVLFEDDPSTIMAARTGP-LAIGH-GNGEMFLGSDAIALAPFTNEITYLIDGDWAVIGKT
GLMS_STRA3      ALIDSQDADTIYVAKNKSPLLIGL-GNGYNMVCSDAMAMIRETSEYMEIHDKELVIVKKD
GLMS_STRA5      ALIDSQDADTIYVAKNKSPLLIGL-GNGYNMVCSDAMAMIRETSEYMEIHDKELVIVKKD
GLMS_STRP3      ALMDSQATDTIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETSEFMEIHDKELVILTKD
GLMS_STRP8      ALMDSQATDTIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETSEFMEIHDKELVILTKD
GLMS_STRP1      ALMDSQATDTIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETSEFMEIHDKELVILTKD
GLMS_STRP6      ALIDTEDADTIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETSQFMEIHDKELVILTKD
GLMS_STRMU      ALIDSQNPDIIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETNQFMEIHDKELVVLTKD
GLMS_LACLA      ALMDSEDAEVIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETSEFMEIHDKELVVLTKD
GLMS_STRPN      ALVDSQDPEVIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKAD
GLMS_STRR6      ALIDSENPDVIYVAKNKSPLLIGL-GEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKAD
GLMS_LISIN      CLIDQTDTETLYAAKNKSPLLIGK-GENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKD
GLMS_LISMF      CLIDQTDTETLYAAKNKSPLLIGK-GENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKD
GLMS_LISMO      CLIDQTNTETLYAAKNKSPLLIGK-GENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKD
GLMS_OCEIH      GLIDAEDSETLYVSKNKSPLLVGL-GDGFNLVASDAMATLRETDQYLEIFDKEIVLVSRN
GLMS_BACSU      ALFDNDNRETIFVAKNKSPLLVGL-GDTFNVVASDAMAMLQVTNEYVELMDKEMVIVTDD
GLMS_LACPL      LLMDKEDPDTLYVAKNKSPLLIGV-GEGFNVVCSDSLAMLDQTKDFLELHDGEIVVVKPD
                          :        *  *          *.             : . .       

GLMS_NOSS9      LGIEIYNFAG--------HRLKKQPRLLNLNPTMVVKTGFKHFMLKEIHEQPGVVRASLE
GLMS_SYNY3      LGVEVYDFNL--------KRVRKLPRTLDWSATTVEKQGFRHFMLKEIYEQPAVVRTCLA
GLMS_CYACA      SQLAIYNKGK--------FTYPSRRFKANLNDLITNKASFDSYTLKEIHDQKKVLRNLII
GLMS_CHLPN      KEPEVYNLEL--------KKIHKDVRQITCSEDASDKSGYGYYMLKEIYDQPEVLEGLIQ
GLMS_CHLTR      KSIETYNFEL--------ARIQKEVRCIDHTEDSLDKKGFDYYMLKELYEQPEVFERILH
GLMS_METMP      NDEIDIEVLN------YGKQVQRDTIELQWDMESAEKEGYEHFMLKEIMEEPVILKNSMK
GLMS_PYRHO      -DWFTIKDII------TGAVKTKEIHEIQWTLEMAEKGGYEHFMLKEIFEQPKAIKDAIY
GLMS_METTH      LRVTDME----------GNTVEKEVHSIDWSADMAEKGGYDHFMLKEIHEEPSAVRDTLT
GLMS_SULAC      NVFIEDKDGN-------PVDLSDRVRVIDWDVETASKEGYPHFMIKEIHESPKSIRDTVD
GLMS_AERPE      GVAIYRPRGDGGFEPLPPGALEERVKRVEWTPESASKAGYPHFMLKEIYEQPRALAETFE
GLMS_AQUAE      TVNIYNFE---------GEPVSKEVMITPWDLVSAEKGGFKHFMLKEIYEQPKAINDTLK
GLMS_THET8      GVEITDLE---------GRPVQREAVEVDWTLEAAEKGGFPHYMLKEIYEQPWVLENTLG
GLMS_THEMA      GFEIYNTD---------GVKQQRRVYHVNWDEKAAEKGGYKHFMYKEIMEDPQALVNALV
GLMS_MYCLE      GYRISDFDGND-------DAVNARTFHIDWDLAAAEKGGYEYFMLKEIAEQPDAVVDTLL
GLMS_MYCTU      GYRISDFDGNDG----LQAGRDFRPFHIDWDLAAAEKGGYEYFMLKEIAEQPAAVADTLL
GLMS_MYCS2      GYRITDFAGNDH----LEAGRDFREFHIDWDLNAAEKGGYDYFMLKEIAEQPSAVADTLL
GLMS_STRCO      GVRVTGFDGSP---------ADVRSYHVDWDASAAEKCGYASFMLKEIAEQPKAVADTLL
GLMS_HALSA      EWTVYNDGARV----------SRDIEALDWSADAAGKSGYDHYMLKEIHEQPRALRQAIS
GLMS_HELPJ      NFKDLNNI---------ENMKDYAFE----NKDYSKGN-FRNYLEKEIYEQHSSLLECLE
GLMS_HELPY      NFKDLNNI---------ENMKDYAFE----DKDYSKGN-FRNYLEKEIYEQHSSLLECLE
GLMS_CAMJE      ELVVYEN----------DILKSLCFSKLSGDKAYAKKDGFRFFMEKEIYEQSRVMSEVLM
GLMS_ECOLI      SVNIFDKT---------GAEVKRQDIESNLQYDAGDKGIYRHYMQKEIYEQPNAIKNTLT
GLMS_HAEIN      TVDIYDTH---------GNKAKREIHESNLENDAAEKGKFRHFMQKEIYEQPTALINTME
GLMS_BUCAI      EINIFNKN---------NSIIQREEVVSNIEYKSAKKGKYRYYMEKEIHEQPKSIRNTLK
GLMS_TREPA      SVCVHDAQ---------GNVVARPVVTYQMQLCTQDKGTHRHHMHQEIWQQPHAIRHTLN
GLMS_ACIFR      TLRITDQA---------GASRQREEHWSQLSAAAVDLGPYRHFMQKEIHEQPRAVADTLE
NODM_RHILV      SVQVFDIE---------GNVVTRPRHISLATADLVGKGNHPHFMEKEIYEQPEVIARALG
NODM_RHIML      GVHIFDFD---------GNVVERPRQISTAAAFLVDKGNHRHFMEKEIYEQPEVIAIALG
GLMS_STRA3      SVEVQDYD---------GNVIERGSYTAELDLSDIGKGTYPFYMLKEIDEQPTVMRKLIS
GLMS_STRA5      SVEVQDYD---------GNVIERGSYTAELDLSDIGKGTYPFYMLKEIDEQPTVMRKLIS
GLMS_STRP3      KVTVTDYD---------GKELIRDSYTAELDLSDIGKGTYPFYMLKEIDEQPTVMRQLIS
GLMS_STRP8      KVTVTDYD---------GKELIRDSYTAELDLSDIGKGTYPFYMLKEIDEQPTVMRQLIS
GLMS_STRP1      KVTVTDYD---------GKELIRDSYTAELDLSDIGKGTYPFYMLKEIDEQPTVMRQLIS
GLMS_STRP6      SVTVLDYD---------GNQLERDSYTAELDLSDIGKGTYPFYMLKEIDEQPTVMRKLIS
GLMS_STRMU      TAQVSDYD---------GNPVERQAYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIS
GLMS_LACLA      NVTVMDYE---------GNVLSRESYTAELDLSDIGKGTYPFYMLKEIDEQPAVMRKLIA
GLMS_STRPN      SVEVQDYD---------GNRRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQ
GLMS_STRR6      SVEVQDYD---------GNSRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQ
GLMS_LISIN      GFTLETLE---------GEEVSRASYTAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQ
GLMS_LISMF      GFTLETLE---------GEEISRASYTAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQ
GLMS_LISMO      GFTLETLE---------GEEITRASYKAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQ
GLMS_OCEIH      YVEVQTLD---------GQVVERKPFTAEIDASDTEKGTYPHFMLKEIDEQPIVMRKIIQ
GLMS_BACSU      QVVIKNLD---------GDVITRASYIAELDASDIEKGTYPHYMLKETDEQPVVMRKIIQ
GLMS_LACPL      EIKITNQA---------GEPVERKPFHVDIDAAQADKGTYPFYMLKEIDEQPNVMRKLSQ
                                                       .  .  :*  :.         

GLMS_NOSS9      AYFNN----GRGKWRSPINLRL-------PENLYTDLEQIHIVACGTSWHAALIGKYLIE
GLMS_SYNY3      TYLNEQWRAADHPSHSPVFLGL-------DPQLTKNLQHIQVLACGTSWHAGLVGKYLLE
GLMS_CYACA      STLQS--------EKSIDESGQ-------LHLEYKKIKNFQIIACGSSFNAALVGKVILE
GLMS_CHLPN      KHMDE--------EGHILSEFL-------SDVPIKSFKEITIVACGSSYHAGYLAKYIIE
GLMS_CHLTR      LTCEE--------NG-FTESFL-------KGFSLDEIQSLHIVACGSSYHAGYLAKYVIE
GLMS_METMP      ISKLEIENL---GKEIE------------------KCDKIYITAMGTSLHAAMVAEYWFS
GLMS_PYRHO      GNVKEAPKV---AELLM------------------KYDRIIITGMGTSYHAALVGKYLIQ
GLMS_METTH      -EWDEVLGV---VEEIG------------------EVERICFVACGTSYHASLVGKYLFE
GLMS_SULAC      SLISDLDLIDKIIAEMK------------------SSGRIVVVGAGTSYHAGLYFSLLLS
GLMS_AERPE      GIIEDPALL-RAAGLVA------------------GAGRLLIVGAGTSFHAGLVGHYYLS
GLMS_AQUAE      GFLSTED-----AIPFK----------------LKDFRRVLIIACGTSYHAGFVGKYWIE
GLMS_THET8      GRLREEEGTVELGLALD----------------PREVDRVHVIACGTASYAGLYGKYLLE
GLMS_THEMA      GRVKNDRPFFEELEYYEE--------------LLKNADRIRVVSCGTSYYAGLVFKYFLE
GLMS_MYCLE      GHFTG-GRIVLDEQRLSDQ-------------ELREIDKVFVVACGTAYHSGLLAKYTIE
GLMS_MYCTU      GHFVG-GRIVLDEQRLSDQ-------------ELREIDKVFVVACGTAYHSGLLAKYAIE
GLMS_MYCS2      GHFDK-NRIVLDEQRLSDQ-------------ELREIDKVFIVACGTAYHSGLLAKYAIE
GLMS_STRCO      GRIDGSGTLSLDEVRIPPG-------------VLREVDKVVVVACGTAFHAGLIAKYAIE
GLMS_HALSA      GRISDLGTDVTLDMELSTE-------------TLQNVAELQIVACGTSYHAGLYAKELLE
GLMS_HELPJ      GRLEA-LSVYCEIDPEF----------------LENVSEITLCSCGSSYHASLASVYLFE
GLMS_HELPY      GRLEA-LSVYCEIDPEF----------------LKNVSEITLCSCGSSYHASLASVYLFE
GLMS_CAMJE      GRIQGDEVVFDELNNED----------------LSQVDEITLCACGTSYHAAMASAYLFE
GLMS_ECOLI      GRISHGQ---VDLSELGPN----------ADELLSKVEHIQILACGTSYNSGMVSRYWFE
GLMS_HAEIN      GRINHEN---VIVDSIGNG----------AKGILEKVEHIQIVACGTSYNAGMVARYWFE
GLMS_BUCAI      NRLTNSNK--VHFSELGSK----------ENNIFYNTEHIQIVACGTSYNAAMVSRYWFE
GLMS_TREPA      AYMSFSSSSRAQVRTFGEDRVLDGTSCKTFERLFRRITRVRIIACGTSYHAGLVARYWFE
GLMS_ACIFR      GALNSQLD---LTDLWGDG----------AAAMFRDVDRVLFLASGTSHYATLVGRQWVE
NODM_RHILV      HYINVNDS---HVTTTS------------TDIDFAGVESLAISACGTAYLAGLIGKYWFE
NODM_RHIML      HYVNVIDK---SCRSDS------------DAIDFAGVESLAISCCGTAYLAGLIGKYWFE
GLMS_STRA3      TYANESGDMNVDSDIIKSV---------------QEADRLYILAAGTSYHAGFAAKTMIE
GLMS_STRA5      TYANESGDMNVDSDIIKSV---------------QEADRLYILAAGTSYHAGFAAKTMIE
GLMS_STRP3      TYADETGNVQVDPAIITSI---------------QEADRLYILAAGTSYHAGFATKNMLE
GLMS_STRP8      TYADETGNVQVDPAIITSI---------------QEADRLYILAAGTSYHAGFATKNMLE
GLMS_STRP1      TYADETGNVQVDPAIITSI---------------QEADRLYILAAGTSYHAGFATKNMLE
GLMS_STRP6      TYSDESGKMAIDPAIVKTI---------------QEADRIYILAAGTSYNAGFASKAMIE
GLMS_STRMU      TYANENGKLTVDPAIVKSV---------------QEADRIYILAAGTSYNAGFASKSMIE
GLMS_LACLA      TYANEDGTMKVDQDIIKGI---------------QEADRIYIIAAGTSYHAGFGAKMMLE
GLMS_STRPN      AYTDEAGQVVVDPDIIKAV---------------QDADRIYILAAGTSYHAGFASKKMLE
GLMS_STRR6      AYTDDAGQVVIDPAIIKAV---------------QDADRIYILAAGTSYHAGFASKKMLE
GLMS_LISIN      AYQNEAGEINVDQTILDEI---------------LSSDRIHIVACGTSYHAGLVGKNLIE
GLMS_LISMF      AYQNEAGEINVDQTILDEI---------------LSSDRIHIVACGTSYHAGLVGKNLIE
GLMS_LISMO      AYQDEAGEINVDKTIIDEI---------------LSSDRIHIVACGTSYHAGLVGKNLIE
GLMS_OCEIH      EYQNDNGQLKLDQDIRTAM---------------KDADRIYIIAAGTSYHAGLVGKEFIE
GLMS_BACSU      TYQDENGKLSVPGDIAAAV---------------AEADRIYIIGCGTSYHAGLVGKQYIE
GLMS_LACPL      VYLNDAGDPIINDDLLTAL---------------KAADRLYIVAAGTSYHAGLVGAKLFE
                                                       . .   *::  :       ..

GLMS_NOSS9      QLAGISTQVHYASEY-RYAPSPLTSNTLIIGVTQSGETADTLAALAMEKERRQGKEAKYE
GLMS_SYNY3      QLAGIPTTVHYASEF-RYAAPPLTPHTLTIGVTQSGETADTLAALEMEKQRRLTLEDDYK
GLMS_CYACA      KLIRIPVHVYYGSEF-KTNLPPLLPCTLTIAVSQSGETGDMLSAIEIEKSRRKFQNTVYK
GLMS_CHLPN      SLVSIPVHIEVASEF-RYRRPYIGKDTLGILISQSGETADTLAALKELRRRN-------I
GLMS_CHLTR      SIASIPVYVETASEF-RYRQPYIAEHSLAILISQSGETADTLAALNEFRKLS-------K
GLMS_METMP      GLNKLVIPIDSSE---FLTKGIVDEKTLVIAITQSGETYDTMKAVKYAKEKG--------
GLMS_PYRHO      RFGKVPVIVEEASELRYEYEDILDNRSLLIAITQSGETADTVAAMKLAKSKG--------
GLMS_METTH      SLLGIPTDVILASEF-RYSAGALNDRTLAIFISQSGETADTLNALRAANSR---------
GLMS_SULAC      R-EGMNSFPLIASEY-YNFKAKKD--DLIFAISQSGETLDLLQAVRKFKEEG--------
GLMS_AERPE      RLAGILGHPVVASEH-KVYTPGVDGETVVVAVSQSGETYDTLEAVREWRGRG--------
GLMS_AQUAE      RFAGVPTEVIYASEF-RYADVPVSDKDIVIGISQSGETADTKFALQSAKEKG--------
GLMS_THET8      TLARLPTEWDVASEY-RYRDPVVDSRTLALAISQSGETIDTLEGLREAKRKG--------
GLMS_THEMA      NHTDIDVEIEVSSEF-RYKRPHIKEGDVLIAISQSGETADTLESVRLAKKHG--------
GLMS_MYCLE      HWTRLPVEVELASEF-RYRDPVLDRSTLVVAISQSGETADTLEAVRHAKEQK--------
GLMS_MYCTU      HWTRLPVEVELASEF-RYRDPVLDRSTLVVAISQSGETADTLEAVRHAKEQK--------
GLMS_MYCS2      HWTRLPVEVELASEF-RYRDPVLDRSTLVIAISQSGETADTLEAVRHAKTQK--------
GLMS_STRCO      HWTRIPCEVELASEF-RYRDPILDQQTLVVAISQSGETMDTLMALRHAREQG--------
GLMS_HALSA      THADLPVTVHVASEY-ELRGGRSPEDTLVVAITQSGETADTLAALRSAAQKG--------
GLMS_HELPJ      RLAKIRARAILASEY-RYAHFKSNPNELFIAISQSGETADTLEALKLAKAQG--------
GLMS_HELPY      RLAKIRARAILASEY-RYAHFKSNPNELFIAISQSGETADTLEALKLAKAQG--------
GLMS_CAMJE      RIAKVKAKVEIASEF-RYREAIIKKDSLFIVISQSGETADTLEALKIAKEQG--------
GLMS_ECOLI      SLAGIPCDVEIASEF-RYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGY-------
GLMS_HAEIN      SLAGVSCDVEIASEF-RYRKFVTRPNSLLITLSQSGETADTLAALRLAKEKGY-------
GLMS_BUCAI      ELANIPCDVEIASEF-SSRKLVVRKKSLLITLSQSGETADTLSALRYSKKLGY-------
GLMS_TREPA      AFAGVGCQVEIASEY-RYRTSVVHAREIVLTISQSGETADTIAALRLAKTQGY-------
GLMS_ACIFR      SIVGIPAQAELGHEY-RYRDSIPDPRQLVVTLSQSGETLDTFEALRRAKDLGH-------
NODM_RHILV      RYARLIVEIDVASEF-RYREIPLSPRSAALFISQSGETADTLASLRYCKAHG--------
NODM_RHIML      RYARLPVEIAVASEF-RYREIPLSPQ-SALFISQSGETADTLASLRYCKAHG--------
GLMS_STRA3      KLTDTPVELGVSSEW-GYNMPLLSKKPMFILLSQSGETADSRQVLVKANEMG--------
GLMS_STRA5      KLTDTPVELGVSSEW-GYNMPLLSKKPMFILLSQSGETADSRQVLVKANEMG--------
GLMS_STRP3      QLTDTPVELGVASEW-GYHMPLLSKKPMFILLSQSGETADSRQVLVKANAMG--------
GLMS_STRP8      QLTDTPVELGVASEW-GYHMPLLSKKPMFILLSQSGETADSRQVLVKANAMG--------
GLMS_STRP1      QLTDTPVELGVASEW-GYHMPLLSKKPMFILLSQSGETADSRQVLVKANAMG--------
GLMS_STRP6      QLTDTPVELGVASEW-GYNMPLLSQKPMFILLSQSGETADSRQVLVKANQMG--------
GLMS_STRMU      TLTDTPVELGIASEW-GYNMPLLSKKPMFILLSQSGETADSRQVLVKANAMG--------
GLMS_LACLA      SLTNTPVELGLASEW-GYDMPLLSQKPFFIFLSQSGETADSRQVLVKVNELG--------
GLMS_STRPN      ELTDTPVELGISSEW-GYGMPLLSKKPLFIFISQSGETADSRQVLVKANEMG--------
GLMS_STRR6      ELTDTPVELGISSEW-GYGMPLLSKKPLFIFISQSGETADSRQVLVKANEMG--------
GLMS_LISIN      KMAKIPVEVHVSSEF-GYNLPLMSKKPLFIFITQSGETADSRQCLVKVKELG--------
GLMS_LISMF      KMAKIPVEVHVSSEF-GYNLPLMSKKPLFIFITQSGETADSRQCLVKVKELG--------
GLMS_LISMO      KMAKIPVEVHVSSEF-AYNLPLMSKKPLFIFITQSGETADSRQCLVKVKELG--------
GLMS_OCEIH      KLANIPVEVHVASEF-SYNMPLLSEKPLFVFISQSGETADSRAVLVKIKELG--------
GLMS_BACSU      MWANVPVEVHVASEF-SYNMPLLSKKPLFIFLSQSGETADSRAVLVQVKALG--------
GLMS_LACPL      SLANVPTEVHVSSEF-AYNQPLLSAHPFFIFLTQSGETADSREVLLNVNDQH--------
                           .                 . ::***** *    :               

GLMS_NOSS9      ARLLGITNRPESSLLSHLVPNIISTLAGIEIGVLATKTFTAQLMAFYALALDLAAHRQTA
GLMS_SYNY3      PLILGITNRPES-TLATMVNEIINTHAGIEIGVAATKTFVAQVLAFYFLALDIAFQRHSL
GLMS_CYACA      PYLLSITNKNYS-SITKKTAQSIDLKAGIEIGVAATKTFTAQTLSFYLLALKLAEHKFTL
GLMS_CHLPN      AYLLGICNVPES-AIALGVDHCLFLEAGVEIGVATTKAFTSQLLLLVFLGLKLANVHGAL
GLMS_CHLTR      ARVLGICNVRES-ALASRVDHCLFIEAGLEVGVASTKAFTAQLLLLILLGLRLANHRQVI
GLMS_METMP      AKTATIVNVLGS-TATREADITIMMGSGLEIAVCATKTFMSQLVILYRLFI----EYGKI
GLMS_PYRHO      VEVVGIVNVVGS-LATRIADETLYTHAGPEIGVAATKTYTTQLVVLTLLAK----ELGKL
GLMS_METTH      AKTLAIVNVLGS-SATREAQHVLYTRAGPEIGVAATKTYVSQLTVIYMLVA----AMG--
GLMS_SULAC      ARIVSLTNVIES-ALARESNYKIYMRAGPEISVAATKTFITQLISLLFIY----------
GLMS_AERPE      ARVIGVTNVVGS-ALDREADVTLYLRAGPEIGVAATKTFLAQTILLQTLSIAAAGEAGRL
GLMS_AQUAE      AFTVGLVNVVGS-AIDRESDFSLHTHAGPEIGVAATKTFTAQLTALYALSVRES------
GLMS_THET8      ARSLGVINAKGS-TLTREVEDVLYIHAGPEIGVASTKAYTAMLAAMALLAVWFGRGRGAL
GLMS_THEMA      AKIVSIVNVVGS-TLDRESDVTLFMNAGPEIGVAATKTYVAELAVLYLLGLKIMEINGYW
GLMS_MYCLE      AKVLAICNTNGS-QIPRECDAVLYTRAGPEIGVASTKTFLAQVAANYLLGLALAQARGTK
GLMS_MYCTU      AKVLAICNTNGS-QIPRECDAVLYTRAGPEIGVASTKTFLAQIAANYLLGLALAQARGTK
GLMS_MYCS2      AKVLAICNTNGS-QIPREADAVLYTRAGPEIGVAATKTFLAQIAANYLVGLALAQARGTK
GLMS_STRCO      ARVLAICNTNGS-TIPRESDAVLYTHAGPEVAVASTKAFLTQLVACYLVALYLGQVRGTK
GLMS_HALSA      APTLALTNTLGS-TVTREADDALFIRAGPEIGVAATKTFVSQVATAALLTMHIGRARNAI
GLMS_HELPJ      LKTISLCNAPFS-MMSRISDHTLLIRAGVERSVASTKAFSSQVMLLWLLSVYLGKQLGTI
GLMS_HELPY      LKTISLCNAPFS-MMSRISDHTLLIRAGVERSVASTKAFSSQVMLLWLLSVYLGKQLGTI
GLMS_CAMJE      AKTFAICNVDNS-NIVRLAHLSLLTRAGIEKGVASTKAFATQVLTLWMLAIFMAQKRNLN
GLMS_ECOLI      LGSLAICNVPGS-SLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKG-L
GLMS_HAEIN      MAALTICNVAGS-SLVRESDLAFMTRAGVEVGVASTKAFTTQLAALLMLVTALGKVKGHI
GLMS_BUCAI      LGNLTICNMKSS-SLVRESDFYILTKAGLEIGVASTKSFTTQLTVLLLLVAKIINSKK-E
GLMS_TREPA      LCAIAICNGARS-TLVRESDAVLLTHAGSEIGVASTKSFTTQLVCLLVLTRMIAQAKKIL
GLMS_ACIFR      TRTLAICNVAES-AIPRASALRFLTRAGPEIGVASTKAFTTQLAALYLLALSLAKAPGAS
NODM_RHILV      LRIGAVVNTRES-TMAREADAIFPILAGPEIGVASTKAFTCQLAVLAALRIGAGKARGTI
NODM_RHIML      LRIGAVVNARES-TMARESDAVFPILAGPEIGVARTKAFTCQLAVLAALRAGAGKARGTI
GLMS_STRA3      IPSLTITNVPGS-TLSREATYTMLIHAGPEIAVASTKAYTAQVATLAFLAKAVGEANGK-
GLMS_STRA5      IPSLTITNVPGS-TLSREATYTMLIHAGPEIAVASTKAYTAQVATLAFLAKAVGEANGK-
GLMS_STRP3      IPSLTVTNVPGS-TLSRESTYTMLIHAGPEIAVASTKAYTAQIAALAFLAKAVGEANGK-
GLMS_STRP8      IPSLTVTNVPGS-TLSRESTYTMLIHAGPEIAVASTKAYTAQIAALAFLAKAVGEANGK-
GLMS_STRP1      IPSLTVTNVPGS-TLSREATYTMLIHAGPEIAVASTKAYTAQIAALAFLAKAVGEANGK-
GLMS_STRP6      IPSLTVTNVPGS-TLSREATYTMLLHAGPEIAVASTKAYTAQVAALAFLSKAVGEANGK-
GLMS_STRMU      VPSLTITNVPGS-TLSREATYTMLLHAGPEIAVASTKAYTAQIAALAFLSKAVGEANGK-
GLMS_LACLA      LPSLTVTNVPGS-TLSREATYTMLIGAGPEIAVASTKAYTGQIATLAFLAKAVGEAEGE-
GLMS_STRPN      IPSLTVTNVPGS-TLSREANYTMLLHAGPEIAVASTKAYTAQIAALAFLAKAVGEANGN-
GLMS_STRR6      IPSLTVTNVPGS-TLSREANYTMLLHAGPEIAVASTKAYTAQIAALAFLAKAVGEANGN-
GLMS_LISIN      YRTLTLTNVPGS-TLDREADHSMYLYAGPEIAVASTKAYTAQISVLAVLAVSLGREIGD-
GLMS_LISMF      YRTLTLTNVPGS-TLDREADHSMYLYAGPEIAVASTKAYTAQISVLAVLAVSLGREIGD-
GLMS_LISMO      YRTLTLTNVPGS-TLDREADHSMYLYAGPEIAVASTKAYTAQISVLAVLAVSLGREIGD-
GLMS_OCEIH      HPALTLTNVPGS-TLSREANYTMHLHAGPEIAVASTKAYTAQIAVLAILAVDTARVKG--
GLMS_BACSU      HKALTITNVPGS-TLSREADYTLLLHAGPEIAVASTKAYTAQIAVLAVLASVAADKNG--
GLMS_LACPL      FPSLTITNVPNS-TLSREATYTLLLHAGPEIAVASTKAYTAQIALQAILAKALGVAVDQ-
                     : *   *          :   :* * .*  **::         :           

GLMS_NOSS9      SKETLEKIINGLREIPKDIESTLESQERLTEQLAHEFAETQDFIFLGRGINFPIALEGAL
GLMS_SYNY3      SLEAIEHIMVGLRQLPAQIETILEQQGSAIEALAHEFAETQDFIFLGRGINFPIALEGAL
GLMS_CYACA      RKKEINKHLDEIRNLPKAIAHLLIKDESSIKWLSKQLKEISKCFYIGKGLNLGSALEGAL
GLMS_CHLPN      THAEQCSFGQGLQSLPDLCQKLLA--NESLHSWAQPYSYEDKFLFLGRRLMYPVVMEAAL
GLMS_CHLTR      AQEDLAQAIQGLKDLPNL-TRLFL--DSSIHDWRCRQIEETSFIFLGRRFMYPICMEAAL
GLMS_METMP      IGKNMDIFEKELLNIPNYISKVLDEKEN-ISKIAEELTAK-NYLFISKGINLANALEGAL
GLMS_PYRHO      VGIDVSQIEGTIPRLPELVDSSLKINDK-IREIAVKLNDKRDFFYIGRGINYPTALEGAL
GLMS_METTH      ----APELMDRLERVPEFMERALEDEDG-IKELAATCSDVSDFFFIGRGFAYPTALEGAL
GLMS_SULAC      -SRLRRDNTNKFRGADTEVERVISSVEGYAKLIGEELSKKTSIYYLGRGMSLPLAMEGAL
GLMS_AERPE      TSGETRELTGVLEGAPDAARRAILASEGAAREAASLLKGAGSMYIIGRGLGGRLAMEAAL
GLMS_AQUAE      --EERENLIRLLEKVPSLVEQTLNTAEE-VEKVAEKYMKKKNMLYLGRYLNYPIALEGAL
GLMS_THET8      ALEEAQRLLREMRRLPRLVEEVLEKRPL-VAHVAEKYHQARDFLFLGRHVQAPTAYEGAL
GLMS_THEMA      D-REAEEILDKLVRMPELLENVLRKDPQ-IRELSEKYKDYRNFMYIGRGYGYPTALEGAL
GLMS_MYCLE      YPDEVQREYRELEAMPDLVARVIAGMGP-VADLAYRFAQSTTVLFLGRHVGYPVALEGAL
GLMS_MYCTU      YPDEVEREYHELEAMPDLVARVIAATGP-VAELAHRFAQSSTVLFLGRHVGYPVALEGAL
GLMS_MYCS2      YPDEVAREYRELEAMPDLIKRVLAGMDS-VAALAERFAPSSTVLFLGRHVGYPVALEGAL
GLMS_STRCO      YGDEIGDVVRDLSGISGAVERVLGTMDP-VRQLARSLAHKNTVLFLGRHVGHPVALEGAL
GLMS_HALSA      STGDAAALRDAIRDLPGAVQQVLDQAPE-IASIGREYADSDAFFYVGRRAGRPVALESAL
GLMS_HELPJ      SKEEERIQAKNMLNSVKAMKVEPK-LHEKIKRLSKRYLHGHGFFYIGRDVFYPLALEGAL
GLMS_HELPY      SKEEERIQAKNMLNSVNAMKVEPK-LHEKIKRLSKRYLHGHGFFYIGRDVFYPLALEGAL
GLMS_CAMJE      VSAE----IKALLHTPNCVSVKQA-LHEKIHRLSKRYLDGHGFFFIGRDVFYPLALEGAL
GLMS_ECOLI      DASIEHDIVHGLQALPSRIEQMLS-QDKRIEALAEDFSDKHHALFLGRGDQYPIALEGAL
GLMS_HAEIN      SVEKEREIIKAMQSLPAEIEKALA-FDTEIEALAEDFAEKHHALFLGRGAFYPIAVEASL
GLMS_BUCAI      NNNTSKRIVQTLSILPVRIEEILK-KKQLIQDMANTLANKKNMLFLGRGNQYPIAMEGAL
GLMS_TREPA      TQEPEDALSAALQRLPQDVEHVLE-CEADVARCARHFVHAQHALFLGRGELYPIAIESAL
GLMS_ACIFR      ERCAAGGSPGRLRQLPGSVQHALN-LEPQIQGWAARFASKDHALFLGRGLHYPIALEGAL
NODM_RHILV      TDDEEQVLVQSLATLPGVMRQVLNDITPEIELLSRELSHYRDVLYLGRGTSFPLAMEGAL
NODM_RHIML      SGDEEQALIKSLAEMPAIMGQVLNSIQPEIEVLSRELSNCRDVLYLGRGTSFPLAMEGAL
GLMS_STRA3      AEAKDFDLVHELSIVAQSIEATLSEKDVISEKVEQLLISTRNAFYIGRGNDYYVTMEAAL
GLMS_STRA5      AEAKDFDLVHELSIVAQSIEATLSEKDVISEKVEQLLISTRNAFYIGRGNDYYVTMEAAL
GLMS_STRP3      QEALDFNLVHELSLVAQSIEATLSEKDLVAEKVQALLTTTRNAFYIGRGNDYYVAMEAAL
GLMS_STRP8      QEALDFNLVHELSLVAQSIEATLSEKDLVAEKVQALLATTRNAFYIGRGNDYYVAMEAAL
GLMS_STRP1      QEALDFNLVHELSLVAQSIEATLSEKDLVAEKVQALLATTRNAFYIGRGNDYYVAMEAAL
GLMS_STRP6      KEALEFDLVHELSLVAQSIEATLSEKDLIASKVEKLLATTRNAFYIGRGNDYYVAMEASL
GLMS_STRMU      KEALEFDLVHELSIVAQSIEASLSEREVIEKKVANLLATSRNAFYIGRGNDYYVAMEASL
GLMS_LACLA      VKAKEFDLVKELSLVAQSIEATLSEKDEIAAIVADLLPTTRNAFYIGRKQDYYVAMEASL
GLMS_STRPN      AKAQAFDLVHELSIVAQSIESTLSEKETIEVKVRELLETTRNAFYIGRGQDYYVAMEASL
GLMS_STRR6      AKAQAFDLVHELSIVAQSIESTLSEKETIEAKVRELLETTRNAFYIGRGQDYYVAMEASL
GLMS_LISIN      AEALSINLAAELGIVATAMEAMVSSKEVIEHIAGEYLATSRNAFFLGRNIDYFVAMEAAL
GLMS_LISMF      AEALSINLAAELGIVATAMEAMVSSKEVIEHIAGEYLATSRNAFFLGRNIDYFVAMEAAL
GLMS_LISMO      EEALNINLAAELGIVATAMEAMVSSKEVIEHIAGEYLATSRNAFFLGRNIDYFVAMEAAL
GLMS_OCEIH      -LELDFEPLQELAIVANAMEVLTDQKEELEQLARDYFGTTRNAFFIGRSTDYHVAQEAAL
GLMS_BACSU      -INIGFDLVKELGIAANAMEALCDQKDEMEMIAREYLTVSRNAFFIGRGLDYFVCVEGAL
GLMS_LACPL      PAATAFDVKQQLALVANGMQSLVDEKATFEKIAKSALLNTPNAFYIGRGLDYAVSLETAL
                           :                                 :.:        * :*

GLMS_NOSS9      KLKEISYIHAEGYPAGEMKHGPIALLDAKVPVVAIAV----PGSVYEKVISNAQEAKARD
GLMS_SYNY3      KLKEISYIHAEGYPAGEMKHGPIALLDAKVPVVAIAM----PGSVHDKVISNAQEAKARD
GLMS_CYACA      KLKEISYIHCDGYAAGEIKHGPIALVENNTLIITITD----PEQSQESTFASSQEAKARG
GLMS_CHLPN      KLKEIAYIEANAYPGGEMKHGPIALISKGTPVIAFCG----DDIVYEKMIGNMMEVKARH
GLMS_CHLTR      KLKEIAYVEANAYPAGEMKHGPIALIREGTPVIVYCG----DRSVYTKTIGAIMEVKARK
GLMS_METMP      KFKEITYLHAEGMSSGFLKHGTISLIDENMDTVALIPP--SKSELLNSVLSNVEEIKARN
GLMS_PYRHO      KIKEIAYVHAEGLSAGELKHGPLALIEDGIPVVGIAPT--GKT--FEKMLSNIEEAKARG
GLMS_METTH      KLKEITYIHGEGYAAGELKHGPLALIDNGVPVVAISPP--GPC--HDKTLSNVEEVRARG
GLMS_SULAC      KIKEVAYVHAEAYPAGESKHGPISLVDKGFPIVAIN-----DGEITDLLRNNVIEMKARG
GLMS_AERPE      KVKEVSYIHAEAYPAGESKHGPIALVEPGFKVYVVA-----TSDSPE-VMGNAIEMKARG
GLMS_AQUAE      KLKEISYIHAEGYPAGEMKHGPIALIDENMPVVVIAP----KDRVYEKILSNVEEVLARK
GLMS_THET8      KLKEISYIHAEAYPAGEMKHGPIALIDEHLPVVVLAT----KGPLYEKTLSNIQEVRARG
GLMS_THEMA      KLKEITYIHATAYQAGELKHGPIALLDVDFPVFAVMP----DDSLFFKTKSNVIESKSRN
GLMS_MYCLE      KLKELAYMHAEGFAAGELKHGPIALIEENLPVIVVMPSPKGSAMLHAKLLSNIREIQTRG
GLMS_MYCTU      KLKELAYMHAEGFAAGELKHGPIALIEDGLPVIVVMPSPKGSATLHAKLLSNIREIQTRG
GLMS_MYCS2      KLKELAYMHAEGFAAGELKHGPIALIDENLPVIVVMPSPKNAAMLHAKLLSNIREIQARG
GLMS_STRCO      KLKELAYMHAEGFAAGELKHGPIALIEEDLPVVVVVPSPRGRSVLHDKIVSNIQEIRARG
GLMS_HALSA      KLKEISYDHAEGFSAGELKHGPLALVTDNTPVVAVLTEYAAP----ERTANNVKEVQSRG
GLMS_HELPJ      KLKEISYLHAEGYASAEMKHGPIALVDSNLFTIALLS--KHL--LFDKTKSNIEELSARD
GLMS_HELPY      KLKEISYLHAEGYASAEMKHGPIALVDSNLFTIALLS--KHL--LFDKTKSNIEELSARD
GLMS_CAMJE      KLKELSYLHAEGYPAGEMKHGPIALADSKLYTIALMP--KHM--LYEKTKSNVEELIARD
GLMS_ECOLI      KLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAP--NNE--LLEKLKSNIEEVRARG
GLMS_HAEIN      KLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAP--NNE--LLEKVKSNIEEVRARG
GLMS_BUCAI      KLKEISYIHAEAYPSGELKHGPLALIDKNIPVIMIAP--ENS--LLEKNKKNIKEICSRG
GLMS_TREPA      KLKEISYIHAEAYAAGELKHGPLALVDAQMPVVAIAP--ASPGVLFEKMASNIEEVRARG
GLMS_ACIFR      KLKEISYIHAEAYPAGELKHGPLALVDRDMPVVVIAP--NDR--LLEKLAANMQEVHARG
NODM_RHILV      KLKEVSYIHAEGYAAGELKHGPIALIDENMPVIVIAP--HDR--FFDKTVSNMQEVAARG
NODM_RHIML      KLKEISYIQPKSYAAGQLKHGPYALIDENMPVIVIAP--HDR--FFDKTVTNMQEVAR-G
GLMS_STRA3      KLKEISYIQTEGFAAGELKHGTISLIEDNTPVIALISA---DSTIAAHTRGNIQEVVSRG
GLMS_STRA5      KLKEISYIQTEGFAAGELKHGTISLIEDNTPVIALISA---DSTIAAHTRGNIQEVVSRG
GLMS_STRP3      KLKEISYIQCEGFAAGELKHGTISLIEEDTPVIALISS---SQLVASHTRGNIQEVAARG
GLMS_STRP8      KLKEISYIQCEGFAAGELKHGTISLIEEDTPVIALISS---SQLVASHTRGNIQEVAARG
GLMS_STRP1      KLKEISYIQCEGFAAGELKHGTISLIEEDTPVIALISS---SQLVASHTRGNIQEVAARG
GLMS_STRP6      KLKEISYIQCEGFAAGELKHGTISLIEDGTPVIGLISS---SELVAAHTRGNIQEVAARG
GLMS_STRMU      KLKEISYIQCEGFAAGELKHGTISLIEEGTPVLALISS---SETVAAHTRGNIQEVAARG
GLMS_LACLA      KLKEISYIQCEGFAAGELKHGTISLIEKGTPVLALISN---NEEVAAHTRGNVMETVARG
GLMS_STRPN      KLKEISYIQCEGFAAGELKHGTIALIEEGTPVLALLS----DPVLANHTRGNIQEVAARG
GLMS_STRR6      KLKEISYIQCEGFAAGELKHGTIALIEEGTPVLALLS----DPVLANHTRGNIQEVAARG
GLMS_LISIN      KLKEISYIQAEGFASGELKHGTIALIEDGTPVLALIT----QESINWNIRGNVNEVLARG
GLMS_LISMF      KLKEISYIQAEGFASGELKHGTIALIEDGTPVLALIT----QESINWNIRGNVNEVLARG
GLMS_LISMO      KLKEISYIQAEGFASGELKHGTIALIEDGTPVLALIT----QESINWNIRGNVNEVLARG
GLMS_OCEIH      KLKEISYIQAEGFAGGELKHGTIALIEEGTPVIALTT----QENVNYSIRGNVQEVVARG
GLMS_BACSU      KLKEISYIQAEGFAGGELKHGTIALIEQGTPVFALAT----QEHVNLSIRGNVKEVAARG
GLMS_LACPL      KLKEISYVQAEGFASGELKHGTIALIEKDTPVIGIIT----QKNTAGLTRSNLQEVAARG
                *.**::* .  .  ..  ***. :*                             *     

GLMS_NOSS9      SRLIGVTPVKDGEAGEIFNDL----------LPVSHVEELLSPLLTVVPLQLLAYHIAAR
GLMS_SYNY3      ARLIGVTPMDDSQARSVFDDL----------LLVPHVEEMLSPIVAVIPLQLLSYHIAAR
GLMS_CYACA      AVLLAITHIEDSSIYQTFDFI----------IKIPKISQICASITSSVSLQLFAYYMAYY
GLMS_CHLPN      AHVIAIAPESREDIAAVSDQQ----------IFVPDCHFLAAPVLYTIVGQVMAYAMALA
GLMS_CHLTR      AYVIALAPESNRDIAAVSDEQ----------IYIPDSHDLAAPILFTIAGQIMAYTMALQ
GLMS_METMP      GKIIGISPVED----NLKYS-----------IKVPDVIEEVSPFVYATACQLLAYYKAVD
GLMS_PYRHO      GFIISLGDDVR----LHQVSD--------IFIRLPKVPEELAPITYIVPLQLLAYHLAVL
GLMS_METTH      ARVIGVGSISDES-LRKEADD--------FIGLDPEVDDVISPLVYIVPLQLLSYHVSVE
GLMS_SULAC      AKAYVISANKKISESDVEIYL---------------DSIQFPALSISVVLQLIAYYASVS
GLMS_AERPE      ASVTVVAPSDLQLDTPEGIEV--------LKMPPTGGETLLDPYSLTPYFQLLAYHLAVA
GLMS_AQUAE      GRVISVGFKGDET--LKSKSE--------SVMEIPKAEEPITPFLTVIPLQLFAYFIASK
GLMS_THET8      GKVIAIATEGDEE--IPRLAQ--------DVIYVPEVHPLLAPIVSVVPLQLLAYEIAVL
GLMS_THEMA      APVIVLGTEGNRS--LEEITG--------DIIHVPPTHESLYPLMMAPVIQLFAYHIADL
GLMS_MYCLE      AVTIVIAEEGDDTV--RLYAD--------HLIELPAVSTLLQPLLSTIPLQVFAASVAQA
GLMS_MYCTU      AVTIVIAEEGDETV--RPYAD--------HLIEIPAVSTLLQPLLSTIPLQVFAASVARA
GLMS_MYCS2      AVTVVIAEEDDDTV--RPYAD--------HLIEIPSVSTLFQPLLSTIPLQVFAAGVARA
GLMS_STRCO      ARTIVIAEEGDEAV--VPYAD--------HLVRIPATPTLLQPLVATVPLQVFACELATA
GLMS_HALSA      ADVIGLA--SDAGT--ARHAD--------VTITLPACGPL-EPVVANVALQLFAYHIANE
GLMS_HELPJ      STICVLSSEILEIADDFIQ-------------LEESESYMEEFFRMNLAMQLLALEIAMR
GLMS_HELPY      STICVLSSEILEIADDFIQ-------------LEESESYMEEFFRMNLAVQLLALEIAMR
GLMS_CAMJE      STVLSISPLEFDLSDDFIK-------------TNEQDHYMCEFFEMMVITQLLAMEISIR
GLMS_ECOLI      GQLYVFADQDAGFVSSDN----------MHIIEMPHVEEVIAPIFYTVPLQLLAYHVALI
GLMS_HAEIN      GQLYVFADKEAGFTPSEG----------MKIITMPKVNDIVAPIFYTIPMQLLSYYVALI
GLMS_BUCAI      GIVYVFSNQE--FDYEEN----------INTIKLPYVEELIAPIFYTIPLQLFAYYVALK
GLMS_TREPA      GMLYIFTDVPERFGPVCTPEADAPEGACSQIVTVPSVSPLTAPIFYAVPLQLLAYHIALL
GLMS_ACIFR      GELYVFADSDSHFNASAG----------VHVMRLPRHAGLLSPIVHAIPVQLLAYHAALV
NODM_RHILV      GRIILITDETGASMSKLPT---------MHTIVLPDVAEIIAPMIFSLPLQLLAYHTAVV
NODM_RHIML      GRIILITDEKGAAASKLDT---------MHTIVLPEVDEIIAPMIFSLPLQLLAYHTAVF
GLMS_STRA3      ANALIIVEEGLERE--------------GDDIIVNKVHPFLSAISMVIPTQLIAYYASLQ
GLMS_STRA5      ANALIIVEEGLERE--------------GDDIIVNKVHPFLSAISMVIPTQLIAYYASLQ
GLMS_STRP3      AHVLTVVEEGLDRE--------------GDDIIVNKVHPFLAPIAMVIPTQLIAYYASLQ
GLMS_STRP8      AHVLTVVEEGLDRE--------------GDDIIVNKVHPFLAPIAMVIPTQLIAYYASLQ
GLMS_STRP1      AHVLTVVEEGLDRE--------------GDDIIVNKVHPFLAPIAMVIPTQLIAYYASLQ
GLMS_STRP6      ASVLTVVEEGLDRE--------------GDDIVVNKVHPYLATIGMVIPTQLIAYYASLQ
GLMS_STRMU      ANVLTVVEEGLNKE--------------EDDVVVNQVHPYLSSISMVIPTQLIAYYASLQ
GLMS_LACLA      ASAITIVEEGVARE--------------DDTIVVNQVHPYLSAISMVIPTQLIAYYASMQ
GLMS_STRPN      AKVLTIAEENVAKD--------------TDDIVLTTVHPYLSPISMVVPTQLVAYFATLH
GLMS_STRR6      AKVLTIAEENVAKD--------------TDDIVLTTVHPYLSPISMVVPTQLVAYFATLH
GLMS_LISIN      AKTCVFAMENVAQP--------------GDRFVIPQVHPLLTPLASVIPCQLLAYYAALH
GLMS_LISMF      AKTCVFAMENVAQP--------------GDRFVIPQVHPLLTPLASVIPCQLLAYYAALH
GLMS_LISMO      AKTCIFAMENVAQP--------------GDRFVIPQVHPLLTPLASVIPCQLLAYYAALH
GLMS_OCEIH      ANAMVVSMKGLEQD--------------EDAFVIPHVHELLTPLASVIPMQLLAYYAALH
GLMS_BACSU      ANTCIISLKGLDDA--------------DDRFVLPEVNPALAPLVSVVPLQLIAYYAALH
GLMS_LACPL      AKTVTIVTDSLAKD--------------GDTVILPTVDERLTALLSVVPGQLLAYYTSLN
                .    .                                            *:.:   :  

GLMS_NOSS9      RGLDVDQPRNLAKSVTVE
GLMS_SYNY3      RGLDVDQPRNLAKSVTVE
GLMS_CYACA      KGNDIDKPRNLAKSVTVE
GLMS_CHLPN      KGMEIDCPRNLAKSVTVE
GLMS_CHLTR      RGTEVDRPRNLAKSVTVE
GLMS_METMP      LKRDVDKPRGLAKSVTVE
GLMS_PYRHO      KGHNPDRPRNLAKSVTVE
GLMS_METTH      RGLDPDKPKNLAKCVTVE
GLMS_SULAC      KGLNPDKPRNLAKTVTVE
GLMS_AERPE      RGYDPDKPRNLAKTVTVE
GLMS_AQUAE      LGLDVDQPRNLAKTVTVE
GLMS_THET8      LGRDVDQPRNLAKSVTVE
GLMS_THEMA      KGLDPDKPRNLAKSVTVE
GLMS_MYCLE      RGYDVDKPRNLAKSVTVE
GLMS_MYCTU      RGYDVDKPRNLAKSVTVE
GLMS_MYCS2      RGYDVDKPRNLAKSVTVE
GLMS_STRCO      RGNEVDQPRNLAKSVTVE
GLMS_HALSA      KGRPIDKPRNLAKSVTVE
GLMS_HELPJ      LNHDVDHPRNLAKSVTVE
GLMS_HELPY      LNHDVDHPRNLAKSVTVE
GLMS_CAMJE      LGNDVDMPRNLAKSVTVE
GLMS_ECOLI      KGTDVDQPRNLAKSVTVE
GLMS_HAEIN      KGTDVDQPRNLAKSVTVE
GLMS_BUCAI      KGRDIDQPRHLAKSVTVE
GLMS_TREPA      KGTDIDQPRNLAKSVTVE
GLMS_ACIFR      KGTDVDRPRNLAKSVTVE
NODM_RHILV      MGADVDQPRNLAKSVTVE
NODM_RHIML      MGTDVDQPRNLAKSVTVE
GLMS_STRA3      RGLDVDKPRNLAKAVTVE
GLMS_STRA5      RGLDVDKPRNLAKAVTVE
GLMS_STRP3      RGLDVDKPRNLAKAVTVE
GLMS_STRP8      RGLDVDKPRNLAKAVTVE
GLMS_STRP1      RGLDVDKPRNLAKAVTVE
GLMS_STRP6      RGLDVDKPRNLAKAVTVE
GLMS_STRMU      RGLDVDKPRNLAKAVTVE
GLMS_LACLA      RGLDVDKPRNLAKAVTVE
GLMS_STRPN      RGLDVDKPRNLAKSVTVE
GLMS_STRR6      RGLDVDKPRNLAKSVTVE
GLMS_LISIN      RDCDVDKPRNLAKSVTVE
GLMS_LISMF      RDCDVDKPRNLAKSVTVE
GLMS_LISMO      RDCDVDKPRNLAKSVTVE
GLMS_OCEIH      RDCDVDKPRNLAKSVTVE
GLMS_BACSU      RGCDVDKPRNLAKSVTVE
GLMS_LACPL      KGLDVDKPRNLAKSVTVE
                     * *: *** ****