CLUSTAL format seed alignment for MF_00165

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KTHY1_SACS2      ----------------------------------------------MQKLIAIEGIDGSG
KTHY_SULAC       -----------------------------------------------MFIISFEGIDGSG
KTHY1_SULTO      ----------------------------------------------MPRFISFEGIDGAG
KTHY_METS5       -----------------------------------------------MNLVVIEGIDASG
KTHY_METM7       ----------------------------------------------MNKFIVFEGIDGCG
KTHY_METM5       ----------------------------------------------MNKFIVFEGIDGCG
KTHY_METMP       ----------------------------------------------MNKFIVFEGIDGCG
KTHY_METVS       ----------------------------------------------MNKFIVFEGIDGSG
KTHY_META3       ----------------------------------------------MNKFIVFEGIDGSG
KTHY_METJA       --------------------------------------------MVDNMFIVFEGIDGSG
KTHY_METS3       ------------------------------------------------MYIVFEGIDGAG
KTHY_METTH       ------------------------------------------------MYICFEGIDGSG
KTHY_METST       ------------------------------------------------MYIVLEGIDGVG
KTHY_BDEBA       -------------------------------------------MRCKMKFIVFEGLDGSG
KTHY_RHOBA       MAGVGIRSYACHRQTRRLLDGDVLMSPGPGNTDMPQTKSSPIAHPYPGRLITLDGIDGVG
KTHY_GEOSL       ----------------------------------------------MGYFITFEGIEGCG
KTHY_GEOUR       ----------------------------------------------MGCFITFEGVEGCG
KTHY_PELPD       ----------------------------------------------MGYFITFEGIEGSG
KTHY_PELCD       ----------------------------------------------MSFFISLEGIEGSG
KTHY_MAGMM       ---------------------------------------------MQGRFITFEGGEGAG
KTHY_AGRFC       ------------------------------------------MAEKTGLFISFEGGEGAG
KTHY_RHIME       ----------------------------------MHADPGIEVSLAKGFFITFEGGEGTG
KTHY_RHILO       --------------------------------------------MARGFFITFEGGEGAG
KTHY_BRUO2       ---------------------------------------------MSGLFITFEGGEGAG
KTHY_BRUME       ---------------------------------------------MSGLFITFEGGEGAG
KTHY_BRUSU       ---------------------------------------------MSGLFITFEGGEGAG
KTHY_BRUC2       ---------------------------------------------MSGLFITFEGGEGAG
KTHY_BRUSI       ---------------------------------------------MSGLFITFEGGEGAG
KTHY_BRASO       -----------------------------------MADAALKRGPGRGRFVTFEGGEGAG
KTHY_BRASB       -----------------------------------MADVALKRGPGRGRFVTFEGGEGAG
KTHY_NITHX       -----------------------------------MTEAAPKVGLLRGRFITFEGGEGSG
KTHY_NITWN       -----------------------------------MAQATPKADSQRGRFITFEGGEGSG
KTHY_BRADU       -----------------------------------MSDSAVQRSSGRGRFITFEGGEGTG
KTHY_RHOPB       -----------------------------------MAKDTPNGAATRGRFITFEGGEGAG
KTHY_RHOPA       -----------------------------------MVQKKPINRSLRGRFITFEGGEGAG
KTHY_BARQU       ---------------------------------------------MSGYFITFEGGEGVG
KTHY_BARHE       ---------------------------------------------MSGYFITFEGGEGVG
KTHY_CAUVC       --------------------------------------------MTQGFFISFEGGEGAG
KTHY_JANSC       ---------------------------------------------MPPLFISLEGIDGSG
KTHY_SPHWW       ---------------------------------------------MPGRFITLEGGEGVG
KTHY_RHOS1       -------------------------------------------MGAQGFFLAVEGIDGSG
KTHY_RHOS4       -------------------------------------------MGAQGFFLAVEGIDGSG
KTHY_SYMTH       ----------------------------------------------MSVFISFEGVDGSG
KTHY_PELTS       ---------------------------------------------MKGKFIVFEGVDGSG
KTHY_ROSCS       ----------------------------------------------MSLFVTFEGPEGSG
KTHY_ROSS1       ----------------------------------------------MSLFVTFEGPEGSG
KTHY_DESRM       ---------------------------------------------MALIFIVFEGVDGSG
KTHY_THEMA       ------------------------------------------------MFITFEGIDGSG
KTHY_THEP1       ------------------------------------------------MFITFEGIDGSG
KTHY_THEM4       ------------------------------------------------MFIAFEGIDGSG
KTHY_FERNB       ------------------------------------------------MFVSFEGIDGCG
KTHY_AQUAE       ------------------------------------------------MLIAFEGIDGSG
KTHY_CALS4       ---------------------------------------------MRGKFISFEGIDGCG
KTHY_PELLD       ------------------------------------------------MLITFEGIDGAG
KTHY_CHLPM       ------------------------------------------------MLITFEGIDGAG
KTHY_CHLPD       ------------------------------------------------MLITFEGIDGAG
KTHY_CHLTE       ------------------------------------------------MLISFEGIDGAG
KTHY_CHLCH       ------------------------------------------------MLITFEGIDGAG
KTHY_DEHMB       ----------------------------------------------MSLFITFEGGEGCG
KTHY_DEHMC       ----------------------------------------------MSLFITFEGGEGCG
KTHY_DEHM1       ----------------------------------------------MSLFITFEGGEGCG
KTHY_NOSS1       ---------------------------------------------MGGRFIVFEGVEGCG
KTHY_TRIV2       ---------------------------------------------MGGRFIVFEGVEGCG
KTHY_ACAM1       ---------------------------------------------MLGKFIVFEGGEGAG
KTHY_TRIEI       ---------------------------------------------MIGKFIVFEGVEGGG
KTHY_THEEB       --------------------------------------MHSATHPYAGLFIVLEGGEGAG
KTHY_SYNSC       ---------------------------------------------MTGRFIVLEGIDGCG
KTHY_SYNPX       ---------------------------------------------MSGRFIVLDGIDGCG
KTHY_SYNS9       ---------------------------------------------MTGRFIVLDGIDGCG
KTHY_PROMM       ---------------------------------------------MSGRFLVLEGIDGCG
KTHY_PROM3       ---------------------------------------------MSGRLLVLEGIDGCG
KTHY_SYNPW       ---------------------------------------------MKGRFLVLEGIDGCG
KTHY_SYNR3       ---------------------------------------------MRGRFLVLEGIDGCG
KTHY_SYNS3       ----------------------------------------------MGRLLVLEGIDGCG
KTHY_PROMT       ---------------------------------------------MKGKFIVFEGIDGSG
KTHY_PROM1       ---------------------------------------------MKGKFIVFEGIDGSG
KTHY_PROMA       ---------------------------------------------MKGIFLVLEGIDGCG
KTHY_PROMS       ---------------------------------------------MKGKFIVIEGIDGCG
KTHY_PROM0       ---------------------------------------------MKGKFIVIEGIDGCG
KTHY_PROM9       ---------------------------------------------MKGKFIVIEGIDGCG
KTHY_PROM2       ---------------------------------------------MKGKFIVIEGIDGCG
KTHY_PROM5       ---------------------------------------------MKGKFIVIEGIDGCG
KTHY_PROMP       ---------------------------------------------MRGKFIVIEGIDGCG
KTHY_CARHZ       ---------------------------------------------MRGKFITIEGVEGSG
KTHY_THET8       ---------------------------------------------MPGLFLTLEGLDGSG
KTHY_THET2       ---------------------------------------------MPGLFLTLEGLDGSG
KTHY_DEIRA       --------------------------------------------MSQGLFITLEGPEGAG
KTHY_CLAMS       ---------------------------------------------MTGVFITLEGGDGVG
KTHY_CLAM3       ---------------------------------------------MTGVFITLEGGDGVG
KTHY_LEIXX       ---------------------------------------MSVPTNRPGLFITLEGGDGVG
KTHY_BIFLO       ---------------------------------------------MNGLFVSFEGVDGVG
KTHY_BIFAA       ---------------------------------------------MQGTFISFEGVDGVG
KTHY_CUTAK       ---------------------------------------------MGGVFVVFEGGDGAG
KTHY_DESVH       ------------------------------------------------MFITFEGIEGSG
KTHY_DESVV       ------------------------------------------------MFITFEGIEGSG
KTHY_DESAG       ------------------------------------------------MFITFEGIEGSG
KTHY_LAWIP       ------------------------------------------------MFITIEGIEGSG
KTHY_GLOVI       ------------------------------------------------MFITFEGGEGCG
KTHY_LACSS       ---------------------------------------------MVGKLITFEGPDGAG
KTHY_LACPL       --------------------------------------------MLTGKLVTFEGPDGAG
KTHY_LACBA       ---------------------------------------------MSGTFISFEGPDGAG
KTHY_PEDPA       ---------------------------------------------MNGHFISFEGPDGAG
KTHY_LACP3       ---------------------------------------------MTGTFITFEGPDGAG
KTHY_ENTFA       ---------------------------------------------MQGIFITFEGPDGAG
KTHY_LACS1       ---------------------------------------------MEGKFITFEGIDGSG
KTHY_LEUMM       --------------------------------------------MPKPIFISFEGPEGAG
KTHY_LACRD       ---------------------------------------------MDGKFISFEGPDGAG
KTHY_OENOB       --------------------------------------------MKKGFFITIEGPDGAG
KTHY_STRA5       --------------------------------------------MKKGLMISFEGPDGAG
KTHY_STRA3       --------------------------------------------MKKGLMISFEGPDGAG
KTHY_STRA1       --------------------------------------------MKKGLMISFEGPDGAG
KTHY_STRTD       --------------------------------------------MSKGLLISIEGPDGAG
KTHY_STRT2       --------------------------------------------MSKGLLISIEGPDGAG
KTHY_STRT1       --------------------------------------------MSKGLLISIEGPDGAG
KTHY_STRMU       --------------------------------------------MTKGIFISFEGPDGAG
KTHY_STRPG       --------------------------------------------MITGKLITVEGPDGAG
KTHY_STRP8       --------------------------------------------MITGKLITVEGPDGAG
KTHY_STRP3       --------------------------------------------MITGKLITVEGPDGAG
KTHY_STRP6       --------------------------------------------MITGKLITVEGPDGAG
KTHY_STRP1       --------------------------------------------MITGKLITVEGPDGAG
KTHY_STRGC       --------------------------------------------MKRGLLVSLEGPDGAG
KTHY_STRSV       --------------------------------------------MKNGILISLEGPEGAG
KTHY_STRP2       --------------------------------------------MSKGFLVSLEGPEGAG
KTHY_STRR6       --------------------------------------------MSKGFLVSLEGPEGAG
KTHY_STRPN       --------------------------------------------MSKGFLVSLEGPEGAG
KTHY_LACLM       ---------------------------------------------MNGILISLEGPDGAG
KTHY_LACLS       ---------------------------------------------MNGILISLEGPDGAG
KTHY_LACLA       ---------------------------------------------MNGILISLEGPDGAG
KTHY_LACH4       ---------------------------------------------MRGYFVSFEGPDGAG
KTHY_LACAC       ---------------------------------------------MKGYFVSFEGPDGAG
KTHY_LACDB       ---------------------------------------------MQGYFITFEGPDGAG
KTHY_LACDA       ---------------------------------------------MQGYFITFEGPDGAG
KTHY_LACJO       ---------------------------------------------MRGYLITFEGPDGAG
KTHY_CLONN       --------------------------------------------MNKGAFITLEGPEGSG
KTHY_CLOB8       --------------------------------------------MKKGLFIVFEGGEGTG
KTHY_BACHD       --------------------------------------------MTKGCFITVEGGEGAG
KTHY_BACVZ       ---------------------------------------------MSGLFITFEGPEGAG
KTHY_BACSU       ---------------------------------------------MSGLFITFEGPEGAG
KTHY_BACLD       ---------------------------------------------MNGLFITFEGPEGAG
KTHY_BACP2       ---------------------------------------------MSGMFITFEGPEGAG
KTHY_BACHK       ---------------------------------------------MKGLFVTIEGPEGSG
KTHY_BACAN       ---------------------------------------------MKGLFVTIEGPEGSG
KTHY_BACCZ       ---------------------------------------------MKGLFVTIEGPEGSG
KTHY_BACAH       ---------------------------------------------MKGLFVTIEGPEGSG
KTHY_BACC1       ---------------------------------------------MKGLFVTIEGPEGSG
KTHY_BACCR       ---------------------------------------------MKGLFVTIEGPEGSG
KTHY_BACCN       ---------------------------------------------MKGLFVTIEGPEGSG
KTHY_OCEIH       ---------------------------------------------MAGLFITFEGGEGAG
KTHY_GEOTN       ---------------------------------------------MNGYFFSFEGPEGAG
KTHY_GEOKA       -----------------------------------------MPRVMNGCFFSFEGPEGAG
KTHY_BACSK       --------------------------------------------MKKGLFITVEGGEGAG
KTHY_STAAN       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAAM       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAAC       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAA9       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAA3       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAAR       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAA2       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAA8       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAA1       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAAB       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAAS       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAAW       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAS1       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAHJ       ----------------------------------------------MSAFITFEGPEGSG
KTHY_STAES       ----------------------------------------------MSTFITFEGPEGAG
KTHY_STAEQ       ----------------------------------------------MSTFITFEGPEGAG
KTHY_LISMF       ---------------------------------------------MKAIFITLEGPDGSG
KTHY_LISMO       ---------------------------------------------MKAIFITLEGPDGSG
KTHY_LISIN       ---------------------------------------------MKAIFITLEGPDGSG
KTHY_LISW6       ---------------------------------------------MKAIFITLEGPDGSG
KTHY_MYCMS       ------------------------------------------------MFITFEGMDGSG
KTHY_MYCCT       ------------------------------------------------MFITFEGMDGSG
KTHY_MESFL       ------------------------------------------------MFITIEGMDGSG
KTHY_ONYPE       ------------------------------------------------MFISFEGCEGTG
KTHY_AYWBP       ------------------------------------------------MFISFEGCEGTG
KTHY_ACHLI       ------------------------------------------------MFITFEGGEGSG
KTHY_TROWT       ------------------------------------------------MFVTFEGIDGSG
KTHY_TROW8       ------------------------------------------------MFVTFEGIDGSG
KTHY_CHLCV       ------------------------------------------------MFIVIEGCEGSG
KTHY_CHLFF       ------------------------------------------------MFIVIEGCEGSG
KTHY_CHLAB       ------------------------------------------------MFIVIEGCEGSG
KTHY_CHLPN       ------------------------------------------------MFIVIEGGEGSG
KTHY_CHLTR       ------------------------------------------------MFIVVEGGEGAG
KTHY_CHLTA       ------------------------------------------------MFIVVEGGEGAG
KTHY_CHLMU       ------------------------------------------------MFIVVEGGEGAG
KTHY_PARUW       ----------------------------------------MPSTKFKGYFITIEGGEGSG
KTHY_PSEPF       ---------------------------------------------MTGLFITLEGPEGAG
KTHY_PSEF5       ---------------------------------------------MTGLFITLEGPEGAG
KTHY_PSEPG       ---------------------------------------------MSGLFITLEGPEGAG
KTHY_PSEP1       ---------------------------------------------MSGLFITLEGPEGAG
KTHY_PSEE4       ---------------------------------------------MSGLFITLEGPEGAG
KTHY_PSEMY       ---------------------------------------------MTGLFITLEGPEGAG
KTHY_PSEU5       ---------------------------------------------MKGLFVTLEGPEGAG
KTHY_PSEAE       ---------------------------------------------MTGLFVTLEGPEGAG
KTHY_PSEA7       ---------------------------------------------MTGLFVTLEGPEGAG
KTHY_PSEAB       ---------------------------------------------MTGLFVTLEGPEGAG
KTHY_PSESM       ---------------------------------------------MTGLFITLEGPEGAG
KTHY_PSEU2       ---------------------------------------------MTGLFITLEGPEGAG
KTHY_PSE14       ---------------------------------------------MTGLFITLEGPEGAG
KTHY_ALCBS       ---------------------------------------------MSGRFITLEGGEGAG
KTHY_CHRSD       --------------------------------------------MTPGRFITLEGGEGVG
KTHY_METCA       --------------------------------------------MTPGKFITLEGGEGVG
KTHY_ALKEH       --------------------------------------------MTRGRFITLEGLEGAG
KTHY_VESOH       --------------------------------------------MQRGKFITIDGVEGAG
KTHY_RUTMC       --------------------------------------------MQRGKFITIDGVEGSG
KTHY_MARMS       ---------------------------------------------MRGKFISLEGGEGSG
KTHY_COXBU       --------------------------------------MEKNMGIERGRFISFEGIEGVG
KTHY_NITEU       --------------------------------------------MQRGKFITVEGIDGAG
KTHY_NITEC       --------------------------------------------MQRGKFITFEGIDGAG
KTHY_NITMU       ---------------------------------------------MRGKFITLEGIDGAG
KTHY_BORBR       -------------------------------------------MTPRGRFITLEGVDGAG
KTHY_BORPE       -------------------------------------------MTPRGRFITLEGVDGAG
KTHY_BORPA       -------------------------------------------MTPRGRFITLEGVDGAG
KTHY_DECAR       ---------------------------------------------MKGKFITFEGIDGAG
KTHY_BURCH       --------------------------------------------MASGKFITFEGIDGAG
KTHY_BURCA       --------------------------------------------MASGKFITFEGIDGAG
KTHY_BURCM       --------------------------------------------MASGKFITFEGIDGAG
KTHY_BURL3       --------------------------------------------MASGKFITFEGIDGAG
KTHY_BURVG       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURM9       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURP6       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURMS       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURM7       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURMA       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURP1       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURPS       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURP0       --------------------------------------------MARGKFITFEGIDGAG
KTHY_BURTA       --------------------------------------------MARGKFITFEGIDGAG
KTHY_PARXL       --------------------------------------------MARGKFITFEGIDGAG
KTHY_RALSO       ---------------------------------------------MTGKFITFEGIDGAG
KTHY_HERAR       --------------------------------------------MTKAKFITFEGIDGAG
KTHY_JANMA       --------------------------------------------MTTGKFITFEGIDGAG
KTHY_NEIG1       ---------------------------------------------MKPQFITLDGIDGAG
KTHY_NEIMB       ---------------------------------------------MKPQFITLDGIDGAG
KTHY_NEIMA       ---------------------------------------------MKPQFITLDGIDGAG
KTHY_NEIMF       ---------------------------------------------MKPQFITLDGIDGAG
KTHY_CHRVO       ----------------------------------------MSSEVRRGRFITLEGIDGAG
KTHY_HALHL       -------------------------------------------MTERGCFITVEGLEGAG
KTHY_DICNV       ---------------------------------------------MRGKFICLDGTEGSG
KTHY_ACISJ       --------------------------------------------MTNGAFITFEGIDGAG
KTHY_ACIAC       -------------------------------------------MQRRGWFITFEGIDGAG
KTHY_RHOFT       -------------------------------------------MTTEGIFISFEGIDGAG
KTHY_POLSJ       ---------------------------------------------MHGLFISFEGIDGAG
KTHY_VEREI       -------------------------------------------MSRPGLFISFEGIDGAG
KTHY_ACIAD       ------------------------------------------------MFISFEGTEGVG
KTHY_SALTY       ---------------------------------------------MGSNYIVIEGLEGAG
KTHY_SALTI       ---------------------------------------------MGSNYIVIEGLEGAG
KTHY_SALPA       ---------------------------------------------MGSNYIVIEGLEGAG
KTHY_SALCH       ---------------------------------------------MGSNYIVIEGLEGAG
KTHY_SALPB       ---------------------------------------------MGSNYIVIEGLEGAG
KTHY_SALAR       ---------------------------------------------MGSNYIVIEGLEGAG
KTHY_ECOUT       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECOK1       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECOL6       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_SHIDS       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_SHIBS       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECOHS       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_SHIFL       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_SHIF8       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECOLC       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECOLI       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_SHISS       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECO24       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECOL5       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_ECO57       ---------------------------------------------MRSKYIVIEGLEGAG
KTHY_CITK8       ---------------------------------------------MGSNYIVIEGLEGAG
KTHY_ENT38       ---------------------------------------------MRSNYIVIEGLEGAG
KTHY_KLEP7       ---------------------------------------------MRSNYIVIEGLEGAG
KTHY_CROS8       ---------------------------------------------MSSKYIVIEGLEGAG
KTHY_YERP3       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_YERPS       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_YERPA       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_YERPP       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_YERPN       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_YERPE       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_YERE8       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_SERP5       ---------------------------------------------MKSKFVVIEGLEGAG
KTHY_PHOLL       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_PECAS       ---------------------------------------------MNSKFIVIEGLEGAG
KTHY_SODGM       ---------------------------------------------MNSKFIVIEGLEGSG
KTHY_VIBC3       ---------------------------------------------MNAKFIVIEGLEGAG
KTHY_VIBCH       ---------------------------------------------MNAKFIVIEGLEGAG
KTHY_VIBPA       --------------------------------------------MMKANFIVVEGLEGAG
KTHY_VIBCB       --------------------------------------------MMKANFIVVEGLEGAG
KTHY_VIBVY       --------------------------------------------MKQAKFIVIEGLEGAG
KTHY_VIBVU       --------------------------------------------MKQAKFIVIEGLEGAG
KTHY_ALIF1       ----------------------------------------------MSKFIVIEGLEGAG
KTHY_PHOPR       ---------------------------------------------MTAKFIVIEGLEGAG
KTHY_HAES1       --------------------------------------------MKTGKFIVIEGLEGAG
KTHY_HISS2       --------------------------------------------MKTGKFIVIEGLEGAG
KTHY_MANSM       -----------------------------------------MNKNMNGKFIVLEGLEGAG
KTHY_HAEIN       ---------------------------------------------MKGKFIVIEGLEGAG
KTHY_PASMU       --------------------------------------------MTTGKFIVLEGIEGAG
KTHY_HAEDU       ----------------------------------------MRTNNMRGKFIVLEGLEGAG
KTHY_WIGBR       --------------------------------------------MIKSKFIVIEGLEGSG
KTHY_BAUCH       ---------------------------------------------MKSKFIVIEGLEGAG
KTHY_SHESR       ------------------------------------------MTQASAKFIVVEGLEGAG
KTHY_SHESM       ------------------------------------------MTQASAKFIVVEGLEGAG
KTHY_SHESA       ------------------------------------------MTQASAKFIVVEGLEGAG
KTHY_SHEON       ------------------------------------------MTQASAKFIVVEGLEGAG
KTHY_SHELP       ------------------------------------------MKQNSAKFIVIEGLEGAG
KTHY_SHEFN       ------------------------------------------MSQQQGKFIVIEGLEGAG
KTHY_SHEAM       ------------------------------------------MTQNPGKFIVIEGLEGAG
KTHY_PSEHT       ---------------------------------------------MKPKFIVIEGLEGAG
KTHY_COLP3       --------------------------------------------MSTGKFIVIEGMEGAG
KTHY_IDILO       ---------------------------------------------MSGKFIVIEGLEGAG
KTHY_LEGPH       ------------------------------------------MSSLTGKLIVIEGLEGAG
KTHY_LEGPL       ------------------------------------------MSSLTGKLIVIEGLEGAG
KTHY_LEGPA       ------------------------------------------MSSLTGKLIVIEGLEGAG
KTHY_LEGPC       ------------------------------------------MSSLTGKLIVIEGLEGAG
KTHY_BLOPB       ---------------------------------------------MDNRFITIEGLDGAG
KTHY_BLOFL       ---------------------------------------------MNNRFIVVEGLDGSG
KTHY_BUCAI       --------------------------------------------MIKSKFIVIEGLEGAG
KTHY_BUCAP       --------------------------------------------MIKSKFIVIEGLEGAG
KTHY_BUCBP       --------------------------------------------MLKGKFIVIEGIEGSG
KTHY_FRAT1       ---------------------------------------------MQSKFIVIEGLDGAG
KTHY_FRATW       ---------------------------------------------MQSKFIVIEGLDGAG
KTHY_FRATT       ---------------------------------------------MQSKFIVIEGLDGAG
KTHY_FRATN       ---------------------------------------------MQSKFIVIEGLDGAG
KTHY_FRATF       ---------------------------------------------MQSKFIVIEGLDGAG
KTHY_FRATH       ---------------------------------------------MQSKFIVIEGLDGAG
KTHY_FRATO       ---------------------------------------------MQSKFIVIEGLDGAG
KTHY_WOLTR       ------------------------------------------------MFITFEGIDGSG
KTHY_WOLPM       ------------------------------------------------MFITFEGIDGSG
KTHY_EHRCR       ------------------------------------------------MFITFEGIDGSG
KTHY_EHRCJ       ------------------------------------------------MFITFEGIDGSG
KTHY_EHRRW       ------------------------------------------------MFITFEGIDGSG
KTHY_EHRRG       ------------------------------------------------MFITFEGIDGSG
KTHY_ANAMM       ------------------------------------------------MFITFEGIDGCG
KTHY_ANAPZ       ------------------------------------------------MFITFEGIDGCG
KTHY_NEOSM       ------------------------------------------------MFIVLEGIDGSG
KTHY_RICRO       -----------------------------------------MNNLKQGKFITFEGGEGIG
KTHY_RICRS       -----------------------------------------MNNLKQGKFITFEGGEGIG
KTHY_RICCN       -----------------------------------------MNNLKQGKFITFEGGEGIG
KTHY_RICM5       -----------------------------------------MNNLKQGKFITFEGGEGIG
KTHY_RICFE       -----------------------------------------MNNLKQGKFITFEGGEGIG
KTHY_RICCK       -----------------------------------------MNNLTQGKFITFEGGEGSG
KTHY_RICAH       -----------------------------------------MNNLKQGKFITFEGGDGIG
KTHY_RICPR       -----------------------------------------MNKLTQGKFITFEGVDGIG
KTHY_RICTY       -----------------------------------------MNKLTQGKFITFEGMDGIG
KTHY_RICB8       -----------------------------------------MSKLKQGTFITFEGGEGIG
KTHY_RICBR       -----------------------------------------MSKLKQGTFITFEGGEGIG
KTHY_ORITB       -----------------------------------------MSNTTIGKFITFEGNEGSG
KTHY_MYCS5       ------------------------------------------------MFITFEGLDGSG
KTHY_MYCPU       -----------------------------------MKIENKSDKEEDQMFITFEGIDASG
KTHY_UREPA       --------------------------------MILTKNSNEKKPLKKGLFIVFEGIDGAG
KTHY_UREP2       --------------------------------MILTKNSNEKKPLKKGLFIVFEGIDGAG
KTHY_MYCMO       ------------------------------------------------MFISFEGIDGAG
KTHY_MYCHJ       ------------------------------------------------MFISFEGIDASG
KTHY_MYCH2       ------------------------------------------------MFISFEGIDASG
KTHY_MYCH7       ------------------------------------------------MFISFEGIDASG
KTHY_MYCPN       --------------------------------------------MKQGVFVAIEGVDGAG
KTHY_MYCGE       --------------------------------------------MNKGVFVVIEGVDGAG
KTHY_MYCGA       --------------------------------------------MKKGVFIVIEGVDGSG
KTHY_MYCPE       ------------------------------------------MQLDKGLFVAFEGPDACG
KTHY_CAMJR       ------------------------------------------------MYVVFEGIDCVG
KTHY_CAMJE       ------------------------------------------------MYVVFEGIDCVG
KTHY_CAMJJ       ------------------------------------------------MYVVFEGIDCVG
KTHY_CAMJ8       ------------------------------------------------MYVVFEGIDCVG
KTHY_CAMJD       ------------------------------------------------MYVVFEGIDCVG
KTHY_CAMC1       ------------------------------------------------MYVLFEGIDGVG
KTHY_CAMHC       ------------------------------------------------MLIFFEGIDGVG
KTHY_SULDN       ------------------------------------------------MYIAIEGIDTAG
KTHY_HELHP       ------------------------------------------------MYVAIEGVDTCG
KTHY_HELPJ       ------------------------------------------------MYVVLEGVDGAG
KTHY_HELPY       ------------------------------------------------MYVVLEGVDGAG
KTHY_HELPH       ------------------------------------------------MYVVLEGVDGVG
KTHY_HELAH       ------------------------------------------------MYVVLEGIDGVG
KTHY_METMA       ---------------------------------------------MRGKLITLEGIDGSG
KTHY_METAC       ---------------------------------------------MRGKLITLEGIDGSG
KTHY_METBF       ---------------------------------------------MRGKLITLEGIDGSG
KTHY_METBU       ---------------------------------------------MKGKLITLEGIDGSG
KTHY_HALSA       ------------------------------------------------MLVTLEGLDGSG
KTHY_HALMA       ------------------------------------------------MLVTLEGLDGSG
KTHY_NATPD       ------------------------------------------------MLITLEGIDGSG
KTHY_METHJ       ------------------------------------------------MLVTIEGIDGSG
KTHY_METLZ       ------------------------------------------------MLITLEGIDGAG
KTHY_METMJ       ------------------------------------------------MLITIEGIDGSG
KTHY_PYRAB       ---------------------------------------------MRGYFVVLEGIDGSG
KTHY_PYRHO       ---------------------------------------------MRGYFIVLEGIDGSG
KTHY_PYRFU       --------------------------------------------MKRGLFIVLEGIDGSG
KTHY_THEKO       ------------------------------------------------MFIVLEGIDGAG
KTHY_XANOR       ---------------------------------------MTIELKPGGLLIAIEGIDGAG
KTHY_XANOM       ---------------------------------------MTIELKPGGLLIAIEGIDGAG
KTHY_XANAC       ---------------------------------------MTIELKPGGLLIAIEGIDGAG
KTHY_XANC5       ---------------------------------------MTIELKPGGLLIAIEGIDGAG
KTHY_XANCP       ---------------------------------------MTIELTPGGLLIAIEGIDGAG
KTHY_XANC8       ---------------------------------------MTIELTPGGLLIAIEGIDGAG
KTHY_XYLFA       ------------------------------------------------MLVAIEGIDGAG
KTHY_XYLFT       ------------------------------------------------MLVAIEGIDGAG
KTHY_DESPS       -----------------------------------------MSNNPG-KLIIFEGTDGAG
KTHY_LEPBJ       ------------------------------------------MKIEKPIFVVFEGIDGSG
KTHY_LEPBL       ------------------------------------------MKIEKPIFVVFEGIDGSG
KTHY_LEPIC       ------------------------------------------MKNKKPIFVVFEGIDGSG
KTHY_LEPIN       ------------------------------------------MKNKKPIFVVFEGIDGSG
KTHY_ARCFU       ------------------------------------------------MLIAVEGIDGAG
KTHY_PYRCJ       ------------------------------------------------MFIAVEGIDGSG
KTHY_PYRAE       -----------------------------------------------MAFVAIEGIDGSG
KTHY_STAMF       ------------------------------------------MSENNGFFLVLEGIDGAG
KTHY2_SACS2      ---------------------------------------------MRGLLIAFEGIDGSG
KTHY2_SULTO      --------------------------------------------MKKGVLIAFEGIDGSG
KTHY_THEVO       ------------------------------------------------MFIAVEGIDGAG
KTHY_THEAC       ------------------------------------------------MFIAIEGIDGAG
KTHY_PICTO       ------------------------------------------MIDNGSMFIAIEGIDGSG
KTHY_SYNY3       ---------------------------------------------MAALFIVLEGIDGSG
KTHY_METKA       ----------------------------------------------MGLYLGVEGIDGVG
KTHY_MYCTU       ------------------------------------------------MLIAIEGVDGAG
                                                                   . .:* :  *

KTHY1_SACS2      KTTLANLLKEHLESKMKL----------N--VIVTREPFS--EDIIKLIEKIGWN-----
KTHY_SULAC       KTTISKIIYEKLLIEIGS----------NKKIILTSEPFS--QEIIKLIEEIGWK-----
KTHY1_SULTO      KTTLAKKVYEVLKKK-GY----------N--VILTQEPFT--REITELIKKAGWN-----
KTHY_METS5       KTTLAKRLAESLSPRFK--------------VLLTQEPFT--DDIKQLLEKYQWK-----
KTHY_METM7       KTTQAKLIAEKLN------------------AKFTFEPTD--GKIGKSIREILSG-----
KTHY_METM5       KTTQAKLIAEKLN------------------AKFTFEPTD--GKIGKSIREILSG-----
KTHY_METMP       KTTQAKLVAEKLN------------------ANFTFEPTD--GKIGKSIREILAG-----
KTHY_METVS       KTTQAKMLAEKLN------------------AEYTCEPTT--GKIGRTIREVLSG-----
KTHY_META3       KTTQAKLLADYLN------------------GIYTCEPTN--GEIGQLIRKVLGG-----
KTHY_METJA       KTTQSKLLAKKMD------------------AFWTYEPSN--SLVGKIIREILSGK----
KTHY_METS3       KSTQINLLKDWLDQN-------------GFDVETVVEPTD--SEVGKLIRKILQRPDAT-
KTHY_METTH       KTTHAALTASWLREN-------------GYMVHEVREPTD--SNIGSLIRSMLSSPDAR-
KTHY_METST       KTTQTEKLKEWLEKR-------------GFSVKTIVEPTD--SDIGKIIREELLKPEAT-
KTHY_BDEBA       KSSLMAALERELQNRAI-------------NFLRTREPGG--TPLGDEIRNMILRKEGPA
KTHY_RHOBA       KSSQIEILAERLRSEGR-------------NVLCVRDPGS--TDLGTKLRAMLLDSD-LE
KTHY_GEOSL       KTTQIKRAAQSLREAGH-------------RVVVTREPGG--CPIADDIRAILLDAGNSA
KTHY_GEOUR       KTTQIKLLAQHLTEQGH-------------TVIVTREPGG--CPIADQARAILLDADNRA
KTHY_PELPD       KTTQIGLLGEQLESLGY-------------SVVMTREPGG--CAISDKIRSILLDADNSS
KTHY_PELCD       KTTQIKRLADRLESLGH-------------AVLITREPGG--CPIADQIRQILLHPDNGH
KTHY_MAGMM       KSTQIAQLTQSLQAHGV-------------KVLCTREPGG--CPISERIREILVTGQGDD
KTHY_AGRFC       KSTQIRTLAEALRGRGF-------------EVVVTREPGG--SPGAEAVRHVILSGAAES
KTHY_RHIME       KSTQMRLLAEALSARGY-------------RVLTTREPGG--SVGAEAVRHVLLSGAAES
KTHY_RHILO       KSTQIERLARKMHAKKY-------------DVLLTREPGG--SPGAEAVRHVLLSGAAEP
KTHY_BRUO2       KSTQIALLASHLRNHGF-------------DPVITREPGG--SPGAEAIRHVILSGNAET
KTHY_BRUME       KSTQIALLASHLRNHGF-------------DPVITREPGG--SPGAEAIRHVILSGNAET
KTHY_BRUSU       KSTQIALLASHLRNHGF-------------DPVITREPGG--SPGAEAIRHVILSGNAET
KTHY_BRUC2       KSTQIALLASHLRNHGF-------------DPVITREPGG--SPGAEAIRHVILSGNAET
KTHY_BRUSI       KSTQIALLASHLRNHGF-------------DPVITREPGG--SPGAEAIRHVILSGNAET
KTHY_BRASO       KSTQIKMLADRLEKDGV-------------RVVLTREPGG--SPGAEIMRHLVLSGMGKL
KTHY_BRASB       KSTQIKMLAARLESEGM-------------RVVLTREPGG--SPGAEIMRHLVLSGMGKL
KTHY_NITHX       KSTQINILAERLNAAKL-------------RAIVTREPGG--SPGAEIIRHLVLSGMGKL
KTHY_NITWN       KSTQIRILAERLQAAKL-------------RAIVTREPGG--SPGAEIIRHLVLSGVGKL
KTHY_BRADU       KSTQIKKLADRLKAARM-------------RTLVTREPGG--SPGAEIMRHLVLSGMGKL
KTHY_RHOPB       KSTQIKLLAERLNAGRI-------------RCVLTREPGG--SPGAEIIRHMILSGIGSL
KTHY_RHOPA       KSTQIRLLAKRLEKARL-------------RTLVTREPGG--SPGAEAIRSALLAGIGKL
KTHY_BARQU       KTTQISLLAQYLRNQGY-------------DVLTTREPGG--TVGAEAIRHILLSGQAQ-
KTHY_BARHE       KTTQIFLLAQHLYGKGY-------------DVLTTREPGG--TAGAEVIRHILLSGQVQQ
KTHY_CAUVC       KSTQIRRLADRLKAAGH-------------DVIVTREPGG--SPGAEAIRELLVNGAADR
KTHY_JANSC       KSTQTARLVDWLRVRGR-------------DPLQTREPGG--SEGAEEIRRLLVEGDPDR
KTHY_SPHWW       KSTQAKALAAALRARGL-------------DVVETREPGG--SDGAEAIRRLLLEGAADR
KTHY_RHOS1       KSGIVRSLAAHLGAEGR-------------DVLVTREPGG--TPEGEAIRGLVLAGADEA
KTHY_RHOS4       KSGIVRSLAAHLGAEGR-------------DVLVTREPGG--TPEGEAIRGLVLAGADEA
KTHY_SYMTH       KSTQIRLLLQYLDEQSV-------------PYVFTREPGG--TPIAEQIRRVLLDPANRG
KTHY_PELTS       KTTQIKLLGEKLESMGC-------------PVVYTREPGG--TRVGERIREILLNPLYGE
KTHY_ROSCS       KSTQARLLYESLYARRY-------------PVILTREPGG--TRIGDLIRRIVLDLQHTE
KTHY_ROSS1       KSTQARLLYESLHARRF-------------PVILTREPGG--TRIGDLIRRIVLDLQHTE
KTHY_DESRM       KSTQLNLLNKYLSQKEI-------------KTICTREPGG--TPVGEKIRELLLDPNFAE
KTHY_THEMA       KSTQIQLLAQYLEKRGK-------------KVILKREPGG--TETGEKIRKILLEEE---
KTHY_THEP1       KSTQIKLLARYLEKRGK-------------RVILKREPGG--TETGEKIRKLLLKEE---
KTHY_THEM4       KSTQLVLLEKYLINRGK-------------KVIKVREPGG--TILGEKIRDLLLNFN---
KTHY_FERNB       KSTQVNLLVNYLEEKGI-------------PYIKVREPGG--THLGEKIRELLITQE---
KTHY_AQUAE       KTTQAKKLYEYLKQKGY-------------FVSLYREPGG--TKVGEVLREILLTEE---
KTHY_CALS4       KTTQVKLLEEHLKKEGY-------------DLLVLREPGG--TRVGEKVREILLDRENL-
KTHY_PELLD       KSTQIQKLAAYLKQEGR-------------EVLTLREPGG--TEVAEKIRHILLESRHD-
KTHY_CHLPM       KSTQIRKLAAHLRSQGQ-------------EVLTLREPGG--TEVAENIRLILLESRHD-
KTHY_CHLPD       KSTQIKKLQTVLNKAGV-------------ESVTLREPGG--TEVAEKIRSILLESRHE-
KTHY_CHLTE       KSTQVMKLKRYLQERGR-------------EVLALREPGG--TPVAEEIRELLLERRND-
KTHY_CHLCH       KSTQVAKLVAYLKQQST-------------PLLSLREPGG--TPTAESIRSLLLDNRKS-
KTHY_DEHMB       KSTQSKALYRYLKKKGL-------------GCVLTHEPGG--SKSGDKITRLLKWSKEEH
KTHY_DEHMC       KSTQSKALYRYLKKLGL-------------GCVLTHEPGG--SKSGDKITRLLKWSKEEH
KTHY_DEHM1       KSTQSKALYRYLKKLGL-------------GCVLTHEPGG--TRSGDKITRLLKWSEEEN
KTHY_NOSS1       KTSQMQLCAEWLQSLGI-------------SVVLTREPGG--TELGLDLRRLLLQKAED-
KTHY_TRIV2       KTSQMQLCAEWLQNLGI-------------SVILTREPGG--TELGVDLRRLLLQKAED-
KTHY_ACAM1       KTTQLNLVFEWLTGSGWTNRIKGYIQGDYPSVLTTREPGG--TALGKSIRKLLLDVTATG
KTHY_TRIEI       KTTQIELLQDWLLETGESRQILPKSIDLDLEVVITREPGG--TKLGKALRELLLSPDVLA
KTHY_THEEB       KTTQMGAIATWLENSGWLAKLRSCHVD--PPLLLTREPGG--TPLGQGLRQLLLHSDLA-
KTHY_SYNSC       KTTQIQHLLEWLPNSGLMPK--------GAAVVCTREPGG--TPLGRSIRELLLHTSDQ-
KTHY_SYNPX       KSTQLDHLLGWLPGSGLMPA--------GAELISTREPGG--TPLGRSVRELLLHTRAE-
KTHY_SYNS9       KSTQIRHLAQWLPASGLMPS--------TAQLICTREPGG--TPLGQSIRELLLHTEAD-
KTHY_PROMM       KTTQLRHLANWLPRSGLMPE--------GARLHLTREPGG--TALGIALRKLVLHPPGD-
KTHY_PROM3       KTTQLRHLANWLPRSGLMPE--------GARLHLTREPGG--TALGMALRKLVLHPPGD-
KTHY_SYNPW       KTTQLRQLAEWLPDSGLMPE--------GATLHLTREPGG--TPLGRALRELLLHPPDE-
KTHY_SYNR3       KTTQLKALADWLPASGLMPS--------GAQLITTREPGG--TALGQALRQLLLHPPEE-
KTHY_SYNS3       KTTQLQQLSSWLPKSGLMPD--------ESRLVVTREPGG--TALGTSLRQLLLHPPQD-
KTHY_PROMT       KTTQINQLSKWLISSDLIPE--------NNKLVITREPGG--TKLGKSIRSLLLDTSIE-
KTHY_PROM1       KTTQINQLSKWLISTDLIPE--------NNKLVITREPGG--TQLGKSIRSLLLDTSIE-
KTHY_PROMA       KSTQIEHLAQWLPLSGLMPS--------AAKLFITREPGG--TRLGKSLRQLLLGTSPTD
KTHY_PROMS       KTTQIDELSKWLPNSGLIKK--------GSKLITTREPGG--SLLGKKLRGLILDNNKN-
KTHY_PROM0       KTTQIDELSKWLPISGLLKK--------ESKLITTREPGG--SLLGKKLRRLILDNNEN-
KTHY_PROM9       KTTQINELSKWLPKSGLIKK--------GSKLITTREPGG--SLLGKKLRGLILDNNKT-
KTHY_PROM2       KTTQIDELSKWLPSSGLIKK--------GSKLITTREPGG--SHLGKRLRGLILDNNQN-
KTHY_PROM5       KTTQIDEISRWLPTSGLMGK--------NSKLIKTREPGG--SLLGKKLRNLILDNNKN-
KTHY_PROMP       KTTQIDEISKWIPTSGLLRG--------KQKLVKTREPGG--SLLGKKIRNLILDNHKD-
KTHY_CARHZ       KTTQIQYIARYLTEKNI-------------PHIITREPGG--TALGKKIRELLLNPSYP-
KTHY_THET8       KTTQARRLAAFLEAQGR-------------PVLLTREPGG--G--LPEVRSLLLTQ----
KTHY_THET2       KTTQARRLAAFLEAQGR-------------PVLLTREPGG--G--LPEVRSLLLTQ----
KTHY_DEIRA       KTTQLARLEARLRAAGH-------------AVTVTREPGG--TPLGTRVREVVLDPA---
KTHY_CLAMS       KSTQSALLREWLEEQGH-------------EVVVTREPGG--SDLGQEIREIVLHR--RG
KTHY_CLAM3       KSTQSALLRGWLEDEGH-------------EVVVTREPGG--SELGVEIREIVLHR--RG
KTHY_LEIXX       KSTQAALLERWLLGLGR-------------AVVRTREPGG--TDLGAEIREIVLHR--RG
KTHY_BIFLO       KTTQVERLRAYLEAQGR-------------TVVVTREPGG--TALGKAIRQLLLHGVDGG
KTHY_BIFAA       KTTQVERLRAYVESQGR-------------ECVVTREPGG--TALGVAIRKMLLHGVDTG
KTHY_CUTAK       KTTQARLLDQWLTTEGI-------------PHLMTREPGD--SWLGQRIRELVLSP-GSG
KTHY_DESVH       KSTALQGLAAWLQQRGH-------------GVAVTREPGG--SRLGRTLRSILLDLGNTD
KTHY_DESVV       KSTALQGLAAWLQQHGH-------------GVAVTREPGG--SRLGRTLRSILLDLGNTD
KTHY_DESAG       KSTALARLKDWLQEHGH-------------GATLTREPGG--SRLGGILRSILLDIGNDD
KTHY_LAWIP       KTTLINRLSEYFSSRGE-------------DVIVTREPGG--CELGGLLRSLVLSS-ELG
KTHY_GLOVI       KTTQLTLLGDWLEKRCH-------------RVVRTREPGG--TALGRSLRGLLLDA-RSE
KTHY_LACSS       KTSALEAVVARLQKEVSQEIVV------------TREPGG--NPISEQIRQIILDVKNTA
KTHY_LACPL       KTSALNAIVAKLQPQLGDRLVV------------TREPGG--NQISEAIRKIILDRHNTA
KTHY_LACBA       KTSALQAITTQIKPVLGDQLVI------------TREPGG--NPISESIRAIILDRANTA
KTHY_PEDPA       KTTVLQAMVEHYQQRLKDQLTV------------TREPGG--NPISEAIRTIILDKNNTE
KTHY_LACP3       KTSVLKTLIPQLEQHVRVPLHL------------TREPGG--AKISETIREVILDPANTA
KTHY_ENTFA       KTSVLKEVSERLAKESKRKIVT------------TREPGG--IPIAEKIRTVILDPRNDR
KTHY_LACS1       KTSVLKGVIEHLNDKRIDNYIW------------TREPGG--NRISEAIRKIILNVEYTE
KTHY_LEUMM       KTSVLEALISELKTKLGDDLVT------------TREPGG--NPISEAIRSILQPEEDNG
KTHY_LACRD       KTSVIQQIQLELEDQLGTEKVMY-----------TREPGG--NKISEQIRQVLFDGQNTD
KTHY_OENOB       KTSLLDNLMPALRDIFGDNLIE------------TREPGG--VRISEAIRKIVLGLKYPE
KTHY_STRA5       KTTVLEAVLPLLREKLSQDILT------------TREPGG--VTISEEIRHIILDVKHTQ
KTHY_STRA3       KTTVLEAVLPLLREKLSQDILT------------TREPGG--VTISEEIRHIILDVKHTQ
KTHY_STRA1       KTTVLEAVLPLLREKLSQDILT------------TREPGG--VTISEEIRHIILDVKHTQ
KTHY_STRTD       KTSVLKVLLPRLREVYPAQVIT------------TREPGG--VAIAEQIREVILDIDNTA
KTHY_STRT2       KTSVLKVLLPRLREVYPAQVIT------------TREPGG--VAIAEQIREVILDIDNTA
KTHY_STRT1       KTSVLKVLLPRLREVYPAQVIT------------TREPGG--VAIAEQIREVILDIDNTA
KTHY_STRMU       KTTVLEAILPQLKKLVAKEVIT------------TREPGG--VAIAESIRDLILDVNHTN
KTHY_STRPG       KTTVLEQLIPPLKQKVAQEILT------------TREPGG--VAISEYIRELILDINHTT
KTHY_STRP8       KTTVLEQLIPPLKQKVAQEILT------------TREPGG--VAISEYIRELILDINHTT
KTHY_STRP3       KTTVLEQLIPLLKQKVAQEILT------------TREPGG--VAISEYIRELILDINHTT
KTHY_STRP6       KTTVLEQLIPLLKQKVAQEILT------------TREPGG--VAISEYIRELILDINHTA
KTHY_STRP1       KTTVLEQLIPLLKQKVAQDILT------------TREPGG--VAISEHIRELILDINHTA
KTHY_STRGC       KSSVLEALVPILEAQ-GHQVVT------------TREPGG--VPISEAIREVILDQNNTE
KTHY_STRSV       KSSVLEALLPFLQNY-GTGLIT------------TREPGG--VQIAEAIREVILEPSHTA
KTHY_STRP2       KTSVLEALLPILEEK-GVEVLT------------TREPGG--VLIGEKIREVILDPSHTQ
KTHY_STRR6       KTSVLEALLPILEEK-GVEVLT------------TREPGG--VLIGEKIREVILDPSHTQ
KTHY_STRPN       KTSVLEALLPILEEK-GVEVLT------------TREPGG--VLIGEKIREVILDPSHTQ
KTHY_LACLM       KTTVLQEILPEIQKM-KREVVP------------TREPGG--VRVAEEIRQIILDPKNTE
KTHY_LACLS       KTTVLQEILPEIQKM-KREVVP------------TREPGG--VRVAEEIRQIILDPKNTE
KTHY_LACLA       KTTVLKEILPEIQKM-KREIVP------------TREPGG--VRVAEEIRQIILDPKNTD
KTHY_LACH4       KSTVLKEVLDQIGPKLKPQYLV------------TREPGG--SKIAEKIRDIILDPANDK
KTHY_LACAC       KSTVLKEVLAEIAPQLKTQYLV------------TREPGG--SKIAEKIRDIILDPANDK
KTHY_LACDB       KTTVINEVVKAIQGQCKREILV------------TREPGG--SKIAEKIRDIILDPANTE
KTHY_LACDA       KTTVINEVVKAIQGQCKREILV------------TREPGG--SKIAEKIRDIILDPANTE
KTHY_LACJO       KTTVINEIIKQLPQSLQERTLV------------TREPGG--SKISENIRTIILDPENKE
KTHY_CLONN       KTTIVKMIEKYLSENNIEYIST-------------REPGG--INISEQIRDVILNKDNVA
KTHY_CLOB8       KTTAIDAIYDWITENNFECIKT-------------REPGG--IKISEQIRQVILSKDNKE
KTHY_BACHD       KTSALDAIEEMLRENGLSVVRT-------------REPGG--IPIAEQIRSIILDVDHTR
KTHY_BACVZ       KTTVLQEMKEILSAEGLPVTAT-------------REPGG--IDIAEQIREVILNKNNTL
KTHY_BACSU       KTTVLQEIKNILTAEGLQVMAT-------------REPGG--IDIAEQIREVILNENNIL
KTHY_BACLD       KTTILQAAADQLTKNGHSVLAT-------------REPGG--IEISERIREVILNPSHTA
KTHY_BACP2       KTTVIRKVHEEMERQGYAVMAT-------------REPGG--IDIAEQIREVILNEKNTK
KTHY_BACHK       KTTLIQSLLPYFEQKEQKVMAT-------------REPGG--IAISEDIRTILHKQEYTM
KTHY_BACAN       KTTLIQSLLPYFEQKEQKVMAT-------------REPGG--IAISEDIRTILHKQEYTM
KTHY_BACCZ       KTTLIQSLLPYFEQKEQKVMAT-------------REPGG--IAISEDIRTILHKQEYTM
KTHY_BACAH       KTTLIQSLLPYFEQKEQKVMAT-------------REPGG--IAISEDIRTILHKQEYTM
KTHY_BACC1       KTTLIQGLLPYFEQKEQKVMAT-------------REPGG--IAISEDIRTILHKQEYTM
KTHY_BACCR       KTTLIKSLLPYFEQKAQKVMAT-------------REPGG--IAISEDIRTILHKQEYTM
KTHY_BACCN       KSTLITKLLPYFENKGQKVIAT-------------REPGG--IAISEEIRTILHKKEYTT
KTHY_OCEIH       KTTVIQHIFQKLIAQGIDVIQT-------------REPGG--IKISEKIRSIIHDPEHLE
KTHY_GEOTN       KTTMIGKLESFLRERGFDVMVT-------------REPGG--VRIAEAIRALILNREYTE
KTHY_GEOKA       KTTMISKLESLLRERGIDVVAT-------------REPGG--VRIAEAIRSIILNRDYTE
KTHY_BACSK       KTTIINLVQEQLATQGYEVIRT-------------REPGG--VELAEQIRDLLLHTQGVE
KTHY_STAAN       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAAM       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAAC       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAA9       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAA3       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAAR       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAA2       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAA8       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAA1       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAAB       KTTVINEVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAAS       KTTVINKVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAAW       KTTVINKVYHRLV-KDYDVIMT-------------REPGG--VPTGEEIRKIVLEGND--
KTHY_STAS1       KTTVIQQVAQKLE-NQYSVVLT-------------REPGG--VKTGEQIREVLLEGDD--
KTHY_STAHJ       KTTVLQRVSEKLA-QDYQLIAT-------------REPGG--VPTGEEIRKVVLEGAN--
KTHY_STAES       KTSVIKKVSERLA-KEYDIVTT-------------REPGG--VLTSEEIRRIVLDGDS--
KTHY_STAEQ       KTSVIKKVSERLA-KEYDIVTT-------------REPGG--VLTSEEIRRIVLDGDS--
KTHY_LISMF       KTTVGTLLNQKMTEAGIDFIKT-------------REPGG--SPISEKVRNIVLGIGNEE
KTHY_LISMO       KTTVGTLLNQKMTEAGIDFIKT-------------REPGG--SPISEKVRNIVLGIGNEE
KTHY_LISIN       KTTVGTLLNQKMEEAGIDFIKT-------------REPGG--SPISEKVRNIVLGIGNEE
KTHY_LISW6       KTTVGTLLNQKMEEAGIDFIKT-------------REPGG--SPISEKVRNIVLGIGNEE
KTHY_MYCMS       KTTTLLKVKEELERLNYQVLIT-------------REPGG--EAIAEQIRQIILDNKNRD
KTHY_MYCCT       KTTALLKVKEELERLNYKVLIT-------------REPGG--EVIAEQIRQIILDNKNKD
KTHY_MESFL       KTTALQRVKQYLEDLNYKVVMT-------------REPGG--LPLSEKIRELILNKDGVG
KTHY_ONYPE       KTTHSRYL-FEKLSKKYSCVLT-------------KEPGG--GLFNEVIRNILLHSSNKQ
KTHY_AYWBP       KTTHSSYL-FEKLSKKYSCVLT-------------KEPGG--GLFNEVIRNILLHSYNKQ
KTHY_ACHLI       KTTLIEKLKHTLLEKKYDVLTT-------------REPGG--SKVAEKIRSVLLDNKNTE
KTHY_TROWT       KTAQLTAAGEFLKASGKQVVLT-------------REPG-----TISCIRDYVL---ASD
KTHY_TROW8       KTAQLTAAGEFLKASGKQVVLT-------------REPG-----TISCIRDYVL---ASD
KTHY_CHLCV       KSSLTELLKDRLIAEGK-------------AVVATREPGG--SPLGERVRDLILE-PSTP
KTHY_CHLFF       KSSLTELLKNRLITEGK-------------SVIATREPGG--SPLGEQVRNWILN-PSLP
KTHY_CHLAB       KSSLTQLLKDKLMAEGK-------------AVVATREPGG--SSLGERVRDWILD-PSTT
KTHY_CHLPN       KSSLAKALGDQLVAQDR-------------KVLLTREPGG--CLIGERLRDLILE-PPHL
KTHY_CHLTR       KTQFIQALSKRLIEEGR-------------EIVTTREPGG--CSLGDSVRGLLLD-PEQ-
KTHY_CHLTA       KTQFIQALSKRLIEEGR-------------EIVTTREPGG--CSLGDSVRGLLLD-PEQ-
KTHY_CHLMU       KTQFTQALSKRLMEEGK-------------EVVLTREPGG--SALGEQLRDLVLD-VTQ-
KTHY_PARUW       KSTLLNQLGDYFRNKGF-------------EVIQTREPGG--TKLGESIRHLLLNHEDSI
KTHY_PSEPF       KSTNREYLAERLRAA-------------GIEVVLTREPGG--TPLAERIREVLLAPV---
KTHY_PSEF5       KSTNREYLAERLRAA-------------GIEVLLTREPGG--TPLAERIRDVLLTPV---
KTHY_PSEPG       KSTNRDYLAARLREH-------------GLDVVLTREPGG--TPLAERVRELLLAPS---
KTHY_PSEP1       KSTNRDYLAARLREH-------------GLDVVLTREPGG--TPLAEKVRELLLTPS---
KTHY_PSEE4       KSTNREYLAARLREQ-------------GVDVVMTREPGG--TPLAERIRELLLAPS---
KTHY_PSEMY       KSTNREYLAERLREQ-------------GVDVVLTREPGG--TPLAERIRELLLDPS---
KTHY_PSEU5       KSTNREYLAERLRAR-------------GLDVVLTREPGG--TPLAERIRELLLTPA---
KTHY_PSEAE       KSTNRDYLAERLRER-------------GIEVQLTREPGG--TPLAERIRELLLAPS---
KTHY_PSEA7       KSTNRDYLAERLRER-------------GVEVQLTREPGG--TPLAERIRELLLAPS---
KTHY_PSEAB       KSTNRDYLAERLRER-------------GIEVQLTREPGG--TPLAERIRELLLAPG---
KTHY_PSESM       KSTNRDYLAAQLRAQ-------------GVQVLLTREPGG--TPLAERIRELLLAPS---
KTHY_PSEU2       KSTNRDYLAAQLRAQ-------------GVQVLLTREPGG--TPLAERVRELLLAPS---
KTHY_PSE14       KSTNREYLAAQLRAQ-------------GVQVLLTREPGG--TPLAERIRELLLAPS---
KTHY_ALCBS       KSSNLVWLAEALRAE-------------GKTVMVSREPGG--TALAESIREVLLAPS---
KTHY_CHRSD       KSTNVAFVCDWLSAR-------------GIEVVRTREPGG--TPRAEAIRELLLDPAP--
KTHY_METCA       KSTNVDFVVSRLRAR-------------GLKVVATREPGG--TAFGEAVREIFLR-----
KTHY_ALKEH       KSTALTRVREYLQRQ-------------GIDAVMTREPGG--TPLGERIRALLLGQS---
KTHY_VESOH       KSTQIDFICSYLAKK-------------NINVVLTREPGG--TKLGEKIRALLLSID---
KTHY_RUTMC       KSTQIDFICDYLVTK-------------KINVILTREPGG--TELGEKIRTLLLSTD---
KTHY_MARMS       KTTAIHFIRQWLDDH-------------KIPYIMTREPGG--TPLAEEIRQLVLTPR---
KTHY_COXBU       KTTALNWVREQLDAA-------------RIPYVVTREPGG--TPIAEAIRDVLLSHS---
KTHY_NITEU       KSTHLAWLERFLQDK-------------GLEVVVTREPGG--TALGEALRQLLLDHR---
KTHY_NITEC       KSTHLAWLASFLRDK-------------GLEVIVTREPGS--TALGEQLRQLLLDHR---
KTHY_NITMU       KTTHLRWLEYFLKER-------------GKNVMVTREPGG--TPLGEALRDILLDSR---
KTHY_BORBR       KSTHTAWMVQALRDL-------------GLTVLATREPGG--TPVGEKLRELLLS-----
KTHY_BORPE       KSTHTAWMVQALRDL-------------GLTVLATREPGG--TPVGEKLRELLLS-----
KTHY_BORPA       KSTHTAWMVQALRDL-------------GLTVLATREPGG--TPVGEKLRELLLS-----
KTHY_DECAR       KSSHVEWLAGLLRQR-------------GIVVHVTREPGG--TELGEKLRELLLN-----
KTHY_BURCH       KTTHLQWFCERLQGRLAA---------AGRQVVVTREPGG--TQLGEKLREILLN-----
KTHY_BURCA       KTTHLQWFCERLQGRLAA---------AGRQVVVTREPGG--TQLGEKLREILLN-----
KTHY_BURCM       KTTHLQWFCERLQAKLAA---------GGRQVVVTREPGG--TQLGEKLREILLN-----
KTHY_BURL3       KTTHLQWFCERLQGKLAA---------AGRQVVVTREPGG--TQLGEKLREILLN-----
KTHY_BURVG       KTTHLQWFCERLQAKLAA---------GDRQVVVTREPGG--TPLGEALREMLLN-----
KTHY_BURM9       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURP6       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURMS       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURM7       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURMA       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURP1       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURPS       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURP0       KTTHLQWFCDRLQERLGP---------TGRHVVVTREPGG--TQLGETLREILLN-----
KTHY_BURTA       KTTHLQWFCDRLQERLGP---------AGRHVVVTREPGG--TRLGETLREILLN-----
KTHY_PARXL       KTTHLSWFRERLEQKVAS---------TGRSVVMTREPGG--TPLGEQIREIVLH-----
KTHY_RALSO       KSTHLAWFAQQLEARLAP---------QGRKVVVTREPGG--TPLGERLREVLLH-----
KTHY_HERAR       KSTHLSFVADLLRAS-------------KKNVVVTREPGG--TSLGEALRTILLH-----
KTHY_JANMA       KSTHLSFVAELLCER-------------KKTVVVTREPGG--TSLGEELREILLH-----
KTHY_NEIG1       KSTNLAVIKAWFERR-------------GLPVLFTREPGG--TPVGEALREILLNPE---
KTHY_NEIMB       KSTNLAVIKAWFERR-------------GLPVLFTREPGG--TPVGEALREILLNPE---
KTHY_NEIMA       KSTNLAVIKAWFERR-------------GLPVLFTREPGG--TPVGEALREILLNPE---
KTHY_NEIMF       KSTNLAVIKAWFERR-------------GLPVLFTREPGG--TPVGEALREILLNPE---
KTHY_CHRVO       KSTHLSFIRDWLARH-------------GVDAAFTREPGG--TPLSEKIRDLLLDPG---
KTHY_HALHL       KTTCLQAIEQMLLEA------------GIDRPLFTREPGG--TPFGEALRGALLDPQ---
KTHY_DICNV       KSSQIQAICSFLQQH-------------GKTVITTREPGG--TQIGEAIRELVLSPH---
KTHY_ACISJ       KSSHIDALAQALRAA-------------GHTVALTREPGG--TPLAEKLREMLL------
KTHY_ACIAC       KSSHIEAVAEALRRE-------------GRTVTVTREPGG--TPLAETLRSLLL------
KTHY_RHOFT       KSTHIDALAQAFRAQ-------------GRAVTLTREPGG--TPLAEKLRVLVL------
KTHY_POLSJ       KSTHIAGLADAFRAQ-------------GRAVTLTREPGG--TPLAEKLRDLVL------
KTHY_VEREI       KSSHVEGLAAAFRAQ-------------GRRVTVSREPGG--TPLAEKLRALLL------
KTHY_ACIAD       KTTLIRKLYEHFEAS-------------GKQVVLTREPGG--TPLAEQIRSLLLAVNH--
KTHY_SALTY       KTTARDVVVETLEQLGIR------------NMIFTREPGG--TQLAEKLRSLVLDIRSVG
KTHY_SALTI       KTTARDVVVETLEQLGIR------------NMIFTREPGG--TQLAEKLRSLVLDIRSVG
KTHY_SALPA       KTTARDVVVETLEQLGIR------------NMIFTREPGG--TQLAEKLRSLVLDIRSVG
KTHY_SALCH       KTTARDVVVETLEQLGIR------------NMIFTREPGG--TQLAEKLRSLVLDIRSVG
KTHY_SALPB       KTTARDVVVETLEQLGIR------------NMIFTREPGG--TQLAEKLRSLVLDIRSVG
KTHY_SALAR       KTTARDVVVETLEQLGIR------------NMIFTREPGG--TQLAEKLRSLVLDIRSVG
KTHY_ECOUT       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECOK1       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECOL6       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_SHIDS       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_SHIBS       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECOHS       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_SHIFL       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_SHIF8       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECOLC       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECOLI       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_SHISS       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECO24       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECOL5       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ECO57       KTTARNVVVETLEQLGIR------------DMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_CITK8       KTTARNVVVETLEQLGIH------------DMIFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_ENT38       KTTARNVVVDTLKELGIE------------QMVFTREPGG--TQLAEKLRSLVLDIKSVG
KTHY_KLEP7       KTTARQLVVETLQSAGIH------------DMVFTREPGG--TILAEKLRSLVLDIQSTG
KTHY_CROS8       KTTARNLVVETLKSLGVT------------DMTFTREPGG--TVLAEKLRSLVLDIKSVG
KTHY_YERP3       KTTARDTVVAVLRAQGIN------------DIVFTREPGG--TPLAEKLRDLIK--QGID
KTHY_YERPS       KTTARDTVVAVLRAQGIN------------DIVFTREPGG--TPLAEKLRDLIK--QGID
KTHY_YERPA       KTTTRDTVVAVLRAQGIN------------DIVFTREPGG--TPLAEKLRDLIK--QGID
KTHY_YERPP       KTTTRDTVVAVLRAQGIN------------DIVFTREPGG--TPLAEKLRDLIK--QGID
KTHY_YERPN       KTTTRDTVVAVLRAQGIN------------DIVFTREPGG--TPLAEKLRDLIK--QGID
KTHY_YERPE       KTTTRDTVVAVLRAQGIN------------DIVFTREPGG--TPLAEKLRDLIK--QGID
KTHY_YERE8       KTTARDTVVATLRAQGIN------------DIVFTREPGG--TPLAEKLRDLIK--QGID
KTHY_SERP5       KTTARDTVVDVLREHGIN------------DIAFTREPGG--TPLAEKLRDLFK--RGVE
KTHY_PHOLL       KTSAMKTIVEMLQQHGIQ------------NLIFTREPGG--TPLAEKLRGLIK--QGVE
KTHY_PECAS       KTTARNIVVETLRSHGVK------------EVLFTREPGG--TPLAEKLRELIK--QGMA
KTHY_SODGM       KTSAIAQVVDVLREQGIR------------DVVFTREPGG--TPLAEALRTLIK--DGVG
KTHY_VIBC3       KSTAIQVVVETLQQNGID------------HITRTREPGG--TLLAEKLRALVK--EEHP
KTHY_VIBCH       KSTAIQVVVETLQQNGID------------HITRTREPGG--TLLAEKLRALVK--EEHP
KTHY_VIBPA       KSTAIKTVLDTLKQAGIE------------NIVNTREPGG--TPLAEKMRALVK--EEHE
KTHY_VIBCB       KSTAIKTVLDTLKAAGIE------------NIVNTREPGG--TPLAEKMRGLVK--EEHE
KTHY_VIBVY       KSTAIQTVLDTLRQAGIN------------EIAQTREPGG--TPLAEKMRALVK--EEHP
KTHY_VIBVU       KSTAIQTVLDTLRQAGIN------------EIAQTREPGG--TPLAEKMRALVK--EEHP
KTHY_ALIF1       KSTAIKNVLATLAKHGIT------------SPVTTREPGG--TPLAEKMRELVK--QGHP
KTHY_PHOPR       KSTAIQQVIDALAAHGIE------------NPESTREPGG--TPLAEQMRALIK--EGHP
KTHY_HAES1       KSSTHQVVVNTLKEFGIH------------EVVFTREPGG--TPLAEKLRYLIK---HEV
KTHY_HISS2       KSSTHQVVVNTLTEFGIH------------EVVFTREPGG--TPLAEKLRYLIK---HEA
KTHY_MANSM       KTTARQAVVEQLNALGIT------------DLLFTREPGG--TPLAEKLRNLIK---YET
KTHY_HAEIN       KSSAHQSVVRVLHELGIQ------------DVVFTREPGG--TPLAEKLRHLIK---HET
KTHY_PASMU       KTTARDSIVRALHAHGIH------------DIVFTREPGG--TPLAEKLRQLIK---HET
KTHY_HAEDU       KTTAHQIILTQLKQAGIQ------------QIVQTREPGG--TPLAEKLRYLIK---HEF
KTHY_WIGBR       KTNAISKIVNLLNKQGIK------------NVIFTREPGG--TPLAESLRTLIK--EGVG
KTHY_BAUCH       KTSVIQQIITILHSNGIH------------NIISTRDPGG--TPLAETIRDIIK--KGMN
KTHY_SHESR       KSSAIALIRDFIEKHTGL------------APVCTREPGG--TPLAERIRDLVK--IADP
KTHY_SHESM       KSSAIALIRDFIEKHTGL------------APVCTREPGG--TPLAERIRDLVK--IADP
KTHY_SHESA       KSSAIALIRDFIEKHTGL------------APVCTREPGG--TPLAERIRDLVK--IADP
KTHY_SHEON       KSSAIALIRDFIEKHTGH------------APVCTREPGG--TPLAERIRDLVK--IADP
KTHY_SHELP       KSSAIALVRDFIEKHNGV------------PPVCTREPGG--TPLAERIRDLVK--IADP
KTHY_SHEFN       KSSAIALVNDIIKQHIGQ------------APVCTREPGG--TPLAEKMRDLVK--IADE
KTHY_SHEAM       KSSAITLVHDFIEKHTGM------------APVCTREPGG--TPLAEKIRDLVK--NAEP
KTHY_PSEHT       KSTAIALCQSFLNSKKI-------------DFINVREPGG--TPLAESLRTLVKA---QH
KTHY_COLP3       KSSAIAVIESTLNKHGI-------------EYINTREPGG--TPLAESLRDMVKSV--DH
KTHY_IDILO       KSSAIASVVTHLQAKGI-------------QVETVREPGG--TPLAESLRDLVKK---KW
KTHY_LEGPH       KSTAVNLVVELLSQKKIS------------TI-TTREPGG--TKIGEILRSIIK--NPEY
KTHY_LEGPL       KSTAVNLVVELLSQKKIS------------TI-TTREPGG--TKIGEILRSIIK--NPEY
KTHY_LEGPA       KSTAVNLVVELLSQKKIS------------TI-TTREPGG--TRIGEILRSIIK--NPEY
KTHY_LEGPC       KSTAVNLVVELLSQKKIS------------TI-TTREPGG--TRIGEILRSIIK--NPEY
KTHY_BLOPB       KTTITHRVSKYLNQYGVT------------DILTTHEPGG--TPVSDFLRVLIKY-GGPM
KTHY_BLOFL       KTTIVHKIVKYFYNQKIT------------NVITTHEPGG--TEIAYILSELIK--NKSK
KTHY_BUCAI       KTNACICIKNLLKKNSIK------------NVLLVRQPGS--TPIAEDIRRLIK--KKFN
KTHY_BUCAP       KTHACICVQRILKENNIK------------NVILVRQPGS--TPVAEKIRKLIK--NNTY
KTHY_BUCBP       KTTICKTLKNILYEHGIK------------NVICVRDPGS--TPLAEKIRSLLI--TKDK
KTHY_FRAT1       KSTAISFVRKYLEKNNL-------------AAIYTREPGG--TKIAEELRNLVL--HNKY
KTHY_FRATW       KSTAISFVRKYLEKNNL-------------AAIYTREPGG--TKIAEELRNLVL--HNKY
KTHY_FRATT       KSTAISFVRKYLEKNNL-------------AAIYTREPGG--TKIAEELRNLVL--HNKY
KTHY_FRATN       KSTAISFVRKYLEKNNL-------------AAIYTREPGG--TKIAEELRNLVL--HNKY
KTHY_FRATF       KSTAISFVRKYLEKNNL-------------AAIYTREPGG--TKIAEELRNLVL--HNKY
KTHY_FRATH       KSTAISFVRKYLEKNNL-------------AAIYTREPGG--TKIAEELRNLVL--HNKY
KTHY_FRATO       KSTAISFVRKYLEKNNL-------------AAIYTREPGG--TKIAEELRNLVL--HNKY
KTHY_WOLTR       KTIQSELLANYFKQIHG-----------ENNMVLTREPGG--TDFAEKVRGILLKDSI--
KTHY_WOLPM       KTTQSKLLANHFKQIRG-----------ENNVVLTREPGG--TNFAEKVRGVLLTNNI--
KTHY_EHRCR       KTTQSHLLAEYLSEIYG-----------VNNVVLTREPGG--TLLNESVRNLLFKAQG--
KTHY_EHRCJ       KTTQSHLLTEYLSKIYG-----------VNNVVLTREPGG--TLLNEAVRDLLFQAKG--
KTHY_EHRRW       KTTQSRLLTEYLSGVYG-----------VDNVILTREPGG--TFFNESVRNLLFSTKN--
KTHY_EHRRG       KTTQSRLLTEYLSGVYG-----------VDNVILTREPGG--TFFNESVRNLLFSTKN--
KTHY_ANAMM       KTTQAVLLAKYLSDLYG-----------EHRVVLTREPGG--TSLNELIRGALLGLTDYK
KTHY_ANAPZ       KTTQSILLAKYMSDLYG-----------EDNVVLTREPGG--TSFNELLRSVFLSVSDYK
KTHY_NEOSM       KSTQVKLLSKFLAKD-------------GYPCVLTREPGG--TSFAESLRSMILHDPI--
KTHY_RICRO       KSTQSQMLYEYLQSQ-------------NTPVILTREVGG--TIVAEKMREILVHEEL--
KTHY_RICRS       KSTQSQMLYEYLQSQ-------------NTPVILTREVGG--TIVAEKMREILVHEEL--
KTHY_RICCN       KSTQSQMLYEYLQSQ-------------NTPVILTREVGG--TIVAEKMREILVHEEL--
KTHY_RICM5       KSTQSQMLYEYLQSQ-------------NTPVILTREVGG--TIVAEKMREILVHEEL--
KTHY_RICFE       KSTQSQMLYEYLKSQ-------------NTPVILTREVGG--TAVAEKMREILVHEEL--
KTHY_RICCK       KSTQSQMLYEYLKSQ-------------NTPVILTREVGG--TIVSEKMREILVHEEL--
KTHY_RICAH       KSTQAQMLYEYLKSQ-------------NTHVILTREVGG--TAVAEKMRAILVHESL--
KTHY_RICPR       KSTQSKMLYEYLKSQ-------------KIPVILTREVGG--TTVAEKMREILVNEEL--
KTHY_RICTY       KSTQSKMLYEYLKSQ-------------KIPVILTREVGG--TFVAEKMREILVHEEL--
KTHY_RICB8       KSTQCQMLYEYLKSQ-------------NIPVILTREVGG--TNVAEKMREILVHTDL--
KTHY_RICBR       KSTQCQMLYEYLKSQ-------------NIPVILTREVGG--TNVAEKMREILVHTDL--
KTHY_ORITB       KTTQSKLLYEKLLDN-------------GIKAVWTREIGG--TDIAELIRDIVLFKDM--
KTHY_MYCS5       KTTVINELLKKLKDNFK-----------FLDYVLTREPGGKDIKESEKIREMILDSDLE-
KTHY_MYCPU       KTSLLAKLKAHVVQKNL-----------QGKCTFTWEPGGRKSPEIQTIRHLILNKESN-
KTHY_UREPA       KTSILKQLLEVLKEPKL-----------VNKIFLTREPGGKNNNAAEMIREFFLKNLEV-
KTHY_UREP2       KTSILKQLLEVLKEPKL-----------VNKIFLTREPGGKNNNAAEMIREFFLKNLEV-
KTHY_MYCMO       KSTIIKKLKRKLPKLYP-----------DKKFVFTREPGGKKLKEAEKIRKILLDKKTN-
KTHY_MYCHJ       KSTVMDLFAKYLKIKFP-----------EKEIVTTFEPGGKNLKEALQIREFLLSKNNQ-
KTHY_MYCH2       KSTVMDLFAKYLKIKFP-----------EKEIVTTFEPGGKNLKEALQIREFLLSKNNQ-
KTHY_MYCH7       KSTVMDLFAKYLKIKFP-----------EKDIVTTFEPGGKNLKEALLIREFLLSKNNQ-
KTHY_MYCPN       KTVLLEAFKQRFPQSFL-----------GFKTLFSREPGG--TPLAEKIRALLLHEA---
KTHY_MYCGE       KTALIEGFKKLYPTKFL-----------NYQLTYTREPGG--TLLAEKIRQLLLNET---
KTHY_MYCGA       KSSFLKRMMNEHTMIN------------SQPIIYSREPGG--CDTSEAVRELIMKLSN--
KTHY_MYCPE       KSTVSKLVYQKLINFFNN----------KDSVILTREPGG--TEVGEKIREILVNYD---
KTHY_CAMJR       KSTQISLLKEIYK-----------------DAIFTLEPGG--TELGKHLREILL------
KTHY_CAMJE       KSTQISLLKEIYK-----------------DAIFTLEPGG--TELGKHLREILL------
KTHY_CAMJJ       KSTQISLLKEIYK-----------------DAIFTLEPGG--TELGKHLREILL------
KTHY_CAMJ8       KSTQISLLKEIYK-----------------DAIFTLEPGG--TELGKHLREILL------
KTHY_CAMJD       KSTQISLLKEIYK-----------------DAIFTLEPGG--TELGKHLREILL------
KTHY_CAMC1       KSTQIEILASKFS-----------------DAIVTKEPGG--TQLGVNLREILL------
KTHY_CAMHC       KSTQIELLKSVYNK----------------NYLITKEPGG--TLLGEKLREILL------
KTHY_SULDN       KSTQIAKLQEHFS-----------------DAIITKEPGG--TEAGKEIREIVL------
KTHY_HELHP       KSTQIQLLKAYYP-----------------QAVFTKEPGG--SIIGEHIRDLVLFAPK--
KTHY_HELPJ       KSTQVGLLKDRFK-----------------NALFTKEPGG--TRMGESLRRIAL------
KTHY_HELPY       KSTQVELLKDRFK-----------------NALFTKEPGG--TRMGESLRRIAL------
KTHY_HELPH       KSTQVGLLKDRFK-----------------NALFTKEPGG--TKMGESLRHIAL------
KTHY_HELAH       KSTQIELLKSAFQ-----------------NALFTKEPGG--TKIGETLRHIAL------
KTHY_METMA       KSTVAKKIQENPEIQVF-------------DPVFTREPTRG-TLTGTAVENAI-QSETD-
KTHY_METAC       KSTVAKKLQENSELRVF-------------EPVFTREPTRG-TLTGNAVENAI-QSDTD-
KTHY_METBF       KSTVAEKLQKNPEIKAF-------------KPVFTREPTRG-TLTGDAVEKAI-QSDTD-
KTHY_METBU       KSTITRFLNSHPAFA---------------NAVFTKEPTT--SWIGDAVYKAI-QSDTD-
KTHY_HALSA       KTTVWESLRA---SHDD-------------GVTFTAEPTD--SQYGQAVRRSESAADAD-
KTHY_HALMA       KTTVWERLRSD-DAVPS-------------ETVFTREPTD--TWYGDAVQRSIDNDDAD-
KTHY_NATPD       KSTAHAALRER--LTAE-------------ETTFTREPTD--SWYGSAVERSIGDADAD-
KTHY_METHJ       KSTLHKALGPY--LADL-------------NPVITCEPGS--TWIGEAVRRAI-REHAD-
KTHY_METLZ       KSTLYEGLKTR--LQDL-------------EPVFTKEPGS--PLVNSAVRREI-GANRD-
KTHY_METMJ       KSTLLARLREL--LADL-------------DPLFTREPGA--TWVGESVRRAI-AERMD-
KTHY_PYRAB       KTTQAKLLAEWFEEQG-------------WDVLLTKEPTD--TEFGRLIRELVLKNS---
KTHY_PYRHO       KTTQAKLLAEWFEDKG-------------YEVLLTKEPTD--SELGKLIRRIILEES---
KTHY_PYRFU       KTTQARLLARWFEDNG-------------FKVVLTKEPTD--TEFGKIIRKLVLEGS---
KTHY_THEKO       KSTQAKLLAEWFENRG-------------YEVVLTKEPTD--TPFGKLIRRLVLTGGKEG
KTHY_XANOR       KTTLARRLTTTLEAAG-------------ARVVLSKEPTN--GPWGTKLRQSAAT-----
KTHY_XANOM       KTTLARRLTTTLEAAG-------------ARVVLSKEPTN--GPWGTKLRQSAAT-----
KTHY_XANAC       KTTLARRLAATLDAAG-------------ARVVLSKEPTN--GPWGTQLRQSAAT-----
KTHY_XANC5       KTTLARRLATTLDAAG-------------ARVVLSKEPTN--GPWGTQLRQSAAT-----
KTHY_XANCP       KTTLARSLATLLEQAG-------------ARVVLSKEPTN--GPWGTQLRQSAAT-----
KTHY_XANC8       KTTLARSLATLLEQAG-------------ARVVLSKEPTN--GPWGTQLRQSAAT-----
KTHY_XYLFA       KTTLARSLALKLRGVG-------------LETVVSKEPTN--GPWGMLLRQSAAT-----
KTHY_XYLFT       KTTLARSLALKLRGVG-------------LETVVSKEPTN--GPWGTLLRQSAVT-----
KTHY_DESPS       KSTQIKMLANYLRSKG-------------LDVIASFEPTN--GPYGQKIRQLYTDR----
KTHY_LEPBJ       KSTLCKSLTEKLTERG-------------IPSVNFTEPTN--FETGKYLRKFLRGEI---
KTHY_LEPBL       KSTLCKSLTEKLTERG-------------IPSVNFTEPTN--FETGKYLRKFLRGEI---
KTHY_LEPIC       KSTLCKSLTEKLIELG-------------IPSAAFTEPTN--LETGKYLRKFLRGEI---
KTHY_LEPIN       KSTLCKSLTEKLIELG-------------IPSAAFTEPTN--LETGKYLRKFLRGEI---
KTHY_ARCFU       KTTIAAYIAELLKEKG-------------YKVKVLKEPGD--SKFGKKIKS---SEE---
KTHY_PYRCJ       KTTVIAEVAKALP-----------------RVYVTREPSG--GPIGRLLKEWALR-----
KTHY_PYRAE       KSTVISLLEKKLP-----------------RVYATREPSS--GPIGRLIKEWALK-----
KTHY_STAMF       KTSIAFKLRDFLV-----------------EKGFNVHYTY--EPYNTLYVEALKKKY---
KTHY2_SACS2      KSSQAVLLKDWIEMRR--------------DVYLTEWNSS--EWIHDIIKEAKKK-----
KTHY2_SULTO      KSSQATLLKDWIELKR--------------DVYLTEWNSS--DWIHDIIKEAKKK-----
KTHY_THEVO       KTTLAKSLSSLLEKEG-------------FRVFLTREPTD-------DIRNYEGD-----
KTHY_THEAC       KTTLARGIGNMLLGEG-------------YRVYMTKEPTD-------GMENYAGD-----
KTHY_PICTO       KTTLAGDIASYTGFY------------------LTREPTD--RFCYDYIEADYND-----
KTHY_SYNY3       KTTQGDLLLAHFQRQG-------------LAAVLSPEPTN--GPVGRLIRQALQGDLFTY
KTHY_METKA       KSSVVNLAAEFLEIHGL-------------EVTTVREPST---DIGREALEWD-------
KTHY_MYCTU       KRTLVEKLSGAFRAAGR-------------SVATLAFPRYGQSVAADIAAEALHGEHGDL
                 *                                                           

KTHY1_SACS2      --------DPILLVLLFAADREIHVNWL---SKI--KDADLIILDRYYFSSIAYQGAL--
KTHY_SULAC       --------DPISLALLFTADRAYHLNLL---FK---QNPEIIIMDRYIDSTIAYQSSL--
KTHY1_SULTO      --------DPVLLTLLFSADRAFHIKWI---ME---QKPEIVLMDRYFHSTIAYQSVL--
KTHY_METS5       --------DQVLLALLFSADRRIHVKWM---ES---QNVDLIISDRYFFSTLAYQGV---
KTHY_METM7       -----SKCQKETLALLFAADRVEHVSKI---EEDLK--KSHVVSDRYVYSSIVYQMSQ--
KTHY_METM5       -----SQCQKETLALLFAADRVEHVFNI---EEDLK--KSHVVSDRYVYSSIIYQISQ--
KTHY_METMP       -----SKCNKETLALLFAADRVEHVSKI---EEDLK--NAHVVSDRYVYSSIVYQMTQ--
KTHY_METVS       -----SECKKETLALLFAADRVEHVSEI---EKMLQ--KSHVVTDRYVYSSIIYQTMQ--
KTHY_META3       -----KNCEKESLALLFAGDRVEHIKEI---EHKLI--ENMVICDRYVYSSMVYQSIQ--
KTHY_METJA       -----TEVDNKTLALLFAADRIEHTKLI---KEELK--KRDVVCDRYLYSSIAYQSVA--
KTHY_METS3       -----TDRIQKTLGLLFAADRMLIMDKL---NDD----SKVILSDRSFISSLAYQEPA--
KTHY_METTH       -----TPDVQRMLALLFAADRLTLRSKI---EGDW--AEDVVVSDRCYYSSMVYQGPE--
KTHY_METST       -----SDTNQQMLALLFAADRLTLKDEI---NQVKNNQQKILISDRSFYSSITYQNST--
KTHY_BDEBA       PT-------PRTELLLYEASRSQHVDQV---IRPALAAGTWVLCDRFAASSVAFQSG---
KTHY_RHOBA       MH-------RRTEAMLFMASRCEMIEST---LRSALADGVTVISDRFLLANVVYQSV---
KTHY_GEOSL       MV-------PTTELLLYAAARAQHVAEV---IAPALAEGAVVLCDRFTDSTLVYQGF---
KTHY_GEOUR       MT-------PTTELLLYAAARAQHVQEI---VKPALAANKVVLCDRFTDATIAYQGY---
KTHY_PELPD       IS-------PMTELLLYAAARAQHVSEV---IIPALKQGNIVLCDRFSDATLAYQGS---
KTHY_PELCD       LD-------PKAELLLYAAARAQHVAEV---IRPALDQGKIVLCDRYCDATLAYQGY---
KTHY_MAGMM       LD-------GTSELLLILAARHEHIRQV---IRPALASGHWVLCDRFEDSTLAYQGG---
KTHY_AGRFC       FG-------VRMEAILFAAARNDHVEEV---IRPALARGEIVLCDRFLDSSRVYQGT---
KTHY_RHIME       FG-------VRMEAILFAAARSDHVEEV---IRPALEQGTIVLCDRFMDSSRVYQGV---
KTHY_RHILO       FG-------PKMEALLFAAARSDHVEQV---IRPAVERGSIVLCDRFLDSSRVYQGV---
KTHY_BRUO2       YG-------PAMEALLFAAARADHVDQL---IRPTLAEGRIVLCDRFIDSSRAYQGV---
KTHY_BRUME       YG-------PAMEALLFAAARADHVDQL---IRPTLAEGRIVLCDRFIDSSRAYQGV---
KTHY_BRUSU       YG-------PAMEALLFAAARADHVDQL---IRPALAEGRIVLCDRFIDSSRAYQGV---
KTHY_BRUC2       YG-------PAMEALLFAAARADHVDQL---IRPALAEGRIVLCDRFIDSGRAYQGV---
KTHY_BRUSI       YG-------PAMEALLFAAARADHVDQL---IRPALAEGRIVLCDRFIDSSRAYQGV---
KTHY_BRASO       LG-------AEAETLLFAAARDDHVRNV---ILPALNQGSWVLCDRFFDSTRAYQGS---
KTHY_BRASB       LG-------AEAETLLFAAARDDHVRNV---ILPALSQGSWVLCDRFFDSTRAYQGS---
KTHY_NITHX       LG-------AYAETLLFAAARDDHVHTV---IKPALEQGIWVLCDRFADSTRAYQGR---
KTHY_NITWN       LG-------ADAETLLFAAARDDHVHTV---IKPALEQGIWVLCDRFADSTRVYQGQ---
KTHY_BRADU       LG-------PEAETLLFAAARDDHVHTV---IEPALKQGIWVLCDRFADSTRAYQGS---
KTHY_RHOPB       IGG------TEAETLLFAAARDDHVHTV---IEPALAQGSWVLCDRFTDSTRAYQGQ---
KTHY_RHOPA       IGG------ADAEALLFAAARDDHVRTL---IEPALARGEWVLCDRFYDSTRAYQGK---
KTHY_BARQU       NYG------PLIEVILLTAARIDHITEV---IAPSLQKGKIVLCDRFIDSTRVYQGL---
KTHY_BARHE       HYG------PLIEAILFTAARIDHVSEV---IMPSLQKGKVVLCDRFIDSTRVYQGL---
KTHY_CAUVC       WS-------PVTESLLMYAARRDHIERV---IRPGLARGAVVLCDRFADSTRAYQGA---
KTHY_JANSC       WS-------AETEILLFTAARRDHLERT---IRPALASGRDVVTDRFADSTRVYQGA---
KTHY_SPHWW       WN-------ARAEALLFAAARADHVART---IRPAIEAGRWVVCDRFLDSSIAYQGG---
KTHY_RHOS1       WD-------PMAELLLMTAARVQHVRRV---IAPALAQGRVVISDRYAGSTLAYQGT---
KTHY_RHOS4       WD-------PMAELLLMTAARVQHVRRV---IAPALAQGRVVISDRYAGSTLAYQGT---
KTHY_SYMTH       -------MSVITEALLFAAARAEHVSRT---IRPALEEGKVVICDRFVDSSLVYQGV---
KTHY_PELTS       -------LVPWAEALLYAAARAQHVAQV---ILPALREGKVVLCDRFTDSSLAYQGY---
KTHY_ROSCS       -------MAPTTETLLFSAARAQLVSEV---IRPYLEQGGIVLCDRYADSTYAYQGY---
KTHY_ROSS1       -------MAPTAEMLLFSAARAQLVSEV---IRPYLEQGGIVLCDRYADSTFAYQGY---
KTHY_DESRM       -------IQDRTEALLYSAARAQLVAQV---IRPQLEQGTVVLCDRYIDSTLAYQGY---
KTHY_THEMA       -------VTPKAELFLFLASRNLLVTE----IKQYLSEGYAVLLDRYTDSSVAYQGF---
KTHY_THEP1       -------MTPKAELFLFLASRNLLVME----IKRYLSEGYVVLLDRYTDSSVAYQGF---
KTHY_THEM4       -------MNKRSELLLFLASRAQLVEEV---IRPSIEKGYFVLADRFSDSSIAYQGG---
KTHY_FERNB       -------MCARSELLLFLASRAQLVESV---IKPALKNGKIVIADRFAHSSVAYQGC---
KTHY_AQUAE       -------LDERTELLLFEASRSKLIEEK---IIPDLKRDKVVILDRFVLSTIAYQGY---
KTHY_CALS4       -------IFPVTEMLLYASSRAQLVEEK---ILPALSKGQMVIVDRFIDSSYVYQGY---
KTHY_PELLD       -------ITPVGELLLFSASRAELVSEV---VRPALAEGKTVILDRFFDSTTAYQGY---
KTHY_CHLPM       -------ITPVGELLLFSASRAELVNEV---IRPALKEGTTVILDRFFDSTTAYQGY---
KTHY_CHLPD       -------ISAVGELLLFSATRAELVQQV---IIPALQTDAVVILDRFYDSTRAYQGY---
KTHY_CHLTE       -------ITPVGELLLFAASRAELVQQV---IQPALENDSDVILDRFFDSTTAYQGY---
KTHY_CHLCH       -------ITPIAELLLFSASRAELVETL---IRPALAEGKTVILDRFFDSTTAYQGH---
KTHY_DEHMB       -------ISPLTELLLFNASRSILIDNV---IKPALQDGKIVICDRYTDSTLAYQGY---
KTHY_DEHMC       -------ISPLTELLLFNASRSILIDNV---IKPALQDGKIVICDRYTDSTLAYQGY---
KTHY_DEHM1       -------ISPLAELFLFNASRSILIDNV---IKPALLDGNIVICDRYTDSTLAYQGY---
KTHY_NOSS1       -----KPIAEVTELLLYAADRAQHVAQE---LKPKLAQGKYILCDRYVDSTIAYQGY---
KTHY_TRIV2       -----KPIAEVTELLLYAADRAQHVAQE---LKPKLAQGKYILCDRYVDSTIAYQGY---
KTHY_ACAM1       N----ESIDERAELLLFAADRAQHVSSC---LLPHLQQGALVLCDRYTDSTIAYQGY---
KTHY_TRIEI       -----EKIQETSELLLYAADRAQHIEAL---IKPCLERGTIVLCDRFIDSTIAYQGY---
KTHY_THEEB       -------IDPLAELLLYAADRAQHVAMG---IRPQLQRGGIVLCDRYTASTVAYQGY---
KTHY_SYNSC       -----EAPAPTAELMLYAADRAQHVETL---IRPALERGDWVISDRFSGSTLAYQGY---
KTHY_SYNPX       -----QAPAPTAELLLYAADRAQHVERL---ILPTLERGDWVISDRFSGSTMAYQGY---
KTHY_SYNS9       -----QVPSVTAELLLYAADRAQHVDTV---IRPALLRGDWVLSDRFAGSTLAYQGY---
KTHY_PROMM       -----ASPEPLAELLLYAADRAQHVAQL---IRPALEQGHWVLSDRFSGSTLAYQGY---
KTHY_PROM3       -----ASPEPLAELLLYAADRAQHVAQL---IRPALEQGHWVLSDRFSGSTLAYQGY---
KTHY_SYNPW       -----AAPCPEAELLMYAADRAQHVQRR---ILPALACGDWVLSDRFSGSTLAYQGD---
KTHY_SYNR3       -----QAPATRAELLLYAADRAQHVQTR---LEPALAAGDWVLSDRYCGSTAAYQGY---
KTHY_SYNS3       -----ADPGPTAELLLYAADRAQHVDRV---IQPALERGDWVLSDRFTGSTMAYQGY---
KTHY_PROMT       -----KSPDSITELLLYAADRSQHINEI---IRPTLDQGDWVISDRFCGSTLAYQGY---
KTHY_PROM1       -----KSPDSITELLLYAADRSQHVNEI---IRPTLDQGDWVISDRFCGSTLAYQGY---
KTHY_PROMA       -----ESPKPLTELLLYAADRAQHVSQV---IQPKINNGDWVISDRFSSSTLAYQGF---
KTHY_PROMS       -----NKPSSLAELLLYSADRAEHVSKI---ISPALNNNDWVISDRFSDSTLAYQGY---
KTHY_PROM0       -----NKPSSLAELLLYSADRAEHVSKI---ILPALNNNDWVISDRFSDSTLAYQGY---
KTHY_PROM9       -----NKPSSLAELLLYSADRAEHISKI---ISPALNNNDWVISDRFSDSTLAYQGY---
KTHY_PROM2       -----NKPSPLAELLLYSADRAEHVYKI---ISPALNNNDWVISDRFSDSTLAYQGY---
KTHY_PROM5       -----NKPSSLAELLLYSADRAEHVSKI---ISPALKKEDWVISDRFSDSTLAYQGY---
KTHY_PROMP       -----NKPSSLAELLLYSADRAEHISKT---ISPALENQDWVLSDRFCDSTLAYQGY---
KTHY_CARHZ       -------VVPEAEILLYLADRAQHVGEK---IIPHLDKGVWVISDRYFDSTLAYQGY---
KTHY_THET8       ------ELSPEAEYLLFSADRAEHVRKV---ILPGLAAGKVVISDRYLDSSLAYQGY---
KTHY_THET2       ------ELSPEAEYLLFSADRAEHVRKV---ILPGLAAGKVVISDRYLDSSLAYQGY---
KTHY_DEIRA       -----VEIEPLGEFLLYSASRAQLVREV---LRPALERGETVLCDRYADSSLAYQGA---
KTHY_CLAMS       ------HIAPRAEALLYAADRAHHVETV---VRPALERGAVVLQDRYLDSSVAYQGA---
KTHY_CLAM3       ------HIAPRAEALLYAADRAHHVETV---VRPALDRGAVVLQDRYLDSSVAYQGA---
KTHY_LEIXX       ------DIAPRAEALLYAADRAHHVATV---VRPALERGEVVLQDRYLDSSVAYQGA---
KTHY_BIFLO       ----AVDIAPRAEALLFAADRAQHVAET---IRPALERGEVVITDRYLDSSLAYQAG---
KTHY_BIFAA       DENDCADIAPRTEALLFAADRAQHVAEV---ILPALQRGAVVITDRYLDSSLAYQAG---
KTHY_CUTAK       ------PISSRAEALLYNADKAQHVDEV---VIPALREGKVVVCDRYVDSTIAYQGA---
KTHY_DESVH       -------ITPEAELFLYLADRAQHVAQV---VRPALDEGMVVLSDRYADSTVVYQGY---
KTHY_DESVV       -------ITPEAELFLYLADRAQHVAQV---VRPALDEGMVVLSDRYADSTVVYQGY---
KTHY_DESAG       -------LTGETELFLYLADRSQHVHQV---IRPALAEGVAVISDRYADSTVVYQGY---
KTHY_LAWIP       -------LTAESELFLFLADRAQHVSEC---IQPAIMNGKTVFCDRYADSTIVYQGY---
KTHY_GLOVI       -------ITPTAELLLYATDRAEHLARV---VRPALASGAAVLCDRFSDSTVAYQGY---
KTHY_LACSS       -------MDDRTEALLYAAARRQHIVEK---IQPALAADKLVICDRFVDSSIAYQGA---
KTHY_LACPL       -------MDDRTEALLYAAARRQHIVQT---IQPALQNDQLVLCDRYIDSSVAYQGA---
KTHY_LACBA       -------MDYRTEALLYAAARRQHLAQT---ILPALAADKLVLCDRYVDSSVAYQGA---
KTHY_PEDPA       -------MDERTEALLYAAARRQHLVET---ILPALKKNHVVFCDRFVDSSIAYQGA---
KTHY_LACP3       -------MDARTEALLYAASRRQHLVEV---IQPALAQGDIVVCDRFVDSSVAYQGG---
KTHY_ENTFA       -------MDERTEALLYAAARRQHLVEK---ILPALEAGHLVLCDRFVDSSLAYQGA---
KTHY_LACS1       -------MDARTEALLYAAARRQHLVDT---VLPALNEGKLVLCDRFVDSSVVYQGV---
KTHY_LEUMM       -------MDKRTEALLYTAARRQHLVEN---IKPALDQNKIVISDRYVDSSLAYQGG---
KTHY_LACRD       -------MDGRTEALLFAAARRQHIVSE---IIPGLKAGKVILCDRFVDSSIAYQGA---
KTHY_OENOB       -------MNRRTEALLFAAARAQHMVEK---IEPALADGKIVLSDRFVDSSIAYQGG---
KTHY_STRA5       -------MDKKTELLLYMAARRQHLVEK---VLPALEEGKIVLMDRFIDSSVAYQGS---
KTHY_STRA3       -------MDKKTELLLYMAARRQHLVEK---VLPALEEGKIVLMDRFIDSSVAYQGS---
KTHY_STRA1       -------MDKKTELLLYMAARRQHLVEK---VLPALEEGKIVLMDRFIDSSVAYQGS---
KTHY_STRTD       -------MDAKTELLLYIAARRQHLVEK---VLPELENGNMVIMDRFIDSSVAYQGA---
KTHY_STRT2       -------MDAKTELLLYIAARRQHLVEK---VLPELENGNMVIMDRFIDSSVAYQGA---
KTHY_STRT1       -------MDAKTELLLYIAARRQHLVEK---VLPELENGNMVIMDRFIDSSVAYQGA---
KTHY_STRMU       -------MDDKTELLLYIAARRQHLVER---ILPELKKGNLVLVDRFIDSSVAYQGY---
KTHY_STRPG       -------MDPKTELLLYIAARRQHLVEK---VLPALEAGQLVFIDRFIDSSVAYQGA---
KTHY_STRP8       -------MDPKTELLLYIAARRQHLVEK---VLPALEAGQLVFIDRFIDSSVAYQGA---
KTHY_STRP3       -------MDPKTELLLYIAARRQHLVEK---VLPALEAGQLVFIDRFIDSSVAYQGA---
KTHY_STRP6       -------MDPKTELLLYIAARRQHLVEK---VLPALEAGQLVFIDRFIDSSVAYQGA---
KTHY_STRP1       -------MDPKTELLLYIAARRQHLVEK---VLPALEAGQLVFIDRFIDSSVAYQGA---
KTHY_STRGC       -------MDGKTELLLYIASRRQHLIEK---VLPALEAGKLVIMDRFIDSSVAYQGF---
KTHY_STRSV       -------MDAKTELLLYIASRRQHLTER---VLPALAQGKLVLMDRFIDSSVAYQGY---
KTHY_STRP2       -------MDAKTELLLYIASRRQHLVEK---VLPALEAGKLVIMDRFIDSSVAYQGF---
KTHY_STRR6       -------MDAKTELLLYIASRRQHLVEK---VLPALEAGKLVIMDRFIDSSVAYQGF---
KTHY_STRPN       -------MDAKTELLLYIASRRQHLVEK---VLPALEAGKLVIMDRFIDSSVAYQGF---
KTHY_LACLM       -------IDSKTELMLFAAARRLHMQEK---MLPALRAGKVVIVDRFIDSSVAYQGY---
KTHY_LACLS       -------IDSKTELMLFEAARRLHMQEK---MLPALRAGKVVIVDRFIDSSVAYQGY---
KTHY_LACLA       -------IDSKTELMLFAAARRLHMQEK---MLPALQAGKVVIVDRFIDSSVAYQGY---
KTHY_LACH4       -------MDAKTEALLYAAARSQHVEEI---IRPALSEGKIVFSDRFVDSSLAYQGE---
KTHY_LACAC       -------MDPKTEALLYAAARSQHVEEI---IKPAINEGKVVFSDRFVDSSLAYQGQ---
KTHY_LACDB       -------MNAKTEALLYAASRSQHVSEI---INPALKRGDLVMSDRFVDSSLAYQGQ---
KTHY_LACDA       -------MNAKTEALLYAASRSQHVSEI---INPALKRGDLVMSDRFVDSSLAYQGQ---
KTHY_LACJO       -------MDDRTEALLYAAQRSQHVSEV---IRPALATGKVVLSDRFIDSSLAYQGV---
KTHY_CLONN       -------MDARTEALLYVASRRQHLAER---VIPAIKEGKVVICDRFIDSSLAYQGY---
KTHY_CLOB8       -------MDAKTEALLYAAARRQHLVEK---VIPALNQGVIVLCDRFIDSSLAYQGY---
KTHY_BACHD       -------MDPRTEALLYAAARRQHLVEK---VLPALEAGHVVLCDRFIDSSLAYQGY---
KTHY_BACVZ       -------MDAKTEALLYAAARRQHLAEK---VQPALKEGRIVLCDRFIDSSLAYQGY---
KTHY_BACSU       -------MDPKTEALLYAAARRQHLVEK---VKPALEQGFIVLCDRFIDSSLAYQGY---
KTHY_BACLD       -------MDPKTEALLYAAARRQHLVEK---VKPALEEGKIVLCDRFIDSSLAYQGY---
KTHY_BACP2       -------MDAKTEALLYAAARRQHLAEK---VEPALQRGETVLCDRFVDSSLAYQGY---
KTHY_BACHK       -------MEARTEALLYAAARRQHLVEK---VMPALNEDYLVLCDRFIDSSLAYQGY---
KTHY_BACAN       -------MEARTEALLYAAARRQHLVEK---VMPALNEDYLVLCDRFIDSSLAYQGY---
KTHY_BACCZ       -------MEARTEALLYAAARRQHLVEK---VMPALNEDYLVLCDRFIDSSLAYQGY---
KTHY_BACAH       -------MEARTEALLYAAARRQHLVEK---VMPALNDDYLVLCDRFIDSSLAYQGY---
KTHY_BACC1       -------MEARTEALLYAAARRQHLVEK---VMPALDEDYLVLCDRFIDSSLAYQGY---
KTHY_BACCR       -------MEARTEALLYAAARRQHLVEK---VMPALNEDYLVLCDRFIDSSLAYQGY---
KTHY_BACCN       -------MEARTEALLYAAARRQHLVEK---VMPALEADQLVLCDRFIDSSLAYQGY---
KTHY_OCEIH       -------MEERTEALLYAAARRQHLVEK---VFPALEQGKVVLCDRFVDSSLAYQGY---
KTHY_GEOTN       -------MDGRTEALLYAAARRQHLLEK---IVPALEAGRVVLCDRFVDSSLAYQGF---
KTHY_GEOKA       -------MDGRTEALLYAAARRQHLLEK---IVPALEAGCVVLCDRFVDSSLAYQGF---
KTHY_BACSK       -------MDNRTEALLYAAARREHLIKK---IVPALAEGALVLCDRYIDSSLVYQGH---
KTHY_STAAN       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAAM       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAAC       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAA9       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAA3       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAAR       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAA2       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAA8       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAA1       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAAB       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAAS       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAAW       -------MDIRTEAMLFAASRREHLVLK---VIPALKEGKVVLCDRYIDSSLAYQGY---
KTHY_STAS1       -------MDDRTEALLFAASRREHLVGK---VIPSLENGKLVLCDRYIDSSLAYQGY---
KTHY_STAHJ       -------MDIRTEAMLFAASRREHLVEK---VVPALNDNKIVLCDRYIDSSLAYQGY---
KTHY_STAES       -------IDIRTEAMLFAASRREHLVEK---IIPSLQAGKIVLCDRYIDSSLAYQGY---
KTHY_STAEQ       -------IDIRTEAMLFAASRREHLVEK---IIPSLQAGKIVLCDRYIDSSLAYQGY---
KTHY_LISMF       -------MDPKTEVLLIAGARRQHVVET---IRPALAAGKTVLCDRFMDSSLAYQGA---
KTHY_LISMO       -------MDPKTEVLLIAGARRQHVVET---IRPALAAGKSVLCDRFMDSSLAYQGA---
KTHY_LISIN       -------MDPKTEVLLIAGARRQHVVET---IRPALAAGKTVLCDRFMDSSLAYQGA---
KTHY_LISW6       -------MDPKTEVLLIAGARRQHVVET---IRPALAAGKTVLCDRFMDSSLAYQGA---
KTHY_MYCMS       -------MDAWTEALLFIASRNQHLQKV---IKPALEKNIIVISDRFIDSTSAYQGS---
KTHY_MYCCT       -------MDAWTEALLFIASRNQHLQKV---IKPALEKNIIVISDRFIDSTSAYQGS---
KTHY_MESFL       -------MEPWTEALLFIAARKEHLEKV---IKPYLKKGYIVISDRFMDSTTAYQGG---
KTHY_ONYPE       -------IDFHTEALLFAADRAEHLSKL---IIPALQQNKIVICDRYLDSTIAYQVY---
KTHY_AYWBP       -------IDFHTEALLFAADRAEHLSKL---IIPALQQNKIVICDRYLDSTIAYQVY---
KTHY_ACHLI       -------ITAHTEALLFAASRAQHLDEV---IIPNL--DKVILCDRYIDSSYAYQAF---
KTHY_TROWT       -------MDIRTEALLYSADRAENIAKN---VIPALNAGKVVLQDRYLDSFLAYQLA---
KTHY_TROW8       -------MDIRTEALLYSADRAENIAKN---VIPALNAGKVVLQDRYLDSFLAYQLA---
KTHY_CHLCV       ------SISPYTELFLFLAARAEHITKK---IFPALESGNIVICDRFHDSTIVYQGI---
KTHY_CHLFF       ------GISPYTELFLFLASRAQHITEK---IIPALESGKIVICDRFHDSTIVYQGI---
KTHY_CHLAB       ------ELSPYTELFLFLAARAQHITEK---ILPALELGKIVVCDRFHDSTIVYQGI---
KTHY_CHLPN       ------ELSRCCELFLFLGSRAQHIQEV---IIPALRDGYIVICERFHDSTIVYQGI---
KTHY_CHLTR       ------KISPYAELLLFLAARAQHIQEK---IIPALKSGKTVISDRFHDSTIVYQGI---
KTHY_CHLTA       ------KISPYAELLLFLAARAQHIQEK---IIPALKSGKTVISDRFHDSTIVYQGI---
KTHY_CHLMU       ------EISSYAELLLFLAARAQHIQEK---ILPALESGKTVICDRFHDSTIVYQGI---
KTHY_PARUW       ------SIGHQAELLLFLAARAQHIEEL---IQPALKAGKIVLCDRFNDSTIAYQGA---
KTHY_PSEPF       ----DEVMNPDTELLLVFAARAQHLAEV---IRPALARGAVVLCDRFTDSTYAYQGG---
KTHY_PSEF5       ----EEVMNADTELLLVFAARAQHLATV---IRPALERGAVVLCDRFTDSTYAYQGA---
KTHY_PSEPG       ----DESMAADTELLLVFAARAQHLAQV---IRPALARGAVVLCDRFTDATYAYQGG---
KTHY_PSEP1       ----DEGMAADTELLLVFAARAQHLAQV---IRPALARGAVVLCDRFTDATYAYQGG---
KTHY_PSEE4       ----EEAMAVDTELLLMFAARAQHLAQV---IRPALARGAVVLCDRFTDATYAYQGG---
KTHY_PSEMY       ----DEPMAADTELLLVFAARAQHLQQV---IRPALAKGCVVLCDRFTDATYAYQGG---
KTHY_PSEU5       ----DEPMAVDTELLLVFAARAQHLAQV---IRPALARGAVVLCDRFTDATYAYQGG---
KTHY_PSEAE       ----DEPMAADTELLLMFAARAQHLAGV---IRPALARGAVVLCDRFTDATYAYQGG---
KTHY_PSEA7       ----DEPMAADTELLLMFAARAQHIAGV---IRPALARGAVVLCDRFTDATYAYQGG---
KTHY_PSEAB       ----DEPMAADTELLLMFAARAQHIAGV---IRPALARGAVVLCDRFTDATYAYQGG---
KTHY_PSESM       ----DEGMSADTELLLVFAARAQHLAEV---IRPALARGEVVLCDRFTDATYAYQGG---
KTHY_PSEU2       ----DEAMSADTELLLVFAARAQHLAEV---IRPALARGEVVLCDRFTDATYAYQGG---
KTHY_PSE14       ----DEAMSADTELLLVFAARAQHLAEV---IRPALARGEVVLCDRFTDATYAYQGG---
KTHY_ALCBS       ----NEVMADDTELLLVFAARAQHLEQK---IRPALARGEWVLCDRFLDATWAYQGA---
KTHY_CHRSD       ----QEPLDETAELLLMFAARAQHLAAR---IRPALARGAWVVCDRFTDATFAYQGG---
KTHY_METCA       ----QDTVRPEAELLLLFAARVHHLREV---IEPALRRGDWVVCDRFTDASYAYQGA---
KTHY_ALKEH       ----EPPMAPATEALLMFAARSEHLDKR---IWPALERGQWVVCDRFTDASYAYQGW---
KTHY_VESOH       ----TQLMDNDTELLLIFAARNEHIKTK---IIPALNRGDWVLSDRFTDASYAYQGG---
KTHY_RUTMC       ----IQSIHGDTELLLLFAARNEHIRTK---IIPSLEKGDWVLSDRFTDASYAYQGG---
KTHY_MARMS       ----DESVNDVTELLLVFAARAQHLAEK---IQPALEKGTWVISDRFLDSSYVYQGK---
KTHY_COXBU       ----DEMMCPDTELLLMFAGRAQNIAHV---VLPALRRGQWVLSDRFTDASFAYQGG---
KTHY_NITEU       -----QAMHPETEALLMFAARREHLDKV---ILPALDRGAWVVSDRFTDASFAYQGG---
KTHY_NITEC       -----QAMHAETETLLMFAARREHLDKV---ILPALERGAWVISDRFTDASFAYQGG---
KTHY_NITMU       -----QTMHAETEALLMFAARREHLDKV---ILPALSRGEWVISDRFTDASFAYQGG---
KTHY_BORBR       -----EPMALETETLLMFAARCEHVREV---IAPALARGEWVVCDRFTDASYAYQGG---
KTHY_BORPE       -----EPMALETETLLMFAARCEHVREV---IAPALARGEWVVCDRFTDASYAYQGG---
KTHY_BORPA       -----EPMALETETLLMFAARCEHVREV---IAPALARGEWVVCDRFTDASYAYQGG---
KTHY_DECAR       -----EPMHLETETLLMFAARREHLARL---IEPALARGEWVVCDRFSDATYAYQGG---
KTHY_BURCH       -----QPMDLETEALLMFAARREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURCA       -----QPMDLETEALLMFAARREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURCM       -----QPMDLETEALLMFAARREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURL3       -----QPMDLETEALLMFAARREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURVG       -----QPMDLETEALLMFAARREHLARV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURM9       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURP6       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURMS       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURM7       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURMA       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURP1       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURPS       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURP0       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_BURTA       -----QPMDLETEALLMFAGRREHLALV---IEPALARGDWVVSDRFTDATFAYQGG---
KTHY_PARXL       -----QKMDLETEALLMFALRRQHLAEV---IEPALARGDWVLSDRFTDATFAYQGG---
KTHY_RALSO       -----ERMHLETEALLMFASRREHIAEV---IQPALERGDWVISDRFTDATFAYQGG---
KTHY_HERAR       -----EKMHLETEALLMFAARREHIAQL---IEPALARGDWVISDRFTDATFAYQGG---
KTHY_JANMA       -----EKMHLETEALLMFAARREHIAQV---IAPALERGDWVISDRFTDATFAYQGG---
KTHY_NEIG1       -----TKAGLRAETLMMFAARMQHIEEV---ILPALSDGIHVVSDRFTDATFAYQGG---
KTHY_NEIMB       -----TKAGLRAETLMMFAARMQHIEEV---ILPALSDGIHVVSDRFTDATFAYQGG---
KTHY_NEIMA       -----TKAGLRAETLMMFAARMQHIEDV---ILPALSDGIHVVSDRFTDATFAYQGG---
KTHY_NEIMF       -----TKAGLRAETLMMFAARMQHIEDV---ILPALSDGIHVVSDRFTDATFAYQGG---
KTHY_CHRVO       -----TVASLDAEALLAFAARQQHIAEV---IEPALAAGRWLVSDRFTDSTYAFQGG---
KTHY_HALHL       ----YRGLTAEAEALTVFAARAEHLAQV---IRPTLDAGRWVISDRFTDATYAYQGG---
KTHY_DICNV       -----YQPQALTELLLILAARHEHLQTV---ILPHLAAGTWVISDRFNDATYAYQGY---
KTHY_ACISJ       ----HDSMDALTEALLVFAARRDHLRCV---IEPALARGEVVLCDRFTDATFAYQGA---
KTHY_ACIAC       ----NEAMDALTESLVVFAGRRDHLRSV---IAPALVRGEVVLCDRFTDATFAYQGA---
KTHY_RHOFT       ----NDAMDAMTEALLVFAARRDHLQQL---IEPALARGDVVLCDRFTDATFAYQGA---
KTHY_POLSJ       ----NDAMDSLTEALLIFAARRDHLVRV---IAPALVRGDVVLCDRFTDATFAYQGA---
KTHY_VEREI       ----AERMDALTESLLIFAARRDHLRQV---IEPALARGDVVLCDRFTDSTFAYQGA---
KTHY_ACIAD       ----DEPMSSDTELLLMYAARAQHLQQV---IVPALADEKLVLSDRFTDASYAYQCV---
KTHY_SALTY       DEV----ITDKAEVLMFYAARVQLVETV---IKPALAQGVWVIGDRHDLSTQAYQGG---
KTHY_SALTI       DEV----ITDKAEVLMFYAARVQLVETV---IKPALAQGVWVIGDRHDLSTQAYQGG---
KTHY_SALPA       DEV----ITDKAEVLMFYAARVQLVETV---IKPALAQGIWVIGDRHDLSTQAYQGG---
KTHY_SALCH       DEV----ITDKAEVLMFYAARVQLVETV---IKPALAQGIWVIGDRHDLSTQAYQGG---
KTHY_SALPB       DEV----ITDKAEVLMFYAARVQLVETV---IKPALAQGIWVIGDRHDLSTQAYQGG---
KTHY_SALAR       DEV----ITDKAEVLMFYAARVQLVETV---IKPALAQGVWVIGDRHDLSTQAYQGG---
KTHY_ECOUT       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECOK1       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECOL6       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_SHIDS       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_SHIBS       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECOHS       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_SHIFL       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_SHIF8       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECOLC       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECOLI       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_SHISS       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECO24       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECOL5       DEV----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_ECO57       DEI----ITDKAEVLMFYAARVQLVETV---IKPALANGTWVIGDRHDLSTQAYQGG---
KTHY_CITK8       DET----ITDKAEVLMFYAARVQLVETV---IKPALAKGTWVIGDRHDLSTQAYQGG---
KTHY_ENT38       DEV----IDVKAEVLMFYAARVQLVETV---IKPALAEGQWVIGDRHDLSTQAYQGG---
KTHY_KLEP7       DEV----INDKAEVLMFYAARVQLVETV---IKPALARGQWVIGDRHDLSTQAYQGG---
KTHY_CROS8       DEV----ITDNAEVLLFYAARVQLVETV---IKPALARGEWVIGDRHDLSTQAYQGG---
KTHY_YERP3       GEV----LTDKAEVLMLYAARVQLVENV---IKPALARGSWVVGDRHDLSSQAYQGG---
KTHY_YERPS       GEV----LTDKAEVLMLYAARVQLVENV---IKPALARGSWVVGDRHDLSSQAYQGG---
KTHY_YERPA       GEV----LTDKAEVLMLYAARVQLVENV---IKPALARGSWVVGDRHDLSSQAYQGG---
KTHY_YERPP       GEV----LTDKAEVLMLYAARVQLVENV---IKPALARGSWVVGDRHDLSSQAYQGG---
KTHY_YERPN       GEV----LTDKAEVLMLYAARVQLVENV---IKPALARGSWVVGDRHDLSSQAYQGG---
KTHY_YERPE       GEV----LTDKAEVLMLYAARVQLVENV---IKPALARGSWVVGDRHDLSSQAYQGG---
KTHY_YERE8       GEV----LTDKAEVLMLYAARVQLVENV---IKPALARGSWVVGDRHDLSSQAYQGG---
KTHY_SERP5       GEL----PTIKAEVLMLYAARVQLVETV---IKPALARGAWVVGDRHDLSSQAYQGG---
KTHY_PHOLL       GEP----LTDKAEVLMLYAARVQLVENV---IKPALARGTWVVGDRHDLSSQAYQGG---
KTHY_PECAS       DEK----VTDKAEVLMLYAARVQLVDNV---IKPALADGKWVIGDRHDLSSQAYQGG---
KTHY_SODGM       EEP----VTDRAELLMLYAARVQLVEGV---IKPALARGAWVVGDRHDLSSQAYQGG---
KTHY_VIBC3       GEE----LQDITELLLVYAARVQLVENV---IKPALARGEWVVGDRHDMSSQAYQGG---
KTHY_VIBCH       GEE----LQDITELLLVYAARVQLVENV---IKPALARGEWVVGDRHDMSSQAYQGG---
KTHY_VIBPA       GEE----LKDMTELLLLYAARVQLVENV---IKPALANGQWVVGDRHDLSSQAYQGG---
KTHY_VIBCB       GED----LKDMTELLLLYAARVQLVENV---IKPALANDQWVVGDRHDLSSQAYQGG---
KTHY_VIBVY       GEH----LHDMTELLLLYAARVQLVENV---IKPALHEGKWVVGDRHDLSSQAYQGG---
KTHY_VIBVU       GEH----LHDMTELLLLYAARVQLVENV---IKPALHEGKWVVGDRHDLSSQAYQGG---
KTHY_ALIF1       DEP----LTDMAELLLLYAARAQLVGNV---IKPALARGEWVVGDRHDLSSQAYQGG---
KTHY_PHOPR       DEP----LTDMAELLLLYAARIQLVDNI---IKPALAEGRWVVGDRHDMSSQAYQGG---
KTHY_HAES1       EEL----VTAKAELLMLYAARVQLVENV---IKPALAQGKWVVGDRHDLSSQAYQGG---
KTHY_HISS2       EEL----VTAKAELLMLYAARVQLVENV---IKPALARGKWVVGDRHDLSSQAYQGG---
KTHY_MANSM       EEP----VTDKAELLMLYAARIQLVENV---IKPALAQGKWVIGDRHDLSSQAYQGG---
KTHY_HAEIN       EEP----VTDKAELLMLYAARIQLVENV---IKPALMQGKWVVGDRHDMSSQAYQGG---
KTHY_PASMU       EEP----VTDKAELLMLYAARIQLVENV---IKPALAQGKWVIGDRHDMSSQAYQGG---
KTHY_HAEDU       EEP----ISPQAELLMLYAARAQLVENV---IKPALSAGKWVLGDRHDMSSQAYQGG---
KTHY_WIGBR       YEK----ITDNAELLMIYAARIQLVESV---IKPALENGSWVVGDRHDLSSLAYQGG---
KTHY_BAUCH       GEY----ITDYTELLLLYAARTQLVAQV---IKPALMSGTWVISDRYDLSSQAYQGG---
KTHY_SHESR       SDP----LCDESECLLIYAARAQLVANV---IKPALAEGKWVLGDRHNLSSLAYQGG---
KTHY_SHESM       SDP----LCDESECLLIYAARAQLVANV---IKPALAEGKWVLGDRHNLSSLAYQGG---
KTHY_SHESA       SDP----LCDESECLLIYAARAQLVANV---IKPALAEGKWVLGDRHNLSSLAYQGG---
KTHY_SHEON       SDP----LCDESECLLIYAARAQLVANV---IKPALAQGNWVLGDRHNLSSLAYQGG---
KTHY_SHELP       NDP----LCDESECLLIYAARAQLVANV---IKPALAQGNWVLGDRHNLSSLAYQGG---
KTHY_SHEFN       TDP----LCDEAECLLIYAARTQLIANV---IKPALSVGQWVLGDRHNLSSLAYQGG---
KTHY_SHEAM       GDP----LCDEAECLLFYAARAQLVANV---IKPSLASGRWVLGDRHNLSSIAYQGG---
KTHY_PSEHT       DEE----IAFETELLIMYAARSQLMHNV---INPALEQGQWVLADRHDLSSQAYQGG---
KTHY_COLP3       QEK----LTVETELLLMYASRSQLLANK---ILPALAAGKWVIGDRHDLSSRAYQGG---
KTHY_IDILO       EEK----VSPTTELLLMYASRVQLVDNI---IKPALSKNRWVIGDRHDLSSRAYQGG---
KTHY_LEGPH       NNV----LDDRSELLLLYAARIQLIEQV---IKPALNVGQWVIADRFELSTLAYQGG---
KTHY_LEGPL       NNV----LDDRSELLLLYAARIQLIEQV---IKPALNVGQWVIADRFELSTLAYQGG---
KTHY_LEGPA       NNV----LDDRSELLLLYAARIQLIEQV---IKPALNVGQWVIADRFELSTLAYQGG---
KTHY_LEGPC       NNV----LDDRSELLLLYAARIQLIEQV---IKPALNEGQWVIADRFELSTLAYQGG---
KTHY_BLOPB       NEP----INSISELLMIYAARLQLIENV---IKPALSKGYWVIGDRFDLSSQAYQGG---
KTHY_BLOFL       NEK----LTDLSELLMLYAARSQLLENV---IKPALFKGDWVIGDRCDLSSFAYQGA---
KTHY_BUCAI       DDN----LIKETELLLMYAARIQLVEKK---IKPALKNGIWVISDRHDLSSLAYQGG---
KTHY_BUCAP       IED----FEKETELLLMYAARIQLVKKI---IQPALKKGTWVISDRHDLSSLAYQGG---
KTHY_BUCBP       NEY----MVNETELLLFYAARIQLIKNI---IQPALNKGVWVISDRYFLSSLAYQCA---
KTHY_FRAT1       DEE----IHSDSELLMIYAGRVQHYRNL---IAPALEKGINVVSDRFYWSSMAYQGG---
KTHY_FRATW       DEE----IHSDSELLMIYAGRVQHYRNL---IAPALEKGINVVSDRFYWSSMAYQGG---
KTHY_FRATT       DEE----IHSDSELLMIYAGRVQHYRNL---IAPALEKGINVVSDRFYWSSMAYQGG---
KTHY_FRATN       DEE----IHSDSELLMIYAGRVQHYRNL---IAPALEKGINVVSDRFYWSSMAYQGG---
KTHY_FRATF       DEE----IHSDSELLMIYAGRVQHYRNL---IAPALEKGINVVSDRFYWSSMAYQGG---
KTHY_FRATH       DEE----IHSDSELLMIYAGRVQHYRNL---IAPALEKGINVVSDRFYWSSMAYQGG---
KTHY_FRATO       DEE----IHSDSELLMIYAGRVQHYRNL---IAPALEKGINVVSDRFYWSSMAYQGG---
KTHY_WOLTR       --------DPVSELLLLISMRYEHVKKV---ILPALKKGKIVICDRFIDSTIAYQGY---
KTHY_WOLPM       --------DSISELLLLISMRREHMKKL---ILPALAEGKIVICDRFIDSTIAYQGY---
KTHY_EHRCR       -------LDSLSELLFFIAMRREHFVKI---IKPSLMQKKIVICDRFIDSTIAYQGY---
KTHY_EHRCJ       -------LDSLSELLFFIAMRREHFMKV---IKPSLMQKKIVVCDRFIDSTIAYQGY---
KTHY_EHRRW       -------LDKLSELLFFIAMRREHFMKV---IKPALTQQKIVICDRFIDSTIAYQGY---
KTHY_EHRRG       -------LDKLSELLFFIAMRREHFMKV---IKPALTQQKIVICDRFIDSTIAYQGY---
KTHY_ANAMM       -------LDGITELMLFIAMRRESFVKV---VLPGLLAGKIVISDRFTDSTVAYQGY---
KTHY_ANAPZ       -------VDKLTELFLFLAMRRESFVKV---VESALRANKIVISDRCVDSTVAYQGY---
KTHY_NEOSM       --------DPMARLLLIVSARVDHYNKV---ILPALKEGKVVVCDRFIYSTLAYQGY---
KTHY_RICRO       --------LPMSELFQAMAARYDHMARK---IIPALQEGHIVICDRFIDSTVCYQGL---
KTHY_RICRS       --------LPMSELFQAMAARYDHMARK---IIPALQEGHIVICDRFIDSTVCYQGL---
KTHY_RICCN       --------LPMSELLQAMAARYDHMARK---IIPALQEGHIVICDRFIESTVCYQGL---
KTHY_RICM5       --------LPMSELLQAIAARYDHMARK---IIPALQEGHIVICDRFIDSTACYQGL---
KTHY_RICFE       --------LPMSELLQAMAARYDHMVRK---IIPALQDGHIVICDRFIDSTACYQGL---
KTHY_RICCK       --------LPMSELLQAMAARYDHMVRK---IIPVLKEGYIVICDRFLDSTACYQGL---
KTHY_RICAH       --------LPMSELLQAMAARYDHMARK---IIPALQDGHVVICDRFIDSTACYQGL---
KTHY_RICPR       --------LPMSELLQAMAARYDHMARK---IIPALKDGYIVICDRFIDSTACYQGL---
KTHY_RICTY       --------LPMSELLQAMAARYDHMVRK---IIPALKDGYIVICDRFIDSTACYQGL---
KTHY_RICB8       --------LPMSELLQAMAARYDHMVKK---IIPALQAGNIVICDRFIDSTACYQGL---
KTHY_RICBR       --------LPMSELLQAMAARYDHMVKK---IIPALQAGNIVICDRFIDSTACYQGL---
KTHY_ORITB       --------SITTELLLIMAARYEHIEKF---IRPNLNEGKWVICDRFIDSTLCYQSK---
KTHY_MYCS5       -------FSPITEALLYTTSRRIHIDKV---ILPALAQNKIVFCDRYYDSFYAYQGY---
KTHY_MYCPU       -------LSPIAEAFLYSSARRIHLDKV---ILPNLAKNKVVFCDRFVDSSFAYQAF---
KTHY_UREPA       -------FDPLTLAYLYASSRAEHVKKT---INPHLEKDHIVISDRFVHSSYIYQGI---
KTHY_UREP2       -------FDPLTLAYLYASSRAEHVKKT---INPHLEKDHIVISDRFVHSSYIYQGI---
KTHY_MYCMO       -------IDPMTETLLYAASRRVHLDSL---IWPALKKGHIVISDRYVDSSYVYQGI---
KTHY_MYCHJ       -------ISPYVEMLLFATARRIHLERL---IWPALKAGKIVLCDRYIDSSIAYQGF---
KTHY_MYCH2       -------ISPYVEMLLFATARRIHLERL---IWPALKAGKIVLCDRYIDSSIAYQGF---
KTHY_MYCH7       -------ISPYVEMLLFATARRIHLERL---IWPALKAGKIVLCDRYIDSSIAYQGF---
KTHY_MYCPN       -------MEPLTEAYLFAASRTEHVRQL---IQPALQQKQLVIVDRFVWSSYAYQGL---
KTHY_MYCGE       -------MEPLTEAYLFAAARTEHISKL---IKPAIEKEQLVISDRFVFSSFAYQGL---
KTHY_MYCGA       -------SDPLTEALLFCASRNEHLKKK---ILPALNENKIAICDRFVVSSWIYQGL---
KTHY_MYCPE       -------IDPRTEALLFAASRTEHVWNV---ILKAKANKKIILCDRFIHSSLVYQGI---
KTHY_CAMJR       --NKTHPINKRAELLLFLADRAQHFEEI---LKTNQN--KLIISDRSFISGMAYA-----
KTHY_CAMJE       --NKTHPINKRAELLLFLADRAQHFEEI---LKTNQN--KLIISDRSFISGMAYA-----
KTHY_CAMJJ       --NKTHPINKRAELLLFLADRAQHFEEI---LKINQN--KLIISDRSFISGMAYA-----
KTHY_CAMJ8       --NKTHPISKRAELLLFLADRAQHFEEI---LKTNQN--KLIISDRSFISGMAYA-----
KTHY_CAMJD       --NKTHPISKRAELLLFLADRAQHFEEI---LKTNQN--KLIISDRSFISGMAYA-----
KTHY_CAMC1       --RSSIKIGKRAEILLFLADRAEHFEKL---VAPNLG--KLILSDRGFISGIAYALAN--
KTHY_CAMHC       --ESDFKISKTAELFLFLADRAEHFEKV---LKFSDK--KDIICDRSFVSGIAYALAN--
KTHY_SULDN       --NAKIK-SKKAEFLLFLADRAEHIQEV---IEPNLS--KMIISDRSVVSGVAYALV---
KTHY_HELHP       --KYGFTLDERAELMLFLADRAQHYAQV---LLPHKD--KLIISDRSVISGIAYA-----
KTHY_HELPJ       ----NENISELARAFLFLSDRAEHIESV---IKPALKEKKLIISDRSLISGMAYS-----
KTHY_HELPY       ----NENISELARAFLFLSDRAEHTESV---IKPALKEKKLIISDRSLISGMAYS-----
KTHY_HELPH       ----NENISELARAFLFLSDRAEHTESV---IKPALKEKRLIISDRSLISGMAYS-----
KTHY_HELAH       ----HENLSELARAFLFLSDRAEHIESV---IKPALKEKKLIISDRSLISGMAYS-----
KTHY_METMA       ---------QLAELFLFTADHAEHLAKL---VKPALANGKNVISDRYSDSRYAYQGVT--
KTHY_METAC       ---------QLAELFLFTADHAEHLAKL---VKPALEDGKTVISDRYSDSRYAYQGIT--
KTHY_METBF       ---------QFAELFLFTADHAEHLAKL---IKPALENGKIVISDRYSDSRYAYQGIT--
KTHY_METBU       ---------ELAELMLFTADHADHISTL---IRPAIEEGKIVISDRYSDSRYAYQGVT--
KTHY_HALSA       ---------PIAELFLFTADHADHLSRV---VSPALDRGDVVISDRYSDSRYAYQGAT--
KTHY_HALMA       ---------SLAELFLYTADHAAHLSET---VRPALNEGRLVVSDRYSDSRYAYQGAT--
KTHY_NATPD       ---------PLAELFLYTADHADHLSRV---VRPALEAGEPVVSDRYSDSRYAYQGAT--
KTHY_METHJ       ---------PIAEALLFVADHAAHLREV---VRPALSEDRLVISDRYIDSRLVYQQVT--
KTHY_METLZ       ---------PFAEATLFVADHAAHLAQV---VLPALEEKKLVISDRYSDSRFAYQQVS--
KTHY_METMJ       ---------PITEALLFCADHAAHIDTV---IRPALDEGRLVISDRYADSRFAYQPVV--
KTHY_PYRAB       IID-GSRISYEAEALLFAADRAEHVKKV---ILPALEKGKVVICDRYLYSSLAYQWA---
KTHY_PYRHO       VID-GSKISYEAEALLFAADRAEHVKKI---ILPALSEGKVVICDRYFYSSLAYQWA---
KTHY_PYRFU       IID-GGRISLEAEALLFAADRAEHVKKI---IEPALREGKVVISDRYFYSSLAYQWA---
KTHY_THEKO       IID-GAKISHEAEALLFAADRAEHVDKL---IKPSLEAGKVVISDRYFYSSLAYQWA---
KTHY_XANOR       -----GRLSADEEAELLIRDRHEHVDTL---IAPALARGDIVILDRYFPSMVAYQGA---
KTHY_XANOM       -----GRLSADEEAELLIRDRHEHVDTL---IAPALARGDIVILDRYFPSMVAYQGA---
KTHY_XANAC       -----GRLSAEEEAELLIRDRHEHVDTL---IAPALARGDIVILDRYFPSMVAYQGA---
KTHY_XANC5       -----GRLSAEEEAELLIRDRHEHVDTL---IAPALARGDIVILDRYFPSMVAYQGA---
KTHY_XANCP       -----GRLSAQDEVDLLLRDRREHVEAL---IAPALARGEIVILDRYFPSMVAYQGA---
KTHY_XANC8       -----GRLSAQDEVDLLLRDRREHVEAL---IAPALARGEIVILDRYFPSMVAYQGA---
KTHY_XYLFA       -----GRFSPEEEVDVLLRDRRQHVEDL---IVPMIGRGAVVILDRYFPSMVAYQGA---
KTHY_XYLFT       -----GRFSPEEEVDVLLRDRRQHVEDL---IVPMIGRGAVVILDRYFPSMVAYQGA---
KTHY_DESPS       -----NKVTRNEELELFLADRREHVNKL---INPAISAGKIVLCDRYYLSTAAYQGA---
KTHY_LEPBJ       ------DLERKEQIDAFLNDREESLRQN---ILPSLESGKNVLLDRYMYSTAAYQSG---
KTHY_LEPBL       ------DLERKEQIDAFLNDREESLRQN---ILPSLESGKNVLLDRYMYSTAAYQSG---
KTHY_LEPIC       ------ELGKEEQIEAFLNDREESLKQN---ILPALNSDKNVLLDRYMYSTAAYQSG---
KTHY_LEPIN       ------ELGKEEQIEAFLNDREESLKQN---ILPALNSDKNVLLDRYMYSTAAYQSG---
KTHY_ARCFU       ------RLSPEEELELFLKDREIDAREN---ILPALQSGYAVVMDRYYFSNIAYQSA---
KTHY_PYRCJ       ----GGTADPHVDALLFAADRVEHYKRE---IEPKLREGYIVITERYVESSIAYQGAA--
KTHY_PYRAE       ----GGSVDPHVDALLFAADRIEHYKRE---IEPRVREGYIVISERYIESSIAYQGAA--
KTHY_STAMF       ----NEYRDAYLDALTYAADRLVHIRTE---ILPYLRRGYIVICDRYYYSSAAYQSAQ--
KTHY2_SACS2      -----NMLTSITFSLIHATDFSDRYERY---ILPMLKSGFVVICDRYVYTAYARDVVR--
KTHY2_SULTO      -----DLLTPLTFSLIHATDFSDRYERY---ILPMLKSGFIVISDRYIYTAYARDSVR--
KTHY_THEVO       ----------DVELFIKFTLDRYKHQKE---IRKKLNEGFVVISDRYIRSSYAYEMKG--
KTHY_THEAC       ----------GVELFLKFTINRYAHQRE---IDRHIKNGEIVICDRYIRSSYAYQFEG--
KTHY_PICTO       -------ESSIINFFLFTLDRYMHQKEI---KNHLING---VISDRYVFSSIAYQGSG--
KTHY_SYNY3       NDA---RQFEAQMGYLFAADRHYHLYHPGDGVEAKLAQQCHVITTRYYFSSLAYNCHT--
KTHY_METKA       --------DPYLQALAFTLDRMLTLKRV------DFEAADVVLSDRTFLSTLAYQSAL--
KTHY_MYCTU       ------ASSVYAMATLFALDRAGAVHTI----QGLCRGYDVVILDRYVASNAAYSAARLH
                                                           .  *   :          

KTHY1_SACS2      GVD----EQWIKMVNSYFPKP-----------------------DMVILLDLPIEVAISR
KTHY_SULAC       GID----ENWIRNLNKYFPEP-----------------------DLTILLDLKPETAIAR
KTHY1_SULTO      GLD----EKWIEEVNSKFPKP-----------------------DIVFLLDIKVNEAIKR
KTHY_METS5       GVD----RTWLESLSSIFPLP-----------------------NLTILLDVPVNVALER
KTHY_METM7       GIP----KDFIYTINDYAKTP-----------------------DLVVLLDVDLNEALKR
KTHY_METM5       GIS----KDFIYTINDYAKTP-----------------------DLVVLLDVDLNEALKR
KTHY_METMP       GIP----KDFIYKINDYAKIP-----------------------DLVVLLDVDLNEALKR
KTHY_METVS       GIS----KEFIYSINFFAKIP-----------------------DIVVILDVDTEEALKR
KTHY_META3       GID----IDFIASINRFAKIP-----------------------DVLIYLDVSIEESLKR
KTHY_METJA       GVD----ENFIKSINRYALKP-----------------------DIVFLLIVDIETALKR
KTHY_METS3       --------EWIEQINKYAKEP-----------------------DLVLLLDVDVKTSVNR
KTHY_METTH       --------EWVCEINRFAPRP-----------------------DVVILLDIDVEVAMER
KTHY_METST       TIE----PEWIYKINKHTPRP-----------------------DLTIILDIDEDEALKR
KTHY_BDEBA       GRA--ISEADVVMLNTFATGG--------------------LKADITVLLDLSVEESRRR
KTHY_RHOBA       GGE--VDAQTLWQLGRLACGG--------------------VQPDVTLLLDLPAEISMQR
KTHY_GEOSL       GRN--LDRDLIARLNTLAAGQ--------------------IRPDLTILLDCPVAVGLAR
KTHY_GEOUR       GRG--LDPATIAYLNDLATDG--------------------LKPRLTVLLDCPVEVGLKR
KTHY_PELPD       GRG--IAREKVDTLNQLACQS--------------------LRPDLTVLIDCDVSVGLER
KTHY_PELCD       ARG--LDLPMVKQLNELAAGN--------------------CRPHLTLLLDMPHDRGLLR
KTHY_MAGMM       GRG--GDGPWLRQLGQWIRGD--------------------VFPDLTLLLDLDPTVGLAR
KTHY_AGRFC       TGN--LEPDFIETLQRIAIDG--------------------VVPELTLIFDIAAEKGLAR
KTHY_RHIME       TGN--LEPAFVETLERVAVNG--------------------VIPDCTIIFDLPASVGLER
KTHY_RHILO       TGG--IDPAFMATLEQIAING--------------------MMPDMTLIFDIDPAEGLRR
KTHY_BRUO2       TGN--LDATYMAAIERIAIDG--------------------AMPDLTLVLDICAERGLSR
KTHY_BRUME       TGN--LDATYMAAIERIAIDG--------------------AMPDLTLVLDICAERGLSR
KTHY_BRUSU       TGN--LDATYMAAIERIAIDG--------------------AMPDLTLVLDICAERGLSR
KTHY_BRUC2       TGN--LDATYMAAIERIAIDG--------------------AMPDLTLVLDICAERGLSR
KTHY_BRUSI       TGN--LDATYMAAIERIAIDG--------------------AMPDLTLVLDICAERGLSR
KTHY_BRASO       QGK--VAPDVLNAMQRVTIGD--------------------LKPDLTLILDVPVEVGLQR
KTHY_BRASB       LGK--VAPDVLNAMQRVTIGD--------------------LKPDLTLILDVPVEVGLKR
KTHY_NITHX       LGD--VLPGVLNALERVTIGD--------------------LKPDLTVILDVPVEIGMQR
KTHY_NITWN       LGN--VLPGVLNAMERVTIGD--------------------LKPDLTVILDVPVEVGLQR
KTHY_BRADU       LGS--VSPGLINAMQRVTIGD--------------------LKPDLTIILDLPVEIGLQR
KTHY_RHOPB       MGA--VAPALLNAMQRVTIGD--------------------LKPDLTIILDVPVEIGVKR
KTHY_RHOPA       LGA--VSLDLLNALQQVTIGD--------------------MKPDLTVILDIPVEIGLAR
KTHY_BARQU       NNT--VGSSVLSVLEYVALNG--------------------IMPCLTFLLDIPARCGMER
KTHY_BARHE       NDK--VSSSTLAVLECLALNK--------------------IKPQITFLLDIPARCSMKR
KTHY_CAUVC       GGD--APASLIAALEEHVLGG--------------------TVPVLTLILDLPAEVGLQR
KTHY_JANSC       TRG--ALRGLVDRIHAEAIEA--------------------E-PDLTLILDMDPELALSR
KTHY_SPHWW       ADG--LGDEAIRTLHAIGSAG--------------------YLPDRTLLLDMPVFDAAFR
KTHY_RHOS1       GRG--LSEAFIRTLHAEATGD--------------------LWPDLTLVLDLEAGIGLAR
KTHY_RHOS4       GRG--LSEAFIRTLHAEATGD--------------------LWPDLTLVLDLEAGIGLAR
KTHY_SYMTH       AGG--LPVEFLTQINEMATGA--------------------LRPHRTIVLDLAPE--VAL
KTHY_PELTS       GRG--VDIEMLEQVNRPAAAG--------------------VVPDLVLVLDFDREGQTER
KTHY_ROSCS       GLG--RDLAELRTITAAATGG--------------------LRPDITFYLDISAEDGLER
KTHY_ROSS1       GLG--RDLAELRVITAAATGG--------------------LRPDITFYLDISAAEGLER
KTHY_DESRM       GRG--MDISFLAQINELASGG--------------------LMPNITILLDLPPEEGLQR
KTHY_THEMA       GRN--LGKEIVEELNDFATDG--------------------LIPDLTFYIDVDVETALKR
KTHY_THEP1       GRN--LGKEIVEKLNDFATDS--------------------LVPDLTFYIDVDVETALNR
KTHY_THEM4       ARN--LGKDLVEKLNIFATNG--------------------IFPDIVFFIDIPVQMAVRR
KTHY_FERNB       GRE--LGPETVKILNDFATDK--------------------TYPDIVFYIDVPVNVAMER
KTHY_AQUAE       GKG--LDVEFIKNLNEFATRG--------------------VKPDITLLLDIPVDIALRR
KTHY_CALS4       ARG--LGLEKVKIVNEIATKG--------------------LFPDITVYIDITPEEAIKR
KTHY_PELLD       GRG--LDLNMLRTLIAISTGA--------------------LTPDITFYLDILPEEALIR
KTHY_CHLPM       GRG--IDLPTLNSIIALSTGG--------------------LKPDITFYLDILPEEALIR
KTHY_CHLPD       GRG--IDLTILETIIAFSTFN--------------------LIPDVTFYLDIKPEDAMIR
KTHY_CHLTE       GRG--LDLDMLAEINRIASCR--------------------LVPDVTFYLDLTPEDALMR
KTHY_CHLCH       GRG--ISLEQLHSIIALSTGD--------------------LLPDVTFYLDLEPEEALRR
KTHY_DEHMB       GRG--LDLDTVKCVNSLASGG--------------------LVPDLTIWLDMDDKAALLR
KTHY_DEHMC       GRG--LDLDTVKCVNSLASGG--------------------LVPDLTIWLDMDDKAALLR
KTHY_DEHM1       GRG--LELDTVKCINSLASGG--------------------LVPDLTIWLDMDDKAALLR
KTHY_NOSS1       GRN--LDMNLIHQLNDIATGG--------------------LTSDITIWLDVDVEVGLAR
KTHY_TRIV2       GRN--LDMNLIHQLNDIATGG--------------------LTSDITIWLDVDVEVGLAR
KTHY_ACAM1       GRE--LDLTLIHQLNQIATQG--------------------LVSDLTFWLDIDPEFGLAR
KTHY_TRIEI       GRG--LDVELIKQLNYIATGG--------------------LKSDLTFWLDIDVEIGLAR
KTHY_THEEB       GRG--LDLQIIQHINQMATGG--------------------LGADLVLWLDLPVAVGLAR
KTHY_SYNSC       GRG--LDRDLIQRLEQIATAG--------------------LQPDITLWLRLSVQESLQR
KTHY_SYNPX       GRG--LDRQLIDQLERIATAG--------------------VQPDLTLWLTLPLEESLRR
KTHY_SYNS9       GRG--LDRQLITRLESIATTG--------------------LEPDLTAWLMVPVEVSLQR
KTHY_PROMM       GRE--LDLDLIQQLEQIATAG--------------------LVPDLTFWLELPVEESLLR
KTHY_PROM3       GRE--LDLDLIQQLEQIATAG--------------------LVPDLTFWLELSVEESLVR
KTHY_SYNPW       GRG--LDRALILDLERIATAG--------------------LVPDVTLWLDLSLEASMAR
KTHY_SYNR3       GRG--LDLDLITQLEQLATAG--------------------LQPDLCLWLELSPELAAQR
KTHY_SYNS3       GRG--LNRELITDLERIATRG--------------------LTPDMTVWLDIPLALSVQR
KTHY_PROMT       GRK--LDINLIKDLEAIATQG--------------------IAPDITFLLDIPIEESIRR
KTHY_PROM1       GRK--LDITLIKDLEAIATQG--------------------IAPDITFLLDIPIEESIRR
KTHY_PROMA       GRR--LDKSLIKELENIATQG--------------------ITPDLTFLLEIPVSESIKR
KTHY_PROMS       GRN--INLEIIKNIESIVCQG--------------------ASPDLTFFLEISPEESIFR
KTHY_PROM0       GRN--INLEIIKNIESIVCQG--------------------ASPDLTFFLEISPEESIFR
KTHY_PROM9       GRK--INLEIIKKVESIVCQG--------------------EYPDLTFFLEISPEESIMR
KTHY_PROM2       GRN--INLEIIKNIESIVCQG--------------------ESPDLTFFLEISPEESIFR
KTHY_PROM5       GRH--INLEIIKNIESIVCQG--------------------EYPDLTIFLEISAEESILR
KTHY_PROMP       GRN--INLEIIKNIESIVCQG--------------------ESPDLTIFLEISAEESVLR
KTHY_CARHZ       GRG--FDLTLLKSFIAFATKG--------------------LIPDLTVLIDLPPEVGLSR
KTHY_THET8       GRG--LPLPWLREVAREATRG--------------------LKPRLTFLLDLPPEAALRR
KTHY_THET2       GRG--LPLPWLREVAREATRG--------------------LKPRLTFLLDLPPEAALRR
KTHY_DEIRA       GRG--LSLPLLRQITAEVTGG--------------------LTPGLTVLLDLDPALGLQR
KTHY_CLAMS       GRV--LDAAEIRDLSLWAAQG--------------------LLPDLTVLLDLDQAAARIR
KTHY_CLAM3       GRV--LDAGEIRELSLWAAQG--------------------LLPDLTVLLDLDQAAARVR
KTHY_LEIXX       GRV--LDAGEVRELSLWAAEG--------------------LLPDLTILLDLDETTARAR
KTHY_BIFLO       GRE--LTPEEIRSLSMWATNN--------------------LLPDRTYLLDMDPALSHHR
KTHY_BIFAA       GRE--LTAAEIRNLSMWATNG--------------------LLPERTYLLDMDPAQSHAR
KTHY_CUTAK       GRA--LDPGEVGQLACWATTG--------------------LVPDVTVLLDVDPCEGAGK
KTHY_DESVH       GRG--LDPMMLRQFNDVAVGG--------------------LWPDLTILLDLEPEAGLNR
KTHY_DESVV       GRG--LDPMMLRQFNDVAVGG--------------------LWPDLTILLDLEPEAGLNR
KTHY_DESAG       GRG--LDPALLHRLNDVAVRG--------------------LWPDLTLLFDLEPEIGLKR
KTHY_LAWIP       GRG--MNIGKLWEFNEVAIKG--------------------IWPQKTLLLDIDVEKALER
KTHY_GLOVI       GRG--LDLGLIERLNAIATGG--------------------LLPDLTFWLKLDPQAGLVR
KTHY_LACSS       GRG--IGEEAVAQMNLFATDG--------------------LTPDLTLYLDVPSEVGLAR
KTHY_LACPL       GRG--IGEQAVYDMNQFATAG--------------------LTADLTLYFDVDAAVGLNR
KTHY_LACBA       GRQ--IGEDAVAQMNTFATDG--------------------LLPAVTVYFDVPAEIGLRR
KTHY_PEDPA       GRK--IGTDAVYQMNLFATEG--------------------ALPEKTIYLDVPSELGLKR
KTHY_LACP3       GRE--IGPDAVLKMNQFATAG--------------------LEPALTLYLDVPVQVGLDR
KTHY_ENTFA       GRR--IGIAPIASINAFATEG--------------------VSPDFTIYLDVDSDTGLRR
KTHY_LACS1       ARD--IGVEPVIKLNEFATEN--------------------LKPDLTLYYDVEPEISLKR
KTHY_LEUMM       GRG--LGIDNIWEINQFAIDG--------------------LLPDMTIYLDVPVEIGLAR
KTHY_LACRD       GRG--LGEKEIWQINQFAIDG--------------------LMPALTIYLDIESEIGLKR
KTHY_OENOB       GRE--LGIEAVGEINNFATNG--------------------LQPNLTLLLDLPSEVGIAR
KTHY_STRA5       GRG--LDKSHIKWLNDYATDS--------------------HKPDLTLYFDVPSEVGLER
KTHY_STRA3       GRG--LDKSHIKWLNDYATDS--------------------HKPDLTLYFDVPSEVGLER
KTHY_STRA1       GRG--LDKSHIKWLNDYATDS--------------------HKPDLTLYFDVPSEVGLER
KTHY_STRTD       GRG--LDQDEVAWLNNYATDG--------------------HKPDLTLLFDVDSETGLAR
KTHY_STRT2       GRG--LDQDEVAWLNNYATDG--------------------HKPDLTLLFDVDSETGLAR
KTHY_STRT1       GRG--LDQDEVAWLNNYATDG--------------------HKPDLTLLFDVDSETGLAR
KTHY_STRMU       GRG--LDADAVTWLNNFATDG--------------------LQPDLTLYFDVDSQIGLTR
KTHY_STRPG       GRG--LIKADIQWLNEFATDG--------------------LEPDLTLYFDVPSEIGLAR
KTHY_STRP8       GRG--LIKADIQWLNEFATDG--------------------LEPDLTLYFDVPSEIGLAR
KTHY_STRP3       GRG--LIKADIQWLNEFATDG--------------------LEPDLTLYFDVPSEIGLAR
KTHY_STRP6       GRG--LIKADIQWLNEFATDG--------------------LEPDLTLYFDVPSEIGLAR
KTHY_STRP1       GRG--LIKADIQWLNEFATDG--------------------LEPDLTLYFDVPSEIGLAR
KTHY_STRGC       GRG--LDVADIEWLNQYATDG--------------------LKPDLTLYFDLDVEEGLAR
KTHY_STRSV       GRG--LDVADIEWLNQFATDG--------------------LKPDLTLYFDIDVEEGLAR
KTHY_STRP2       GRG--LDIEAIDWLNQFATDG--------------------LKPDLTLYFDIEVEEGLAR
KTHY_STRR6       GRG--LDIEAIDWLNQFATDG--------------------LKPDLTLYFDIEVEEGLAR
KTHY_STRPN       GRG--LDIEAIDWLNQFATDG--------------------LKPDLTLYFDIEVEEGLAR
KTHY_LACLM       GRD--LGVEVVDWLNYFATDG--------------------LKPDLTLYFDIDTDVALER
KTHY_LACLS       GRD--LGVEVVDWLNYFATDG--------------------LKPDLTLYFDIDTDVALER
KTHY_LACLA       GRD--LGVEVVDWLNYFATDG--------------------LKPDLTLYFDVDTDVALER
KTHY_LACH4       GRD--LGIEEVKQINDFATGK--------------------LDPDLTFFLDIAPEIGLSR
KTHY_LACAC       GRD--LGIAKVKQINDFATDK--------------------LDPDLTFFLDIAPEIGLSR
KTHY_LACDB       GRG--LGIDEVAQINAFATGH--------------------LEPDLTIFLDLDPAQGLAR
KTHY_LACDA       GRG--LGIDEVAQINAFATGH--------------------LEPDLTIFLDLDPAQGLAR
KTHY_LACJO       GRN--LGIEEVKQINDFGTGG--------------------LEPDLTIFLDLDPAVGLAR
KTHY_CLONN       ARG--IGIDEVMAINEFAIDG--------------------YMPDLTLYLDIEPEVGLKR
KTHY_CLOB8       ARN--LGIEEVLSINKFAIGE--------------------YMPDISVLFDLDPKIGLAR
KTHY_BACHD       ARG--IGFEDILAINEFAIEG--------------------RYPDLTLLFRVDPDVGLSR
KTHY_BACVZ       ARG--LGIDEVLSINQFAIGD--------------------TMPDVTIYFSIEPEEGLKR
KTHY_BACSU       ARG--LGIDEVLSINEFAIGD--------------------MMPHVTVYFSIDPEEGLKR
KTHY_BACLD       ARG--LGIDEVFSVNQFAIGS--------------------LMPNVTIYFDIDPEEGIKR
KTHY_BACP2       ARG--LGIDQVRSINDFAIDG--------------------TMPQMTIYFSITPEEGLKR
KTHY_BACHK       ARG--LGMDKVFEINRFATED--------------------CMPSLTIYLDIEPEVGLAR
KTHY_BACAN       ARG--LGMDKVFEINRFATED--------------------CMPSLTIYLDIEPEVGLAR
KTHY_BACCZ       ARG--LGMDKVFEINRFATED--------------------CMPSLTIYLDIEPEVGLAR
KTHY_BACAH       ARG--LGMDKVFEINRFATED--------------------CMPSLTIYLDIEPEVGLAR
KTHY_BACC1       ARG--LGMDKVFEINRFATED--------------------CMPSLTIYLDIEPEVGLAR
KTHY_BACCR       ARG--LGMDKIFEINRFATED--------------------CMPSLTIYLDIEPEVGLAR
KTHY_BACCN       ARG--LGIDKVYEMNRFATED--------------------CMPSLTIYLDIAPEVGLAR
KTHY_OCEIH       ARG--LGIDEVYAINHFVIQD--------------------CMPDLTLFFDIEPKKGLER
KTHY_GEOTN       ARG--LGVEEVWKINEFAIDG--------------------YMPSLTVYFDIDPQIGLER
KTHY_GEOKA       ARG--LGIEEVWKINEFAIDG--------------------YMPSLTIYFDIDPQIGLER
KTHY_BACSK       ARG--IGMEEVRAINGFAIET--------------------YMPDLTLYFDVEPEIGLER
KTHY_STAAN       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAAM       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAAC       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAA9       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAA3       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAAR       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAA2       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAA8       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAA1       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAAB       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAAS       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAAW       ARG--IGVEEVRALNEFAING--------------------LYPDLTIYLNVSAEVGRER
KTHY_STAS1       ARG--IGIEEVKSINEFAING--------------------LYPDITIYLDVSVAVGRER
KTHY_STAHJ       ARG--IGIEEVKQLNDFAING--------------------LYPDLTIYLDITAEVGRDR
KTHY_STAES       ARG--IGIKEVKLLNEFAING--------------------LYPDLTIYLDVDAEIGRQR
KTHY_STAEQ       ARG--IGIKEVKLLNEFAING--------------------LYPDLTIYLDVDAEIGRQR
KTHY_LISMF       GRD--MNMEQVLQVNLYAIED--------------------TLPDRTYYLDVPAEVGLAR
KTHY_LISMO       GRD--MNMEQVLQVNLYAIED--------------------TLPDRTYYLDVPAEVGLAR
KTHY_LISIN       GRD--MNMEQVLQVNLYAIED--------------------TIPDRTYYLDVPAEVGLAR
KTHY_LISW6       GRD--MDMEQVLQVNLYAIED--------------------TIPDRTYYLDVPAEVGLAR
KTHY_MYCMS       ARN--IGVDVVNQVQQIVLKN--------------------CLPDLTLFFDVSFSEAEKR
KTHY_MYCCT       ARN--IGVDVVSEVQQIVLKN--------------------CLPDLTLFFDVSFSEAEKR
KTHY_MESFL       ARG--LGVDYLNELQKNILEG--------------------FLPDLTLYFELSFEDAEKR
KTHY_ONYPE       ARG--LSQDFVLNINNFALN---------------------YIPNITFYLDLDPKIGIQR
KTHY_AYWBP       ARG--LSKDFVLNINNLALN---------------------YMPNITFYLDLDPKIGIQR
KTHY_ACHLI       GRN--LGMEFVQSINSYALK---------------------YLPDLTFYIDLDPKTGIDR
KTHY_TROWT       DNK--LVETDIMRLFEFSSQG--------------------LRPDLTLLFDLTPACAQER
KTHY_TROW8       DNK--LVETDIMRLFEFSSQG--------------------LRPDLTLLFDLTPACAQER
KTHY_CHLCV       AEG--LGKEYVTSLCHHVVGEKK------------------FLPDLTCLLDIPADEGLRR
KTHY_CHLFF       AEG--LGKEYVTNLCHHVVGEKK------------------FLPDLTCLLDIPVDTGIKR
KTHY_CHLAB       VGG--LGKEYVTNLCHSVVGQKK------------------ILPNLTCLLDIPADEGLKR
KTHY_CHLPN       AEG--LGADFVADLCSKVVGPTP------------------FLPNFVLLLDIPADIGLQR
KTHY_CHLTR       AGG--LGESFVTNLCYHVVGDKP------------------FLPDITFLLDIPAREGLLR
KTHY_CHLTA       AGG--LGESFVTNLCYHVVGDKP------------------FLPDITFLLDIPAREGLLR
KTHY_CHLMU       AGG--LGEAFVTDLCYRVVGDEP------------------FLPDITFLLDLPEKEGLLR
KTHY_PARUW       ARG--LNAKKIQEFCQLVCAE--------------------ILPNWTLFLDVSPEIGLAR
KTHY_PSEPF       GRG--LSLERIAALETFVQGD--------------------LRPDLTLIFDLPVEIGLAR
KTHY_PSEF5       GRG--LSLARIAALEDFVQGE--------------------LRPDLTLVFDLPVDVGLAR
KTHY_PSEPG       GRG--LSVERIATLEQFVQGG--------------------LRPDLTLVFDLPVEVGLAR
KTHY_PSEP1       GRG--LSVERIAVLEQFVQGD--------------------LRPDLTLVFDLPVEVGLAR
KTHY_PSEE4       GRG--LSVERIAILESFVQGE--------------------LRPDLTLVFDLPVEVGLAR
KTHY_PSEMY       GRG--LSIERIAQLEQFVQGE--------------------LRPDLTLIFDLPVEVGLAR
KTHY_PSEU5       GRG--LSLERIAQLETFVQGD--------------------LRPDLTLIFDLPVDVGLAR
KTHY_PSEAE       GRG--LPEARIAALESFVQGD--------------------LRPDLTLVFDLPVEIGLAR
KTHY_PSEA7       GRG--LPEARIAALESFVQGD--------------------LRPDLTLVFDLPVEIGLAR
KTHY_PSEAB       GRG--LPEVRIAALESFVQGD--------------------LRPDLTLVFDLPVEIGLAR
KTHY_PSESM       GRG--LSHERIAALEQFVQGD--------------------LRPDLTLVFDLPVEIGLSR
KTHY_PSEU2       GRG--LSHQRIAALEQFVQGD--------------------LRPDLTLVFDLPVEIGLSR
KTHY_PSE14       GRG--LSQQRIAVLEEFVQGD--------------------LRPDLTLVFDLPVEIGLSR
KTHY_ALCBS       GRG--LDSAAIAALEALVIRD--------------------TRPDMTILFDVPVEVGMAR
KTHY_CHRSD       GRG--LDETRIATLEALVQQG--------------------LQPDLTLLLDMPVEAAQRR
KTHY_METCA       GRG--IAPGVIDFLRDWIQAG--------------------LRPDLTLLLDAPVDTGLKR
KTHY_ALKEH       GRG--LGAERIAALEDWTQGA--------------------LRPDLTLWLDVPVETGLAR
KTHY_VESOH       GRG--LSIERIALLEQWVLQD--------------------FSPDVTLLLDVPVALGMLR
KTHY_RUTMC       GRG--LSIERITQLEKWVLQD--------------------FTPDVTLLLDVSVALGMSR
KTHY_MARMS       ARG--GDIAMLDQLANWVVGD--------------------NKPDATLVLDVPVELGQER
KTHY_COXBU       GRG--IPVKHIEELAGWVLGN--------------------LKPDLTLLLDAPVSVGLCR
KTHY_NITEU       GRG--VAQSKLDNLEQWVQAE--------------------LSPDLTVYFDVPVIVGRER
KTHY_NITEC       GRG--VPSARLEILEQWVQKG--------------------FSPDLTVYFDVPVTISRQR
KTHY_NITMU       GRG--LSLQKLNELECWVQGE--------------------FQPDVTLYLDVSIASGRQR
KTHY_BORBR       GRQ--LGAARVAALEQWVHPD--------------------LQPDRTWLFDVPLDVARAR
KTHY_BORPE       GRQ--LGAARVAALEQWVHPD--------------------LQPDRTWLFDVPLDVARAR
KTHY_BORPA       GRQ--LGAARVAALEQWVHPD--------------------LQPDRTWLFDVPLDVARAR
KTHY_DECAR       GRG--LDRAKFLALEHWVHGH--------------------LQPDLTLLFDLPLDVARER
KTHY_BURCH       GRG--LPRDKLETLERWVQGG--------------------FQPDLTVLFDVAPQVASER
KTHY_BURCA       GRG--LPRDKLETLERWVQGG--------------------FQPDLTVLFDVAPQVASER
KTHY_BURCM       GRG--LPRDKLETLERWVQGG--------------------FQPDLTVLFDVAPQVASER
KTHY_BURL3       GRG--LPRDKLETLERWVQGG--------------------FQPDLTVLFDVAPQVASER
KTHY_BURVG       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVAPQVASER
KTHY_BURM9       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURP6       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURMS       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURM7       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURMA       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURP1       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURPS       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURP0       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVQPQVASAR
KTHY_BURTA       GRG--LPRDKLEALERWVQGG--------------------FQPDLTVLFDVPPQIASAR
KTHY_PARXL       GRG--LPRDKLETLERWVQGG--------------------FQPDLTVLFDLDPEVASER
KTHY_RALSO       GRG--LAIERLEALEQWVQQG--------------------LQPTRTLLFDLAPEVAAAR
KTHY_HERAR       GRK--LDRQKLSVLEQWVHPH--------------------LQPDLTLLFDVPLDVARAR
KTHY_JANMA       GRK--LDRAKLNALEQWVHPH--------------------LQPHLTLLFDVPLDVARAR
KTHY_NEIG1       GRG--MPSEDIEILEHWVQGG--------------------LRPDLTLLLDVPLEVSMAR
KTHY_NEIMB       GRG--MPSEDIEILEHWVQGG--------------------LKPDLTLLLDVPLEVSMAR
KTHY_NEIMA       GRG--MPSEDIEILEHWVQGG--------------------LRPDLTLLLDVPLEVSMAR
KTHY_NEIMF       GRG--MPSEDIEILEHWVQGG--------------------LRPDLTLLLDVPLEVSMAR
KTHY_CHRVO       GRG--VPFERIRALEDWVQRG--------------------LQPDLTLLFDLPTEVAAGR
KTHY_HALHL       GRG--LGDERIAVLERWVHGG--------------------FTPDRTLLLDVDPTVGRSR
KTHY_DICNV       GRG--IDLKIIKTLEQIIQAS--------------------FQPDLACILCLPEHIAAER
KTHY_ACISJ       GRG--FDLEVLSYMERLAQTGVGL------------QPDLMRNPDLTLWFDVPPEVAAQR
KTHY_ACIAC       GRG--FDRAVLAQLERITQSGLQE------------GTDAVLHPHLTLWFDLAPDVAAAR
KTHY_RHOFT       GRG--FDLKILSFLERTVQSIQGL------------EPDFIRNPDLTVWFDLAAAIAAQR
KTHY_POLSJ       GRG--FDLAVLATLEQWVQSDEGLLGDPAGNFPMKPEVETVIEPHLTVWFDLPPEEAALR
KTHY_VEREI       GRG--FDHETLSILERMTNTAAAH------------KDGLLPEPELTLWFDLAPELAAER
KTHY_ACIAD       GRG--LSKDKLNTLNQTFVS---------------------HMPDITFWLDAPIELGMSR
KTHY_SALTY       GRG--IDQTMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SALTI       GRG--IDQTMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SALPA       GRG--IDQTMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SALCH       GRG--IDQTMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SALPB       GRG--IDQTMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SALAR       GRG--IDQTMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECOUT       GRG--IDQHMLATLRDAVLGG--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECOK1       GRG--IDQHMLATLRDAVLGG--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECOL6       GRG--IDQHMLATLRDAVLGG--------------------VRPDLTLYLDVTPEVGLKR
KTHY_SHIDS       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SHIBS       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECOHS       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SHIFL       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SHIF8       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECOLC       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECOLI       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_SHISS       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECO24       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECOL5       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ECO57       GRG--IDQHMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_CITK8       GRG--IDQTMLATLRDAVLGD--------------------FRPDLTLYLDVTPEVGLKR
KTHY_ENT38       GRG--IDQQMLATLRNAVLGD--------------------FRPNLTLYLDVTPEVGLKR
KTHY_KLEP7       GRG--IDRTMLATLRDAVLGD--------------------FRPNLTLYLDVTPEVGLQR
KTHY_CROS8       GRG--IDRQLLATLRQAVLGD--------------------FAPDLTLYLDVDPRIGLER
KTHY_YERP3       GRG--IDSQLMASLRDTVLGE--------------------FRPDLTLYLDLPPAVGLAR
KTHY_YERPS       GRG--IDSQLMASLRDTVLGE--------------------FRPDLTLYLDLPPAVGLAR
KTHY_YERPA       GRG--IDSQLMASLRDTVLGE--------------------FRPDLTLYLDLPPAVGLAR
KTHY_YERPP       GRG--IDSQLMASLRDTVLGE--------------------FRPDLTLYLDLPPAVGLAR
KTHY_YERPN       GRG--IDSQLMASLRDTVLGE--------------------FRPDLTLYLDLPPAVGLAR
KTHY_YERPE       GRG--IDSQLMASLRDTVLGE--------------------FRPDLTLYLDLPPAVGLAR
KTHY_YERE8       GRG--IDINLMTSLRDTVLGE--------------------FRPDLTLYLDLPPVIGLAR
KTHY_SERP5       GRG--VDQQLMASLRDTVLGE--------------------FRPDLTLYLDLPPIVGLQR
KTHY_PHOLL       GRG--IDKNLMTSLRDTVLGD--------------------FRPDLTIYLDLPPQIGLLR
KTHY_PECAS       GRG--IDQQLLRSLRDTVLGN--------------------FRPDLTLYLDLPPAIGLQR
KTHY_SODGM       GRG--MDARLLQTLRDAVLGD--------------------FRPDLTLYLDIPPALGLAR
KTHY_VIBC3       GRQ--IAPSTMQSLKQTALGD--------------------FKPDLTLYLDIDPKLGLER
KTHY_VIBCH       GRQ--IAPSTMQSLKQTALGD--------------------FKPDLTLYLDIDPKLGLER
KTHY_VIBPA       GRQ--IDASLMKNLRDTTLGD--------------------FKPAFTLYMDIDPRIGLER
KTHY_VIBCB       GRQ--IDASLMKNLRDTTLGE--------------------FKPAFTLYMDIDPRVGLER
KTHY_VIBVY       GRQ--IDATLMKNLRDTALGE--------------------FKPAFTLYMDIDPKVGLER
KTHY_VIBVU       GRQ--IDATLMKNLRDTALGE--------------------FKPAFTLYMDIDPKVGLER
KTHY_ALIF1       GRG--FDRELMMTMRNTVLGD--------------------FKPDLTIYMDIDPKLGLQR
KTHY_PHOPR       GRG--FDKALMENLRDTVLGD--------------------FCPDLTIYMDIDPILGLER
KTHY_HAES1       GRG--LDQHLMTTLKNAVLGD--------------------FKPDFTLYLDIEPEIGLAR
KTHY_HISS2       GRG--LDRHLMTTLKNAVLGD--------------------FKPDFTLYLDIEPEIGLAR
KTHY_MANSM       GRQ--IDSHLLETLKKTVLGD--------------------FEPDFTLYLDLSPAIGLAR
KTHY_HAEIN       GRQ--LDPHFMLTLKETVLGN--------------------FEPDLTIYLDIDPSVGLAR
KTHY_PASMU       GRQ--LDQHLLHTLKQTILGE--------------------FEPDLTLYLDIDPVLGLSR
KTHY_HAEDU       GRQ--LDVALLNSLKESVLGP--------------------FEPDLTIYLDIDPAIGLAR
KTHY_WIGBR       GRK--IDTKILKMLREVFLRD--------------------FYPDLTFYLDIPPIMGLAR
KTHY_BAUCH       GRG--IDIRLLQNLRDAALGK--------------------FYPDLTIYLDLPPSKCRAR
KTHY_SHESR       GRG--L-MPLVEAVSNATLKG--------------------FKPDLTLYLDLDPKLGLQR
KTHY_SHESM       GRG--L-MPLVEAVSNATLKG--------------------FKPDLTLYLDLDPKLGLQR
KTHY_SHESA       GRG--L-MPLVEAVSNATLKG--------------------FKPDLTLYLDLDPKLGLLR
KTHY_SHEON       GRG--L-MPLVEAVSNATLKG--------------------FKPDLTLYLDLDPKLGLQR
KTHY_SHELP       GRQ--L-MPLVEAVSQATLKD--------------------FKPDLTLYLDIDPQLGLQR
KTHY_SHEFN       GRG--L-MPLVKAVSDACLRG--------------------FKPDLTLYLDIDPTLGLSR
KTHY_SHEAM       GRG--L-MSLVKTISDATLGG--------------------FKPDLTLYLDIDPLLGLER
KTHY_PSEHT       GRG--ISANTLASLSSMVLKG--------------------LKPDLTIYLDIDPVIGLER
KTHY_COLP3       GRG--FDETIMNTISDITLKG--------------------FRPDITLYLDIDPHIGLSR
KTHY_IDILO       GRE--LGDELLQKIRKITLGN--------------------FTPDLTLLLDVEEKKGLER
KTHY_LEGPH       GRK--MDMRVINELSNFCLKG--------------------FKPDLTLYLDINPELGMIR
KTHY_LEGPL       GRK--MDMRVINELSNFCLKG--------------------FKPDLTLYLDINPELGMIR
KTHY_LEGPA       GRK--MNMRVINELSNFCLKG--------------------FKPDLTLYLDINPELGMIR
KTHY_LEGPC       GRK--MDMRVINELSNFCLKG--------------------FKPDLTLYLDINPELGMIR
KTHY_BLOPB       GRG--IDILLLHALSNKITNT--------------------LSPDLTFYLDISPELSISR
KTHY_BLOFL       GRK--LNSVLLNMLSQYVIND--------------------FFPKLIFYLDIPSELVLSR
KTHY_BUCAI       GLG--IPKKIIYQLQSLFLNN--------------------FIPDLTIYLDVSPEIGLAR
KTHY_BUCAP       GLG--IKRKLINKLKYLFLQD--------------------FIPDLTIYLDVYPEIGLKR
KTHY_BUCBP       GRK--IKEEIVLLLQSLFLKN--------------------FNPNITFYLDVTPEIGLNR
KTHY_FRAT1       GRG--VELSKIRALNDNFLNG--------------------CEPDLVIYLDIDPILGLQR
KTHY_FRATW       GRG--VELSKIRALNDNFLNG--------------------CEPDLVIYLDIDPILGLQR
KTHY_FRATT       GRG--VELSKIRALNDNFLNG--------------------CEPDLVIYLDIDPILGLQR
KTHY_FRATN       GRG--VELSKIRALNDNFLNG--------------------CEPDLVIYLDIDPILGLQR
KTHY_FRATF       GRG--VELSKIRALNDNFLNG--------------------CEPDLVIYLDIDPILGLQR
KTHY_FRATH       GRG--VELSKIRALNDNFLNG--------------------CEPDLVIYLDIDPILGLQR
KTHY_FRATO       GRG--VELSKIRALNNNFLNG--------------------CEPDLVIYLDIDPILGLQR
KTHY_WOLTR       GLG--VDLELIRDLHKLVKIKY---------------------PDTTFILDIDVQIGLSR
KTHY_WOLPM       GFG--VDLRLIRDLHKLVEIKY---------------------PDITFILDIDVKVGLNR
KTHY_EHRCR       GQG--IDCSLIDQLNDLVIDVY---------------------PDITFIIDVDINESLSR
KTHY_EHRCJ       GQG--IDCNLICQLNDLVVDMY---------------------PDITFVIDVDVHESLSR
KTHY_EHRRW       GHG--IDCKLIEELNDLVVDIY---------------------PNITFVLDSDINQSVAR
KTHY_EHRRG       GHG--IDCKLIEELNDLVVDIY---------------------PNITFVLDSDINQSVAR
KTHY_ANAMM       GCG--VDLALVGMLNSLVADVV---------------------PDITFVIDASIELALAR
KTHY_ANAPZ       GCG--IDLDLIYKLNSLVMGIV---------------------PDMTFIIDIDIEKALSR
KTHY_NEOSM       GDK--IDLQTILDLHRLSGCLVE--------------------PDLTLLLLGSGHKKLGR
KTHY_RICRO       ELE--NGIDLVYNLHKTLMPSLM--------------------PDITFFIDVEPDTAIKR
KTHY_RICRS       ELE--NGIDLVYNLHKTLMPSLM--------------------PDITFFIDVEPDTAIKR
KTHY_RICCN       ELE--NGIDLVYNLHKTLMPSLM--------------------PDITFFIDVEPDTAIKR
KTHY_RICM5       ELE--NGIDLVYNLHKTLMPSLM--------------------PDITFFIDVEPDTAIKR
KTHY_RICFE       ELE--NGIDLVYNLHKTLMPSLM--------------------PDITFFIDVEPDTAIER
KTHY_RICCK       ELE--NGIDLVYNLHKTLMPPLM--------------------PDITFFIDVEPDTAIKR
KTHY_RICAH       ELE--NGIDLVYNLHKILMPSLM--------------------PEITFFIDVEPDTAIER
KTHY_RICPR       ELE--NGIDLVYSLHKTLMPSLM--------------------PDITFFIDVEPHTAIKR
KTHY_RICTY       ELE--NGIDLVYSLHTTLMPSLM--------------------PDITFFIDVEPDTAIKR
KTHY_RICB8       ELE--NGIELVYNLHKDLMPPLM--------------------PDLTFFIDVESSIAIER
KTHY_RICBR       ELE--NGIELVYNLHKDLMPPLM--------------------PDLTFFIDVESSIAIER
KTHY_ORITB       NSE--EQ-QLILELHRKLLDNFF--------------------PDLTLIINVSPSIAMQR
KTHY_MYCS5       GRN--LGMEFTKTLTELAVGK--------------------TIPNLTFFFDISPFETRKR
KTHY_MYCPU       GRD--LGFEKIKLLNELATDK--------------------KYPDITFILKISYEESMER
KTHY_UREPA       VQN--QSLDVIYQINQQAIGE--------------------LEIDYVFYFDVNVNNALNR
KTHY_UREP2       VQN--QSLDVIYQINQQAIGE--------------------LEIDYVFYFDVNVNNALNR
KTHY_MYCMO       ARG--LGVKVVKEINDIATSN--------------------FMPDYTFFLSISEEESIIR
KTHY_MYCHJ       GNG--LDIDLVTSLNSLISEN--------------------TFPDLTIFLDIKISKAFER
KTHY_MYCH2       GNG--LDIDLVTSLNSLISEN--------------------TFPDLTIFLDIKISKAFER
KTHY_MYCH7       GNG--LDIDLVTSLNSLISEN--------------------TFPDLTIFLDIKISKSFER
KTHY_MYCPN       IKK--VGLDVVKKLNADAVGD--------------------SMPDFTFIVDCDFETALNR
KTHY_MYCGE       SKK--IGIDTVKQINHHALRN--------------------MMPNFTFILDCNFKEALQR
KTHY_MYCGA       IKN--AGYEKVKKINEYVTDG--------------------LEPDLTILFDVDPEIAAKR
KTHY_MYCPE       VKN--LGYKNVYKVNQFGISK--------------------IKPDIVFYFSANPKVLLER
KTHY_CAMJR       -KD--FENDLLFALNSFALENF-------------------FPQ-KIIFLKGDANLIQER
KTHY_CAMJE       -KD--FENDLLFALNSFALENF-------------------FPQ-KIIFLKGDANLIQER
KTHY_CAMJJ       -KD--FENDLLFALNSFALENF-------------------FPQ-KIIFLKGDANLIQER
KTHY_CAMJ8       -KD--FENDLLFALNSFALENF-------------------FPQ-KIIFLKGDANLIQER
KTHY_CAMJD       -KD--FENDLLFTLNSFALEDF-------------------FPQ-KIIFLKGDENLIQER
KTHY_CAMC1       DEN--LDENVLLELNKFALNDK-------------------FAD-KIIFFEASRELISSR
KTHY_CAMHC       EQN--LDINDLINLNKIALGGK-------------------IPNAKFIFLKISKDNLRFR
KTHY_SULDN       QGE--ISETAILHLNRFATGGI-------------------YPQ-KIFLLQLTNEELSLR
KTHY_HELHP       -KS--IDIAQSIALNDFVLRGM-------------------LPD-LVVILELDEKSLKER
KTHY_HELPJ       -------QFSSLELNLLATQSV-------------------LPE-KIILLLINKENLKQR
KTHY_HELPY       -------QFSSLELNLLATQSV-------------------LPA-KIILLLIDKEGLKQR
KTHY_HELPH       -------EFSSLELNLLATQSV-------------------LPA-KIILLVIDKEGLKQR
KTHY_HELAH       -------AFSSLELNLLATQSI-------------------LPA-KIILLWIDKEGLKER
KTHY_METMA       LKS--RFENPLEWVRSLHSGWTV-------------------VPDLTFLFDIEPEIAVER
KTHY_METAC       LKN--RLDNPLEWVRDLHRGWTV-------------------IPDLTFLFDIEPEIAVKR
KTHY_METBF       LKT--RLENPLEWVKDLHRSWTI-------------------VPDLTFLFDIRPEISIER
KTHY_METBU       LKE--RMEEPMEWIQMIHRGWTI-------------------IPDLTLLFDIDPAVAVQR
KTHY_HALSA       LAD--TVPRAMEYVRGIHQPWTR-------------------PPDVTLYFDVDPDTGAAR
KTHY_HALMA       LAGSGTFDDPLSYVREVHAPWTR-------------------PPDRTVYLDLDPETAARR
KTHY_NATPD       LEG--VIDEPMAYVKRVHEPFTR-------------------PPDATLYFDVPPTVGAER
KTHY_METHJ       LDG--IIPDPRTWLRAVHQGWTI-------------------MPDLTILLAVPVPVALER
KTHY_METLZ       LIG--IVPDPKAWLTAVHAGWSV-------------------RPDLTILLLISPETAMNR
KTHY_METMJ       LDG--VLPDPLSWLRRIHEGWSI-------------------RPDRTFLLVLPVEDAVSR
KTHY_PYRAB       -RG--LSLEWLMQINS--FAPR---------------------PDLAILLDLPVKESIRR
KTHY_PYRHO       -RG--LDLNWLIQVNS--FAPR---------------------PDLAILLDLPVKESLRR
KTHY_PYRFU       -RG--LNLEWLIEINK--FAPH---------------------PDIAILLDIPPREGIKR
KTHY_THEKO       -RG--LDLEWLIDLNR--FAVK---------------------PDIVFLLDLPVKESMNR
KTHY_XANOR       -AG--LPLDELLELNA--FAPR---------------------PDVLLLLDLPPPTGLAR
KTHY_XANOM       -AG--LPLDELLELNA--FAPR---------------------PDVLLLLDLPPPTGLAR
KTHY_XANAC       -AG--LPLDELLERNA--FAPR---------------------PDVLLLLDLPPPTGLAR
KTHY_XANC5       -AG--LPLDELLERNA--FAPR---------------------PDVLLLLDLPPPTGLAR
KTHY_XANCP       -AG--LPLDALLAAND--FAPR---------------------PDLLLLLDLPPPTGLAR
KTHY_XANC8       -AG--LPLDALLAAND--FAPR---------------------PDLLLLLDLPPPTGLAR
KTHY_XYLFA       -AG--LPVDALLEANA--FAPR---------------------PDVLLLLDVPPAIGLQR
KTHY_XYLFT       -AG--LPVDALLEANA--FAPR---------------------PDVLLLLDVPPVIGLQR
KTHY_DESPS       -LG--FDVEEILQRNS--FAPT---------------------PDLALLLQIPVEDGRRR
KTHY_LEPBJ       -DD--LLPETIIEKNLKKNFKI---------------------PDLLFYLDLNPAIALER
KTHY_LEPBL       -DD--LLPETIIEKNLKKNFKI---------------------PDLLFYLDLNPAIALER
KTHY_LEPIC       -DD--LSPEMILKKNLNRNFKI---------------------PDLLFYLDLSPSIALER
KTHY_LEPIN       -DD--LSPEMILKKNLNRNFKI---------------------PDLLFYLDLSPSIALER
KTHY_ARCFU       -RG--IDARLIREMNEKIAPK----------------------PDLTILLDVEPEIALER
KTHY_PYRCJ       GVP----IEYILYINSVVPRP-----------------------HLTIILDVDPAEAIKR
KTHY_PYRAE       GVS----REFVKYINSLVPKP-----------------------DLTIILDVDPSIAEAR
KTHY_STAMF       GAP----IEWVLEINKYALKP-----------------------DLTIYLDVDPAIGVKR
KTHY2_SACS2      NVD----FDWVKRLYSFAIKP-----------------------NFTFYIRVTPEIALER
KTHY2_SULTO      GVD----IDWVKKLYSFAIKP-----------------------DITFYIRVSPDIALER
KTHY_THEVO       AAAALGSEEKAKEWMDCVSNIIT------------------IRPDINILVQVDVQVGLDR
KTHY_THEAC       IAEFFGNSEKAWEWMDSVSEIIK------------------IRPDVQIYVDVDEETAMER
KTHY_PICTO       MEKRFKNMDETISWMLDVSRFI-------------------IMPDLIIYLKIDPGIALKR
KTHY_SYNY3       EAD----WEFVQRLNQSFPQP-----------------------DWVIYLDLPVDLALQR
KTHY_METKA       GAD----MRWLLELQRPVPKP-----------------------DVVYIIDREPLAEDAT
KTHY_MYCTU       ENAAGKAAAWVQRIEFARLGLP--------------------KPDWQVLLAVSAELAGER
                                                                             

KTHY1_SACS2      IKN--D------------------------KFNFEEKIKSLAKVREKYLKLAK-----EY
KTHY_SULAC       IKNKVD------------------------KFNFDEKISTLSKVREKYLELAK-----RN
KTHY1_SULTO      IRKD-D------------------------QFNFEEKIATLEAVRKKYLELAR-----KY
KTHY_METS5       LRNKRD------------------------SLDFEEKRKSLHQVRENYLSLAR-----RY
KTHY_METM7       MESRE-------------------------KEIFEKI-EIQKKIKEGYYSLINSENEKFM
KTHY_METM5       MESRE-------------------------KEIFEKI-EIQKKIKEGYYNLINSEDKKFM
KTHY_METMP       MESRE-------------------------KEIFEKL-EFQKKIKEGYYNLINSENGKFM
KTHY_METVS       MEFRE-------------------------KEIFEKI-EFQKKIKQEYHKIAELKCSKFE
KTHY_META3       MGDRDS------------------------KEIFENK-EILQKVNKKYMNIINER--LFE
KTHY_METJA       VKTKD---------------------------IFEKK-DFLKKVQDKYLEL--------A
KTHY_METS3       CSKED---------------------------EFENE-EFLSKVKANYLDLIS------N
KTHY_METTH       CGGTD---------------------------EFEDP-LYLAGVRERYLELAD------K
KTHY_METST       CDKID---------------------------TFENK-EFLEKTRENYLKLVKT-----E
KTHY_BDEBA       RQGR-GAVTGE-----------------TEDRIESEADTFHENVRQSFLKQSRE---D-A
KTHY_RHOBA       --------VGG-----------------EADRMESRGVDYMAKVRQAFLDELPN---A-G
KTHY_GEOSL       AAARINSRQTN-----------------REERFERESLLFHERVREGFLSLAGG---E-P
KTHY_GEOUR       AFDRINGAAGA-----------------REERFELESVLFHRKVRDGYLKLAED---E-P
KTHY_PELPD       ARRRIETASGP-----------------REERFELEALEFHRSVREAYLELAHA---E-P
KTHY_PELCD       ARSRNALGAGP-----------------EEGRFEQESLAFHNKVRQGYLDLARQ---E-P
KTHY_MAGMM       SKRR-----GG-----------------QEQRFEQEALSFHQQVRQAFLQMAQQ---E-P
KTHY_AGRFC       ARKRADEGA-------------------TPDRFEKEEIETHEKRREAYLDIALA---E-P
KTHY_RHIME       ARRRAAND--------------------SPDRFEKEQLETHEKRREAFLDIAAA---D-P
KTHY_RHILO       ATLRRGSDA-------------------GADRFEKETLAIHQARRAAFLAIAAA---E-P
KTHY_BRUO2       AGKRRGSD--------------------TADRFEKEDIAVHEARRQAFLEIARQ---E-P
KTHY_BRUME       AGKRRGSD--------------------TADRFEKEDIAVHEARRQAFLEIARQ---E-P
KTHY_BRUSU       AGKRRGSD--------------------TADRFEKEDIAVHEARRQAFLEIARQ---E-P
KTHY_BRUC2       AGKRRGSD--------------------TADRFEKEDIAVHEARRQAFLEIARQ---E-P
KTHY_BRUSI       AGKRRGSD--------------------TADRFEKEDIAVHEARRQAFLEIARQ---E-P
KTHY_BRASO       ASARRGSG--------------------APDRFESEDIKFHKGLRDAFHKIAAT---E-P
KTHY_BRASB       AAARRGAG--------------------APDRFEAEDIKFHKGLRDAFHKIADD---D-P
KTHY_NITHX       AAVRRGSG--------------------APDRFEAEDVAFHQKLRDAYRDIAAS---D-P
KTHY_NITWN       AAARRGSG--------------------APDRFEAEDIAFHRKLRDAYRAIAAS---D-P
KTHY_BRADU       AAARRGSG--------------------TPDRFEGEQLSFHQGLREAYRKIAAD---E-P
KTHY_RHOPB       ARLRRGAA--------------------EPDRFEAESLEFHRKLREAYRQIAAD---E-P
KTHY_RHOPA       AAVRRGSE--------------------TPDRFESEAIDFHRGLREVFRQIAAQ---E-P
KTHY_BARQU       ANLRRKKAE-------------------TIDYFEKDELKIQEQRRQAFLQLAKQ---E-P
KTHY_BARHE       ANLRREKAE-------------------TIDYFEKDELKIQEQRRQAFLQLAKQ---E-P
KTHY_CAUVC       AEAR-GGA----------------------ARFESKGLAFHERLRAGYLEIARR---E-P
KTHY_JANSC       GLARDSGE----------------------DRFEDFGLPFQQKLRAGFQALARE---Y-P
KTHY_SPHWW       QAEAGIAN---------------------SDRFEKRDEAFHDRVADSFRRIAAQ---E-P
KTHY_RHOS1       SRRRLTGETL------------------DEGRFESLDLAFHERIRAAFLAQAAR---D-P
KTHY_RHOS4       SRRRLTGETL------------------DEGRFESLDLAFHERIRAAFLAQAAR---D-P
KTHY_SYMTH       ARRT----------------------GEEADRIERQSREYHQLVREGYLDLARA---E-P
KTHY_PELTS       MARS----------------------GRSADRIEREAQEFYRRVRSGYLALAAR---A-P
KTHY_ROSCS       KRRKHPGARLMGQRGVD---------Q-EWNRLDARELEYHQRVEAGYRALIAQ---D-P
KTHY_ROSS1       KRRK--GARSTGQRGAN---------NDEWNRLDARELEYHQRVEAGYRELIAA---D-P
KTHY_DESRM       SRKD---------R--------------PADRLENESLTFYHKVRSGYLEMAKR---K-P
KTHY_THEMA       K--G------------------------ELNRFEK--REFLERVREGYLVLARE---H-P
KTHY_THEP1       K--G------------------------ELNRFEK--REFLERVREGYLVLAKE---H-P
KTHY_THEM4       MKEK------------------------EKDRIEKEGEDFLEKVRTTYLHIAKS---R--
KTHY_FERNB       MKNQ------------------------HKDRIEKEGKEFWESIRNCYLKMAKE---N--
KTHY_AQUAE       LK--------------------------EKNRFEN--KEFLEKVRKGFLELAKE---E--
KTHY_CALS4       RQGK------------------------KADRLEGEDYEFHKKVREGYLRLVKD---F-P
KTHY_PELLD       KFSEKSLPLAFENE--------------ELDRMERSGLEFYRNVRQGYLDIIEA---E-P
KTHY_CHLPM       KFSEKSIPLAFDND--------------ELDRMERSGLDFYRKVYEGYRCIMQE---E-P
KTHY_CHLPD       KNSKKSLPLAFENS--------------DLDRMERSGLEFYSKVRNGYFEIIRS---E-Q
KTHY_CHLTE       KFSEKSLPLAFESE--------------ELDRMENSGLDFYRRVREGYHKIGGE---N-P
KTHY_CHLCH       AFSRSGLPLDFAAQS------------NESDRMEQAGIAFYHKVRNGYLTLMQQ---H-P
KTHY_DEHMB       KGELP------------------------PDRFESENNGFHQRVRNGFGAIYAT---E-P
KTHY_DEHMC       KGELP------------------------PDRFESENNGFHQRVRNGFGAIYAT---E-P
KTHY_DEHM1       KGKLP------------------------PDRFESENNGFHQRVRDGFGVIAAA---E-P
KTHY_NOSS1       KRGDN----------------------VGLDRIEQETIAFHRRVQQGYADLAAS---S-P
KTHY_TRIV2       KRGEN----------------------VGLDRIEQETIAFHRRVQQGYANLAAS---S-P
KTHY_ACAM1       THDREQDP------------------EIETDRMEANEIAFHQRLRQGFADLARQ---H-P
KTHY_TRIEI       AKSRG-----------------------NFDRMEQANIEFHRRVQQGYQELAKN---N--
KTHY_THEEB       TQQRG-----------------------RGDRLEQNAVAFHERVRQGFLALAQQ---G-S
KTHY_SYNSC       RLGDK------------------------EDRIEAEGAAFLERVAQGFAQLAEH---R--
KTHY_SYNPX       RQGDQ------------------------ADRIEAEGQVFLQRVIDGFAAIAEQ---R--
KTHY_SYNS9       RHGEK------------------------EDRIEAEGRAFLRRVADGFAVLAEQ---R--
KTHY_PROMM       RDARS------------------------NDRIEAEGVDFLTRVATGFAVLARE---R--
KTHY_PROM3       RDARS------------------------NDRIEAEGVDFLTRVATGFAVLARE---R--
KTHY_SYNPW       REERT------------------------EDRIEAEGQAFLARVADGFRQLAAE---R--
KTHY_SYNR3       RSGQQ------------------------QDRIEAEGLAFLARVHQGFAELSQR---P--
KTHY_SYNS3       RGSRE------------------------EDRIEAEGLAFLERVSEGFSDMCKA---R--
KTHY_PROMT       RRNRK------------------------DDRIEKEGREFLSNVSLGFQALSED---S--
KTHY_PROM1       RRNRK------------------------DDRIEKEGREFLSNVSLGFQALSED---S--
KTHY_PROMA       RENTR------------------------KDRIESEGEIFLKRVSDGFSYIAKN---D--
KTHY_PROMS       RKNEI------------------------PDRIESEGIRFLEKVNEGFKLIAKQ---K--
KTHY_PROM0       RKNEI------------------------PDRIESEGIRFLERVNEGFKLIAKQ---K--
KTHY_PROM9       RKNEI------------------------PDRIESEGIRFLEKVNEGFKLIARE---K--
KTHY_PROM2       RKNQI------------------------PDRIESEGIEFLEKVNKGFKIIAKE---K--
KTHY_PROM5       RKNFV------------------------PDRMESEGINFLQKVNEGFKLIAKE---K--
KTHY_PROMP       REKFI------------------------PDRMESEGIKFLEKVNEGFKLIAKE---K--
KTHY_CARHZ       VKGRG-----------------------EYDRLERETLEFHQRVREGFLQLARD---Q--
KTHY_THET8       VRR--------------------------PDRLEGLGLEFFRRVREGYLALARA---E-P
KTHY_THET2       VRR--------------------------PDRLEGLGLEFFRRVREGYLALARA---E-P
KTHY_DEIRA       AARRG-----------------------QPDRLEQADLTFHRRVRQGFLDLAHA---E-P
KTHY_CLAMS       LDAART----------------------RFDRLEAERADFHERVRQAFLGLAAA---E-P
KTHY_CLAM3       LDAART----------------------RFDRLESERADFHERVRQAFLGLAGA---E-P
KTHY_LEIXX       LGSART----------------------RYDRLEAERSEFHARVRAAYLALAAE-----P
KTHY_BIFLO       LEHAE-------------------------DRMESAGDDFQSRTRQAFLDLAAA---E-P
KTHY_BIFAA       LQHAE-------------------------DRMEAAGNDFQRRTRVAFLDLAER---E-P
KTHY_CUTAK       IAAKD--------------------------RLEAAGDEFHLRVRQHFLDLAAA---H-P
KTHY_DESVH       ALARNIREGM----------------HAAEGRFEAESLAFHTRVREGYLTWAAL---H-G
KTHY_DESVV       ALARNIREGM----------------HAAEGRFEAESLAFHTRVREGYLTWAAL---H-G
KTHY_DESAG       ATTRNLREGT----------------GATEGRFEAESLAFHTRVREGYLTWAAL---N-K
KTHY_LAWIP       ACIRNEALGL----------------NIVEGRFESEPMDFHNRIRDGFLHWAGR---N-P
KTHY_GLOVI       RLASN---------------------GNTPDRIEAETLAFHQRVHMGFAALANR---Y-P
KTHY_LACSS       IKQHRQNQ---------------------YDRLDQEKLAFHQKVRQSYLKLAQA---H-P
KTHY_LACPL       IQQHRQNE---------------------INRLDVEALSFHHRVQAAYLRLLAD---H-P
KTHY_LACBA       IQAHRDPQK--------------------VDRLDVEQAAFHDRVRAAYLRLQAA---H-P
KTHY_PEDPA       IMTHRTED---------------------VDRLDLEQLDFHQRVRSAYLDLAKK---F-P
KTHY_LACP3       IKSHQNERQ--------------------YDRLDQESLAFHERVHDAYMTLIVD---N-P
KTHY_ENTFA       IQENRTQQ---------------------IDRLDSEGLEFHQRVRHEYLKLAEE---N-P
KTHY_LACS1       ISNNRQNQ---------------------VDRLDKESMDFYHKVRQAYLSLAES---N-K
KTHY_LEUMM       VNENRQGK---------------------IDRLDKESISFHQKVRETYLKLQSE---F-S
KTHY_LACRD       IAEHRSNQ---------------------VNRLDEEKLEFHRTVRQSYLKLYQN---Y-P
KTHY_OENOB       IMKHRSDE---------------------VNRLDKDRLVFHKKVRQTYLQLAKD---Q-P
KTHY_STRA5       IQKSVQRE---------------------VNRLDLEQLDMHQRVRQGYLELADS---E-P
KTHY_STRA3       IQKSVQRE---------------------VNRLDLEQLDMHQRVRQGYLELADS---E-P
KTHY_STRA1       IQKSVQRE---------------------VNRLDLEQLDMHQRVRQGYLELADS---E-P
KTHY_STRTD       IAANGERE---------------------VNRLDLEKLDMHQRVRQGYLDLAEA---E-P
KTHY_STRT2       IAANGERE---------------------VNRLDLEKLDMHQRVRQGYLDLAEA---E-P
KTHY_STRT1       IAANGERE---------------------VNRLDLEKLDMHQRVRQGYLDLAEA---E-P
KTHY_STRMU       IEKNKERE---------------------VNRLDLEQLDMHRRVRSGYLKLAQE---N-P
KTHY_STRPG       INANQQRE---------------------VNRLDLETIEIHQRVRKGYLALAKE---H-P
KTHY_STRP8       INANQQRE---------------------VNRLDLETIEIHQRVRKGYLALAKE---H-P
KTHY_STRP3       INANQQRE---------------------VNRLDLETIEIHQRVRKGYLALAKE---H-P
KTHY_STRP6       INANQQRE---------------------VNRLDLETIEIHQRVRKGYLALAKE---H-P
KTHY_STRP1       INANQQRE---------------------VNRLDLETIEIHQRVRKGYLALAKE---H-P
KTHY_STRGC       IAKNKNRE---------------------VNRLDLEGLEMHQRVRQGYLYSLEK---D-P
KTHY_STRSV       IAKSESRE---------------------VNRLDLEGLDLHQRVRQGYLAILDK---E-P
KTHY_STRP2       IAANSDRE---------------------VNRLDLEGLDLHKKVRQGYLSLLDK---E-G
KTHY_STRR6       IAANSDRE---------------------VNRLDLEGLDLHKKVRQGYLSLLDK---E-G
KTHY_STRPN       IAANSDRE---------------------VNRLDLEGLDLHKKVRQGYLSLLDK---E-G
KTHY_LACLM       IMKNRADE---------------------VNRLDLERAEMHRKVREGYLEIVAK---E-P
KTHY_LACLS       IMKNRADE---------------------VNRLDLERAEMHRKVREGYLEIVAK---E-P
KTHY_LACLA       IMKNRADE---------------------VNRLDLERAEMHRKVREGYLEIVVK---E-P
KTHY_LACH4       IQKLRPGQ---------------------EDRLEQENIAFHKKVYNGFLKVKDL---Y-P
KTHY_LACAC       IKKLRPAQ---------------------EDRLEQEDIAFHQKVYEGFLKVIKM---Y-P
KTHY_LACDB       IAKVRSGS---------------------EDRLEQEKLAFHEEVYRGYQKVNQA---H-P
KTHY_LACDA       IAKVRSGS---------------------EDRLEQEKLAFHEEVYRGYQKVNQA---H-P
KTHY_LACJO       IEKERAGQ---------------------EDRLEQEKIDFHNKVYAGYRELFER---Y-P
KTHY_CLONN       ISKNNERE---------------------VNRLDLEALDFHKKVREGYFKLLEK---Y-P
KTHY_CLOB8       IANNDCRE---------------------VNRLDIEKLEFHERVREGYDIVYKN---N-N
KTHY_BACHD       IHRDQSRE---------------------QNRLDQEALTFHQKVKEGYERIVET---Y-P
KTHY_BACVZ       ITSNDSRE---------------------KNRLDLEALHFHTKVREGYQKVMQR---F-P
KTHY_BACSU       IYANGSRE---------------------KNRLDLEKLDFHTKVQEGYQELMKR---F-P
KTHY_BACLD       IDLNDARE---------------------KNRLDLEKLHFHQLVQKGYEEVMNR---F-P
KTHY_BACP2       IHANQGRE---------------------KNRLDMETLNFHQLVREGYELLIAQ---S-P
KTHY_BACHK       IAKDAGRE---------------------VNRLDMEDISFHKRVREGYLQVVER---F-S
KTHY_BACAN       IAKDAGRE---------------------VNRLDMEDISFHKRVREGYLQVVER---F-S
KTHY_BACCZ       IAKDAGRE---------------------VNRLDMEDISFHKRVREGYLQVVER---F-S
KTHY_BACAH       IAKDAGRE---------------------VNRLDMEDISFHKRVREGYLQVVER---F-S
KTHY_BACC1       IAKDAGRE---------------------VNRLDMEDITFHKRVREGYLQVVER---F-S
KTHY_BACCR       IEKDAGRE---------------------VNRLDMEDISFHKRVREGYLQVVER---F-S
KTHY_BACCN       IEKDAARE---------------------VNRLDMESIAFHRLVREGYLQIVER---F-K
KTHY_OCEIH       IAANKNRE---------------------RNRLDLENMQFHEAVYEGYQKVIAR---F-P
KTHY_GEOTN       IRQNRERE---------------------VNRLDLETLSFHDKVREGYRKLAKR---F-A
KTHY_GEOKA       IRRNRGRE---------------------VNRLDLETLSFHEKVREGYRELARR---F-A
KTHY_BACSK       VQKDAVRS---------------------WNRLDQETLTFHKRVQEGYKKLLKA---E-P
KTHY_STAAN       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAAM       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAAC       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAA9       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAA3       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAAR       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAA2       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAA8       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAA1       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAAB       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAAS       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAAW       IIKNS-RD---------------------QNRLDQEDLKFHEKVIEGYQEIIHN---E-S
KTHY_STAS1       ILKNQ-RN---------------------QNRLDQEDVKFHEKVVEGYKKIIHN---E-S
KTHY_STAHJ       ILKNQ-RD---------------------QNRLDKEDIAFHEKVIEGYRQIIQE---T-P
KTHY_STAES       ILKNN-RE---------------------QNRLDKEEKAFHEKVIEGYQKVISD---N-P
KTHY_STAEQ       ILKNN-RE---------------------QNRLDKEEKAFHEKVIEGYQKVISD---N-P
KTHY_LISMF       IAANKGRE---------------------VNRLDKEDITYHEKVQAGYEKVINM---F-P
KTHY_LISMO       IAANKGRE---------------------VNRLDKEDITYHEKVQAGYEKVINM---F-P
KTHY_LISIN       IAANKGRE---------------------VNRLDKEDITYHEKVQNGYEKIIQM---F-P
KTHY_LISW6       IAANKGRE---------------------VNRLDKEDISYHEKVQAGYEKIIKM---F-P
KTHY_MYCMS       MQIRGENS---------------------KNRLDEEKSDFKQKVYQGYLELVKN---N-P
KTHY_MYCCT       MQIRGESS---------------------KNRLDKEENNFKQKVYQGYLELVKN---N-P
KTHY_MESFL       LSARPEE----------------------KNRLDEEGRKFKEAVKLAFEELVVK---E-P
KTHY_ONYPE       VKQFRPKE---------------------INSFDLQKLSFHKKVRKGYLDLCQKD--Q-Q
KTHY_AYWBP       VKQFRPKE---------------------INSFDLQKLSFHKKVRKGYLDLYQKD--Q-Q
KTHY_ACHLI       VKKNRLHK---------------------TDRLDMEVQTFHQKVREGYIRISEM---F-K
KTHY_TROWT       LENRD--------------------------RIERKPIDFHSKVRNIYLKLSAD---N-T
KTHY_TROW8       LENRD--------------------------RIERKPIDFHSKVRNIYLKLSAD---N-T
KTHY_CHLCV       KQQ-QKS----------------------LDKFEDKPLAYHTKIREGFLSLAEA---H-P
KTHY_CHLFF       KQQ-QKS----------------------LDKFEDKPLVYHNKIREGFLSLAEA---N-P
KTHY_CHLAB       KQQ-QKS----------------------FDKFENQSLAYHTKIREGFLSLAES---R-L
KTHY_CHLPN       KHR-QKV----------------------FDKFEKKPLSYHNRIREGFLSLASA---D-P
KTHY_CHLTR       KAR-QKH----------------------LDKFEQKPQIFHRSVREGFLALAEK---A-P
KTHY_CHLTA       KAR-QKH----------------------LDKFEQKPQIFHQSVREGFLALAEK---A-P
KTHY_CHLMU       KTR-QKN----------------------LDRFEQKPTSFHRAAREGFISLAER---S-P
KTHY_PARUW       TQKIQKVHAQMG----------------QLDRIESEKIEFHERVRQAFLSLVQQ---E-P
KTHY_PSEPF       ASAR-----------------------GRLDRFELEGREFFEAVRNAFLKRAED---D-P
KTHY_PSEF5       ASAR-----------------------GRLDRFEQEGQAFFQKVREAFLARAAA---A-P
KTHY_PSEPG       AAAR-----------------------GRLDRFEQEGQAFFEAVRQAYLQRAQR---A-P
KTHY_PSEP1       AAAR-----------------------GRLDRFEQEGQAFFEAVRQAYLQRAQG---A-P
KTHY_PSEE4       AAAR-----------------------GRLDRFEQEGQAFFEAVRQAYLQRAGQ---Q-P
KTHY_PSEMY       AAAR-----------------------GRLDRFEQEGRGFFEAVRQAYLQRAVQ---A-P
KTHY_PSEU5       AAAR-----------------------GRLDRFEQEGMRFFEAVRSAYLQRAEA---A-P
KTHY_PSEAE       AAAR-----------------------GRLDRFEQEDRRFFEAVRQTYLQRAAQ---A-P
KTHY_PSEA7       AAAR-----------------------GRLDRFEQEDRRFFEAVRQTYLQRAAQ---A-P
KTHY_PSEAB       AAAR-----------------------GRLDRFEQEDRRFFEAVRQTYLQRAAQ---A-P
KTHY_PSESM       AAAR-----------------------GRLDRFEQEGRAFFDAVRSTYLNRAKA---E-P
KTHY_PSEU2       AAAR-----------------------GRLDRFEQEGRAFFDAVRSTYLERARA---E-P
KTHY_PSE14       AAAR-----------------------GRLDRFEQEGRAFFDAVRSTYLQRAKA---D-P
KTHY_ALCBS       AGKR-----------------------AALDRIEQEDRAFFDRIRQCYLARAAQ---E-P
KTHY_CHRSD       VERRG----------------------IERDRFERERGAFFNAVRESYLARAAQ---A-P
KTHY_METCA       AHQR-----------------------SGPDRLEREDSAFFARVREGYLALARA---E-P
KTHY_ALKEH       AAGRG----------------------EAPDRFEQERDGFFERVHEGYAALAER---F-P
KTHY_VESOH       IKSR-----------------------SRKDRIELETNDFFNRVRDSYIKRSKQ---F-P
KTHY_RUTMC       VESR-----------------------GRKDRIELETNDFFKRVRNSYIERSKQ---F-P
KTHY_MARMS       VVQR-----------------------QHQDRLDKESFAFHQKVRDGFLERAEA---D-P
KTHY_COXBU       VKSR-----------------------GAKDRIEAEGLEFFKRVRECYLALANQ---E-P
KTHY_NITEU       LQST-----------------------RVADRFEMESNLFFERVRQAYLQRAEQ---F-P
KTHY_NITEC       VQSA-----------------------RTADRFELEPDLFFERVRQAYLQRAKQ---F-S
KTHY_NITMU       TSNI-----------------------RQADRFEKEQDEFFRRVREAYLERAKE---F-P
KTHY_BORBR       LARS-----------------------RQLDRFEREEDAFFERTRAAYHERARS---S-D
KTHY_BORPE       LARS-----------------------RQLDRFEREEDAFFERTRAAYHERARS---S-D
KTHY_BORPA       LARS-----------------------RQLDRFEREEDAFFERTRAAYHERARS---S-D
KTHY_DECAR       IVLAN----------------------RVLDKFEQERVDFHERVRQAYLERAHT---S-P
KTHY_BURCH       RGAV-----------------------RMPDKFESESDAFFSRTRAEYLRRAEE---A-P
KTHY_BURCA       RGAV-----------------------RMPDKFESESDAFFSRTRAEYLRRAEE---A-P
KTHY_BURCM       RGAV-----------------------RMPDKFESESDAFFSRTRGEYLRRAEE---A-P
KTHY_BURL3       RGAA-----------------------RMPDKFESESDAFFSRTRSEYLRRAEE---A-P
KTHY_BURVG       RGAA-----------------------RAPDKFESETDAFFTRTRDEYLRRAQE---A-P
KTHY_BURM9       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURP6       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURMS       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURM7       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURMA       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURP1       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURPS       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURP0       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAHE---A-P
KTHY_BURTA       RGAV-----------------------RMPDKFESESDAFFARTRAEYLRRAQE---A-P
KTHY_PARXL       RSAA-----------------------RDPDRFESESEAFFSRTRAEYLRRAEE---A-P
KTHY_RALSO       LADA-----------------------RTPDKFEAESAQFFVRTRAEYLRRAAA---E-P
KTHY_HERAR       LDAT-----------------------RTLDKFEQEQADFFAATRAEYLRRAAE---F-P
KTHY_JANMA       LDAT-----------------------RTLDKFEQEKAEFFAATRAEYLRRAAE---F-P
KTHY_NEIG1       IGQA-----------------------REKDRFEQEQADFFMRVRGVYLDRAAA---C-P
KTHY_NEIMB       IGQT-----------------------REKDRFEQEQADFFMRVRGVYLDRAAA---C-P
KTHY_NEIMA       IGQT-----------------------REKDRFEQEQADFFMRVRSVYLNRAAA---C-P
KTHY_NEIMF       IGQT-----------------------REKDRFEQEQADFFMRVRSVYLNRAAA---C-P
KTHY_CHRVO       MAGT-----------------------RVPDRFEQEAADFHRRVRAAYLRRAEE---A-P
KTHY_HALHL       VAHRG----------------------DGEDRFEQERDPFFQAARAAYARRAAA---D-P
KTHY_DICNV       VHNRA----------------------HDHDRIELENRAFFARVAQGYHARAQL---P-H
KTHY_ACISJ       LSAAR----------------------A-PDRFESQPVEFFTRVARGYADRAAG---A-P
KTHY_ACIAC       LEGAR----------------------A-PDRFEAQPVEFFRRVAQGYADRAAA---D-P
KTHY_RHOFT       LAGAR----------------------S-PDKFEAQPVEFFRRVSDGYLNRMTA---C-P
KTHY_POLSJ       LQGAR----------------------V-PDKFEAQPLEFFRRVAKGYSDRQQG---H-P
KTHY_VEREI       MAGAA----------------------HRPDRFEAQPVEFFRRVARGYADRAAA---A-P
KTHY_ACIAD       ARERG----------------------A-LDRFEQEKVEFFQRVRQGYQQLHEL---Y-P
KTHY_SALTY       ARARGD-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SALTI       ARARGD-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SALPA       ARARGD-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SALCH       ARARGD-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SALPB       ARARGD-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SALAR       ARARGD-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECOUT       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECOK1       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECOL6       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SHIDS       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SHIBS       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECOHS       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SHIFL       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SHIF8       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECOLC       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECOLI       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_SHISS       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECO24       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECOL5       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_ECO57       ARARGE-----------------------LDRIEQESFDFFNRTRARYLELAAQ-----D
KTHY_CITK8       ARARGE-----------------------LDRIEQESLDFFNRTRARYLELAAS-----D
KTHY_ENT38       ARARGE-----------------------LDRIEQESLDFFNRTRARYLELAAQ-----D
KTHY_KLEP7       ARARGE-----------------------LDRIEQESMNFFNRTRARYLELAAA-----D
KTHY_CROS8       ARARGE-----------------------LDRIEQESLDFFNRTRARYLELAAA-----D
KTHY_YERP3       ARARGE-----------------------LDRIEQESLAFFERTRARYLELAAS-----D
KTHY_YERPS       ARARGE-----------------------LDRIEQESLAFFERTRARYLELAAS-----D
KTHY_YERPA       ARARGE-----------------------LDRIEQESLAFFERTRARYLELAAS-----D
KTHY_YERPP       ARARGE-----------------------LDRIEQESLAFFERTRARYLELAAS-----D
KTHY_YERPN       ARARGE-----------------------LDRIEQESLAFFERTRARYLELAAS-----D
KTHY_YERPE       ARARGE-----------------------LDRIEQESLAFFERTRARYLELAAS-----D
KTHY_YERE8       ARARGE-----------------------LDRIEQESLAFFERTRERYLELAAT-----D
KTHY_SERP5       ARARGE-----------------------LDRIEQEALPFFERTRARYRELAAQ-----D
KTHY_PHOLL       ARERGE-----------------------LDRIEKESMDFFDRTRSRYLEFAAQ-----D
KTHY_PECAS       ARQRGE-----------------------LDRIEQESLAFFDRTRTRYQALAAE-----D
KTHY_SODGM       ARARGE-----------------------LDRIEVESLAFFDRTRARYQALAAA-----D
KTHY_VIBC3       ARGRGE-----------------------LDRIEKMDISFFERARERYLELANS-----D
KTHY_VIBCH       ARGRGE-----------------------LDRIEKMDISFFERARERYLELANS-----D
KTHY_VIBPA       ARGRGE-----------------------LDRIEKMDISFFERTRERYLEIANA-----D
KTHY_VIBCB       ARGRGE-----------------------LDRIEKMDISFFERTRERYLELANA-----D
KTHY_VIBVY       ARGRGE-----------------------LDRIEKMDISFFERTRQRYLELAKS-----D
KTHY_VIBVU       ARGRGE-----------------------LDRIEKMDISFFERTRQRYLELAKS-----D
KTHY_ALIF1       ASARGE-----------------------LDRIEQMKLDFFERSRERYLEFANS-----D
KTHY_PHOPR       ARGRGE-----------------------LDRIEKMNVDFFHRARARFLELSEN-----N
KTHY_HAES1       VRGRGE-----------------------LDRIEQQNLDFFHRTRARYLQLVQQ-----D
KTHY_HISS2       AKGRGE-----------------------LDRIEQQNLDFFHRTRERYLQLVQQ-----D
KTHY_MANSM       ARGRGE-----------------------LDRIEQQNLAFFDRTRTRYLELVKD-----N
KTHY_HAEIN       ARGRGE-----------------------LDRIEQMDLDFFHRTRARYLELVKD-----N
KTHY_PASMU       AKGRGA-----------------------LDRIEQQNLDFFHRTRQRYQELVRH-----N
KTHY_HAEDU       ASGCGE-----------------------LDRIEQQSLDFFYRTRERYLALTQH-----N
KTHY_WIGBR       IRARATVRAQIRDKVNKIKRNHSHDIKNALDRIEVEPISFFDRTRKKYKELASK-----N
KTHY_BAUCH       IRARGI----------------------PLDRIEMESLSFFQRTSIRYRELVAN-----D
KTHY_SHESR       AAKRGE-----------------------LDRIEQQAIDFFERARATYLKLASE-----D
KTHY_SHESM       AAKRGE-----------------------LDRIEQQAIDFFERARATYLKLASE-----D
KTHY_SHESA       AAKRGE-----------------------LDRIEQQAIDFFERARATYLKLASE-----D
KTHY_SHEON       AAKRGE-----------------------LDRIEQQAIDFFERARATYLKLASE-----D
KTHY_SHELP       ARDRGA-----------------------LDRIEQQALSFFERARATYLQLAAR-----D
KTHY_SHEFN       AASRGE-----------------------LDRIEQQAIDFFERARRTYLQLAHE-----D
KTHY_SHEAM       AARRGA-----------------------LDRIEQQEIDFFHRARATFLAQARD-----D
KTHY_PSEHT       AKGRGE-----------------------LDRIEQEAIEFFQRTRMRYLELAND-----D
KTHY_COLP3       AKARGD-----------------------LDRIELEKMEFFIRVHNKYRELAEQ-----D
KTHY_IDILO       ARERGE-----------------------LDRIEEEDLAFFQRTRQRYLNIAAK-----D
KTHY_LEGPH       AKSRGK-----------------------FDRIEQESIEFFHRIHDTYHILVKQ-----N
KTHY_LEGPL       AKSRGK-----------------------FDRIEQESIEFFHRIHDTYHILVKQ-----N
KTHY_LEGPA       AKSRGK-----------------------FDRIEQESIEFFHRIHDTYHVLVKQ-----N
KTHY_LEGPC       AKSRGK-----------------------FDRIEQESIEFFHRIHDTYHILVKQ-----N
KTHY_BLOPB       INHRQK-----------------------LDRIEQEPLSFFDRVRSCYKKLASE-----R
KTHY_BLOFL       IKNRKV-----------------------LDRIEQESLSFFNRVRSYYRKLAFL-----K
KTHY_BUCAI       ALKRNP-----------------------LDLIESRSLFFFKKTRRCYLEKSKL-----D
KTHY_BUCAP       ASKRNH-----------------------LDRIEHRSLTFFKKTRASYLKNIKL-----D
KTHY_BUCBP       IKNRNE-----------------------IDRIEQNTKFFFNNVRNKYLNLIKT-----K
KTHY_FRAT1       AQKVGS-----------------------PDRIEKAGLEFFNRTRKVFKDLVKD-----S
KTHY_FRATW       AQKVGS-----------------------PDRIEKAGLEFFNRTRKVFKDLVKD-----S
KTHY_FRATT       AQKVGS-----------------------PDRIEKAGLEFFNRTRKVFKDLVKD-----S
KTHY_FRATN       AQKVGS-----------------------PDRIEKAGLEFFNRTRNVFKDLVKD-----S
KTHY_FRATF       AQKVGS-----------------------PDRIEKAGLEFFNRTRKVFKDLVKD-----L
KTHY_FRATH       AQKVGS-----------------------PDRIEKAGLEFFNRTRKVFKDLVKD-----L
KTHY_FRATO       AQKVGS-----------------------PDRIEKAGLEFFNRTRKVFKDLVKD-----L
KTHY_WOLTR       AMDK--------------------------NKYEEMNISFYNKVRKGFQEIAIN---E-P
KTHY_WOLPM       AKDK--------------------------NKYEEMDVNFYNKVRKGFQEIAIK---E-P
KTHY_EHRCR       S-CK--------------------------NGYEFADMEFYYRVRDGFYDIAKK---N-P
KTHY_EHRCJ       S-CK--------------------------NGYEFAELEFYYRVRNGFYSIVEK---N-P
KTHY_EHRRW       S-NK--------------------------NGYEFLDLEFYARVRDGFRDIVKR---N-Q
KTHY_EHRRG       S-NK--------------------------NGYEFLDLEFYARVRDGFRDIVKR---N-Q
KTHY_ANAMM       T-SL--------------------------NGFENHGPEFYDRVREGFRTIVAN---N-P
KTHY_ANAPZ       A-TR--------------------------NGYESNSMDFYHKVRKGFQRIAEE---E-K
KTHY_NEOSM       D------------------------------NFERMPREYLSNVCMGYEKIARM---Y-P
KTHY_RICRO       VNSR-----------------------NMNNKFDIRGIDFYKKIYYCFKELSNR---F-P
KTHY_RICRS       VNSR-----------------------NMNNKFDIRGIDFYKKIYYCFKELSNR---F-P
KTHY_RICCN       VNSR-----------------------NMNNKFDIRGIDFYKKIYYCFKELSNR---F-P
KTHY_RICM5       VNSR-----------------------NMSNKFDIRGIDFYKKIYDCFKELSNR---F-P
KTHY_RICFE       VNLR-----------------------NMSNKFDVRGIDFYKKIYDCFKELSNR---F-P
KTHY_RICCK       VNLR-----------------------NMSNKFDIRGIDFYNKIYDCFKELSNR---F-P
KTHY_RICAH       VNSR-----------------------NMSNKFDIRGIDFYKKVYDCFKALSNR---F-P
KTHY_RICPR       VNAR-----------------------NMSNKFDIRSIDFYKKIYTCFKELSNR---F-P
KTHY_RICTY       VNSR-----------------------NMSNKFDRRRIDFYKKIYSCFQELSHR---F-P
KTHY_RICB8       INSR-----------------------NMSNKFDVRGLDFYNKIYDCFKGLSKK---F-P
KTHY_RICBR       VNSR-----------------------NMSNKFDVRGLDFYNKIYDCFKGLSKK---F-P
KTHY_ORITB       IKIREIHKNT-----------------NQLNKFDNRNQQFHQKITDAFIQVSKL---F-P
KTHY_MYCS5       R-SENN---------------------LINDRLELEDLSFHNRVYEGYLEIIKNN--K-E
KTHY_MYCPU       R-KARQ---------------------EDEDRLEKEENSFYQKVIKGYDFLASYP--EFQ
KTHY_UREPA       M-KNRF---------------------DNTNAFDSQNKQFYEKLLKQYPSVFKVY--NQP
KTHY_UREP2       M-KNRF---------------------DNTNAFDSQNKQFYEKLLKQYPSVFKVY--NQP
KTHY_MYCMO       R-HKR----------------------GKPDRLEMSSKDFFSRAYEGYFKIINSP--TMA
KTHY_MYCHJ       MGIFRD---------------------HNRDRLENRGVEFYEKVINGYEFLAKKN--K--
KTHY_MYCH2       MGIFRD---------------------HNRDRLENRGVEFYEKVINGYEFLAKKN--K--
KTHY_MYCH7       MGIFRD---------------------HNRDRLENKGVEFYERVINGYEFLTKKN--K--
KTHY_MYCPN       MAKRGQ----------------------DNLLDNTVKKQADFNTMRQYYHSLV-D--N--
KTHY_MYCGE       MQKRGN----------------------DNLLDEFIKGKNDFDTVRSYYLSLV-D--K--
KTHY_MYCGA       ISERST----------------------MNHLDAYTKERI-NKIRNAYLERLK-D--N--
KTHY_MYCPE       KTKDKDRDI------------------FDRLDNQYAQEENLKKIIGGYSSILQFD--N--
KTHY_CAMJR       LSQK------------------------ELDSIEKRGIEYFLSVQDKLEKVLHFLKEKIS
KTHY_CAMJE       LSQK------------------------ELDSIEKRGIEYFLSVQDKLEKVLHFLKEKIS
KTHY_CAMJJ       LSQK------------------------ELDSIEKRGIEYFLSVQDKLEKVLHFLKEKIS
KTHY_CAMJ8       LSQK------------------------ELDSIEKRGIEYFLSVQDKLEKVLHFLKEKIS
KTHY_CAMJD       LSQK------------------------ELDSIEKRGIEYFLSVQDKLKKVLHFLKEKIS
KTHY_CAMC1       LKARG-----------------------TSDKIEARGLEYLLKVQSLMKQIL----IKNG
KTHY_CAMHC       LENRG-----------------------NFDKIEERGLEYLMKVQKNMSEIF----KILK
KTHY_SULDN       LSQK------------------------KLDGIELRGIEYLLKIQDALIKAS----NLLN
KTHY_HELHP       IESK------------------------SHDNIESRGISYMLEIQKCFKNVV----TQMN
KTHY_HELPJ       LSLK------------------------SLDKIENQGIEKLLTIQQKLKTHAYALQEKFG
KTHY_HELPY       LSLK------------------------SLDKIENQGIEKLLHIQQKLKTHAYALQEKFG
KTHY_HELPH       LSLK------------------------SLDKIENQGTEKLLTIQQKLKTHAHALQEKFG
KTHY_HELAH       LSLK------------------------SLDKIENQGVEKLLHIQQKFKTHAYALKEQFG
KTHY_METMA       CGKRG-------------------------EQTKFEKIEFLQNVRENFLILAAED----P
KTHY_METAC       CGKRG-------------------------EQTKFEKIEFLRGVRELFLGLAAEE----P
KTHY_METBF       CGKRG-------------------------EQSKFEKLEFLQGVRAIFLKLAADD----P
KTHY_METBU       CGKRG-------------------------EQTKFEKTDLLKGVRENYLKLAEKE----P
KTHY_HALSA       SG----------------------------ATNKFETAAFLADVRANYEQLIDYT----P
KTHY_HALMA       SG----------------------------ATNKFETAEYLTTVRDNYERLIEAD----P
KTHY_NATPD       AG----------------------------ATNKFEAADYLESVRENYERLIEAE----P
KTHY_METHJ       TGKRG-------------------------SGEHFEQESVLTKVQEYYMQLVEED----T
KTHY_METLZ       LHERP-------------------------GKEHFEDPAFLEEVQKKYLERVTED----P
KTHY_METMJ       LGPEK-------------------------KREYFENAAILEQVQENYLNLAAAD----P
KTHY_PYRAB       TKA------------------------RGNMSEFDKLLELQRKVRMNYLKLAEM-----F
KTHY_PYRHO       IKL------------------------RGTLTEFDKIVELQRKVRHNYLKLAEM-----F
KTHY_PYRFU       IKK------------------------RSSQTEFDKLFKLQEKVRENYIKLAKM-----F
KTHY_THEKO       IRS------------------------RKVKSEFDKIFELQRKVRENYLKLAEM-----F
KTHY_XANOR       IRA------------------------RGDAPNHFETQDNLERCRTIFAGLE-------L
KTHY_XANOM       IRA------------------------RGDAPNHFETQDNLERCRTIFAGLE-------L
KTHY_XANAC       IRA------------------------RGDAPNHFETQDNLERCRTIFAALE-------L
KTHY_XANC5       IRA------------------------RGDAPNHFETQDNLERCRTIFAALD-------L
KTHY_XANCP       IRA------------------------RGDAPNHFETQDNLERCRAIFAALQ-------L
KTHY_XANC8       IRA------------------------RGDAPNHFETQDNLERCRAIFAALQ-------L
KTHY_XYLFA       IWE------------------------RGSTPNHFETTENLSRCRDIFLALE-------L
KTHY_XYLFT       IWE------------------------RGSTPNHFETTENLSRCRDIFLALE-------L
KTHY_DESPS       ITSS-----------------------RGEETNDFEKAEMLEKVSTIFNSLS-------F
KTHY_LEPBJ       LSQ------------------------RKENKERFETLAQLEKIRSAYNRIL-------P
KTHY_LEPBL       LSQ------------------------RKENKERFETLAQLEKIRSAYNRIL-------P
KTHY_LEPIC       LNR------------------------RKEGKERFETLAQLEKIRSAYEKIL-------P
KTHY_LEPIN       LNR------------------------RKEGKERFETLAQLEKIRSAYEKIL-------P
KTHY_ARCFU       VRK------------------------RGK-LSPFEKLDYLRKVRKCFLENA-------D
KTHY_PYRCJ       IK-ARERLE------------------------KFEDVEFLRRVREIYLTRARAE-----
KTHY_PYRAE       IR-QRGGAE------------------------KYEYLSFLRKVREIYLARAAEE-----
KTHY_STAMF       RKGLNTRFP------------------------EYEKLDFLYRVRENYLWLVDKG-----
KTHY2_SACS2      IRKAKRKIKPQEAGIDI----------LGEIPLEEGFLKYQSRIVEIYDKIAKEES----
KTHY2_SULTO      IKKSKRKIKPQEAGADI----------FPGLSPEEGFLKYQGLITEVYDKLVKDE-----
KTHY_THEVO       ISKRN------------------------GTITHFEQRERLNEALKIYNSFDWD------
KTHY_THEAC       ISRRG------------------------LRNPHFENEQKLRSVRQIYKGFQWD------
KTHY_PICTO       LNLRKNEK---------------------KNTDAFERLEMLKNVSKYYDYIFSG-----I
KTHY_SYNY3       LGDRQQ-------------------LEDQAPRECYEQREKLISVHRNYDRIFAHY----Q
KTHY_METKA       FDK-----------------------------------EFLERVRNRYREAARLIEEEFD
KTHY_MYCTU       SRGRAQRDP------------------GRARDNYERDAELQQRTGAVYAELAAQ---GWG
                                                                             

KTHY1_SACS2      N-FYVVDASKDKN----EVLEQAIKIIQKNLF--------------------------
KTHY_SULAC       NKIRIVNAEKSID----EIVEETWSIVYSFLNHF------------------------
KTHY1_SULTO      N-FIVLDAMSKIE----ELTEKTVQIICSLVKCS------------------------
KTHY_METS5       N-FKILDGTLPLE----KLTSISLELVQGLLSSSTSRGSQGT----------------
KTHY_METM7       PKYGFIIIDTTSK----SITQVFDEILNAIIDKIPDIIQ-------------------
KTHY_METM5       PKYGFIIVNTTSK----SIHQVFDEILNAIIDKIPDIIQ-------------------
KTHY_METMP       PKYGFIVIDTTSK----PIDQVFNEILNAIVDKIPDIIQ-------------------
KTHY_METVS       PTYGFVMVNTTGK----TPEEVFNELFNKILDKIPDII--------------------
KTHY_META3       PKNGYILINTDNK----TVEEVHKEIIKKLMDK--KIIL-------------------
KTHY_METJA       EEYNFIVIDTTKK----SVEEVHNEIIGYLKNIPH-----------------------
KTHY_METS3       FNHEIIDASTGVN----KVSTDIKKAVAPYMGICPDCIR-------------------
KTHY_METTH       NGFYTVNAERGVN----LIQRDIRRILAPHFGICSGGIM-------------------
KTHY_METST       KNIVKIDATPTED----VVQDEIRNQIIKYLKL-------------------------
KTHY_BDEBA       AAWIVLDARETPE----VLFKQLLQSLTERKVL-------------------------
KTHY_RHOBA       GRTHVIDASGTIE----EVAETIAAIELF-----------------------------
KTHY_GEOSL       HRFAVIDGNDGVE----ATATAVADVLLNRVPRR------------------------
KTHY_GEOUR       ERFIIIDGSQGVQ----ETEAAITAAVLARLAEG------------------------
KTHY_PELPD       QRFITVDGSGGVE----EISEAIVAQVLQNRLNNTSHALL------------------
KTHY_PELCD       QRIKVVDANGTLD----EVCHRIWLTTSNALNLPGGM---------------------
KTHY_MAGMM       QRMIPIDADQPVQ----MVAATIWREVEGRFFVSF-----------------------
KTHY_AGRFC       RRCRIVNADQPED----KVTEDVMSFVEPLLERAGNAADAAHE---------------
KTHY_RHIME       ERCRVVDANRPPT----AIAAEVLSLVEALLPLEGKPQPSNAEATS------------
KTHY_RHILO       ERCIVVDASADPN----TVEDVVTAAVFAALEARAPARNRQAAPV-------------
KTHY_BRUO2       ARCKVIDADRSQE----KIADEIRSVVDTILTEKGLL---------------------
KTHY_BRUME       ARCKVIDADRSQE----KIADEIRSVVDTILTEKGLL---------------------
KTHY_BRUSU       ARCKVIDADRSQE----KIADEIRSVVDTILTEKGLL---------------------
KTHY_BRUC2       ARCKVIDADRSQE----KIADEIRSVVDTILTEKGLL---------------------
KTHY_BRUSI       ARCKLIDADRSQE----KIADEIRSVVDTILTEKGLL---------------------
KTHY_BRASO       RRCVLIDATASAE----AVSNIVWDAVRERLFTAVAAAS-------------------
KTHY_BRASB       KRCVLIDATAGPD----PVSLLVWDAVRERLFTAVAAAS-------------------
KTHY_NITHX       QRCVVIDANADVN----TVAAGVWAALRDRVLVADSSTKVTRA---------------
KTHY_NITWN       QRCVVIDADADLD----AVAARVWAALHDRALTADAATKASRA---------------
KTHY_BRADU       ARCVLIDANSDPD----TVAGRVWSALRDRLLPTPASVVSV-----------------
KTHY_RHOPB       QRCVLIDANAKVK----PVAAKVWAAVQKRLLYSKVSAVQHA----------------
KTHY_RHOPA       ERCVLIDANAEPE----EVADRIWQAVRLRLLEPARAGAKSA----------------
KTHY_BARQU       HRFRVIDATGAME----VIAQQIKNICHQVILDQVP----------------------
KTHY_BARHE       HRFRVIDGTDTVE----VIAQQIRDICDQVMLDQLP----------------------
KTHY_CAUVC       DRCVVIDADAELD----AVTAAISDVVVQRLGL-------------------------
KTHY_JANSC       DRCHIVDASADPD----AIAHTIQTIVGQRLAEA------------------------
KTHY_SPHWW       ARIRTINAQGSPQ----EVTARLIEALADLLP--------------------------
KTHY_RHOS1       GRHAVIDASGTPE----EVQARACAALAPFLAQAPV----------------------
KTHY_RHOS4       GRHAVIDASGTPE----EVQARACAALAPFLAQAPV----------------------
KTHY_SYMTH       RRVKVVDASRSVE----EVQKDIRRLVEEVLPRRFRGAGTRP----------------
KTHY_PELTS       RRYRVIDASRAEK----LVHLDVLKAAEEVLDAFLKGNSRA-----------------
KTHY_ROSCS       ERWRVLDARQSIE----ALAEQIAAIVEPYLASIPQLEAVPYS---------------
KTHY_ROSS1       ERWRVLDARQSIE----ALAEQIGAIVEPYLASITRLETVL-----------------
KTHY_DESRM       DTYLVLDARQTME----QLHRQICCRVGGLLGV-------------------------
KTHY_THEMA       ERIVVLDGKRSIE----EIHRDVVREVKRRWKLDV-----------------------
KTHY_THEP1       ERIVVLDGKRSIE----EIHRDVVREVERRWKLDV-----------------------
KTHY_THEM4       KNFFVIDGTKDVD----YVFSQIKRIIDTMLDH-------------------------
KTHY_FERNB       ENFVIIDGTRTIE----EIHREIVKVFNAYL---------------------------
KTHY_AQUAE       ENVVVIDASGEEE----EVFKEILRALSGVLRV-------------------------
KTHY_CALS4       ERFILIDGMQEVL----AVHKMVVKAVEEYLKGAKV----------------------
KTHY_PELLD       GRFKSINARHGVQ----EIHAIIVKTLNE-RFKEQS----------------------
KTHY_CHLPM       DRFVSINARKSIQ----EIHTTVTKTLKEQRAGRQS----------------------
KTHY_CHLPD       HRFKVLNALEHPD----DLHRQILETLRKKKPALKALNRY------------------
KTHY_CHLTE       NRIIIIDALLSPS----EIHRKIISSIDALCTKTA-----------------------
KTHY_CHLCH       SRFVALDATQPPD----TLHQHIIAEVETRLKLHISPLVAP-----------------
KTHY_DEHMB       DRFLKLDASLPQS----EIFSRIKQRVTILLGCRNE----------------------
KTHY_DEHMC       DRFLKLDASLPQS----EIFSRIKQRVTILLGCRNE----------------------
KTHY_DEHM1       NRFLKLDASLSQS----ELTKCIKQRVNALLKLPQ-----------------------
KTHY_NOSS1       KRIIRVDGQLSKE----TVHKTIQEILSVHLKQWL-----------------------
KTHY_TRIV2       SRIIRVDGQLSKE----TVHKTIQEILSPHLKEWL-----------------------
KTHY_ACAM1       ERIFRIEAHQSDD----VVAQQIQGILESRLQEWYP----------------------
KTHY_TRIEI       SLIVRIDANLTRE----KVQQQIQAIIMQKLVEWKYI---------------------
KTHY_THEEB       DRWQRIDADQPPD----QVTQAIQECLAAHLHRWFETLKQRLTGGDRDLP--------
KTHY_SYNSC       -SWCAVAADQSAS----AVRAALERQLQEHLA--------------------------
KTHY_SYNPX       -QWSAIAADRPPE----AVSRALERELMDRLG--------------------------
KTHY_SYNS9       -NWSQIDAQQSVS----KLSQVLEQTLRETLQ--------------------------
KTHY_PROMM       -SWVPLQADQQVE----SVSSALESQLKHHFGPLQESMR-------------------
KTHY_PROM3       -SWVPLQADQQVE----SVSSALESQLKHHFGPLQESMR-------------------
KTHY_SYNPW       -GWVGIPAALSPK----EVHQAIRLALEGHAALRRR----------------------
KTHY_SYNR3       -LWRRVDASLPPE----QVHQQVQHLVREGLELAL-----------------------
KTHY_SYNS3       -DWVSVVADRPLL----EVAEAIQTALLTRAAAWQR----------------------
KTHY_PROMT       -NWKKISAIDSKE----KIISEIKSEIKKLIKNK------------------------
KTHY_PROM1       -HWKKISAIDSKE----KIISEIKSEIKKLIKNK------------------------
KTHY_PROMA       -NWLVIPANQKKD----IVSKQIENKLINYFQNISSLKNERS----------------
KTHY_PROMS       -NWKVISASQNIQ----TISNQIKETLLNNFSNNK-----------------------
KTHY_PROM0       -NWKVISASQNIK----TISNQIKETLLNNFSNAK-----------------------
KTHY_PROM9       -KWKVISASQNIK----TISNQIKETLLNNFSNDK-----------------------
KTHY_PROM2       -NWTVISASQNIK----TISNQIKETVLNNFSKNT-----------------------
KTHY_PROM5       -KWKVISATQNIT----AISNEIKETLLKTFRN-------------------------
KTHY_PROMP       -NWTTISALQDIN----TITNEIKETLLKKFSRVNND---------------------
KTHY_CARHZ       -RFRVVDGRKKPE----EIFWEIKGFLEGLNG--------------------------
KTHY_THET8       GRFVVLDATLPEE----EIARAIQAHLRPLLP--------------------------
KTHY_THET2       GRFVVLDATLPEE----EIARAIQAHLRPLLP--------------------------
KTHY_DEIRA       QRFLVLDATRPED----ELEAEIWAAVSERGH--------------------------
KTHY_CLAMS       ERFLVVDAGWPRE----VIAAEIRARAHVLIAAGASA---------------------
KTHY_CLAM3       ERFLVVDAARPRE----EIAAAIRTRAQALIAAGASA---------------------
KTHY_LEIXX       QRFLVVDASRPVE----EIAAEIRCRLDGRV---------------------------
KTHY_BIFLO       NRFRVIDASQSIE----AVWAAIESDIKELA---------------------------
KTHY_BIFAA       ERFHVIDASQSIE----DVWARIKADFDTVSTADGGIA--------------------
KTHY_CUTAK       QRYLVLNARKSRK----EISEAIRQRVTGLLNR-------------------------
KTHY_DESVH       GRYRVVDATQSPEDVVRDVVGIVAAALGDVSSGEAVSGRTGA----------------
KTHY_DESVV       GRYRVVDATQSPEDVVRDVVGIVAAALGDVSSGEAVSGRTGA----------------
KTHY_DESAG       ERFRIIDAAASPD----EVFEQVRSAVADVFTIG------------------------
KTHY_LAWIP       DRITILNADTTPE----DLFQQSVSVLREIV---------------------------
KTHY_GLOVI       GRIRPVDAGLSVE----ATAEQIRSAVDVFLNENQSKLEK------------------
KTHY_LACSS       DRIKTIDASQPLE----AVVTQCLQVIAQANLHLFEV---------------------
KTHY_LACPL       DRIKRVDASQPLD----QVVTQALEIMASQLPTYVASKGGEDQ---------------
KTHY_LACBA       DRIKLIDATQKRE----AVVTTALTLIKQAAQNYFD----------------------
KTHY_PEDPA       DRIVVIDASQELD----DVKRDVIEVLDQILN--------------------------
KTHY_LACP3       QRIVSIDATEPLE----KVVAACFQTITRRFPELFN----------------------
KTHY_ENTFA       QRIKKIDARMSLE----LVVEATYQAIIERYPENF-----------------------
KTHY_LACS1       ERIKVIDASQNLD----KVIDDTLSILNNFM---------------------------
KTHY_LEUMM       DRIKIVDATQPLN----KVIDDTRILINQILEDKS-----------------------
KTHY_LACRD       ERIELIDASQPLE----KVIEDVKATIHDRFSDLF-----------------------
KTHY_OENOB       NRIKVLDATQSPE----KIAINALQLIQESLKGWI-----------------------
KTHY_STRA5       NRIVTIDASQQLD----EVIAETFSIILDRINQ-------------------------
KTHY_STRA3       NRIVTIDASQQLD----EVIAETFSIILDRINQ-------------------------
KTHY_STRA1       NRIVTIDASQQLD----EVIAETFSIILDRINQ-------------------------
KTHY_STRTD       ERIKRIDASQTLE----EVVEDTWEIIKSYL---------------------------
KTHY_STRT2       ERIKRIDASQTLE----EVVEDTWEIIKSYL---------------------------
KTHY_STRT1       ERIKRIDASQTLE----EVVEDTWEIIKSYL---------------------------
KTHY_STRMU       DRIVTIDAARPLE----EVITDALFIIKQRCLEK------------------------
KTHY_STRPG       KRIVTIDATKPLK----EVVSVALEHVLALLLA-------------------------
KTHY_STRP8       KRIVTIDATKPLK----EVVSVALEHVLALLLA-------------------------
KTHY_STRP3       KRIVTIDATKPLK----EVVSVALEHVLTLLLA-------------------------
KTHY_STRP6       KRIVTIDATKPLK----EVVSVALEHVLALLLA-------------------------
KTHY_STRP1       KRIVTIDATKPLK----EVVSVALEHVLALLLA-------------------------
KTHY_STRGC       ERLVKIDASQALE----DVVKDSLAVLNQHLNSKS-----------------------
KTHY_STRSV       ERFVKVDASQPLD----KVVADSLAIIQERFGNPS-----------------------
KTHY_STRP2       NRIVKIDASLPLE----QVVETTNAVLFDGMGLAK-----------------------
KTHY_STRR6       NRIVKIDASLPLE----QVVETTNAVLFDGMGLAK-----------------------
KTHY_STRPN       NRIVKIDASLPLE----QVVETTKAVLFDGMGLAK-----------------------
KTHY_LACLM       GRFVKIDASQSLE----KVVADTLEVLKKRFVSEF-----------------------
KTHY_LACLS       ERFVKIDASQSLE----KVVADTLEVLKKRFVSEF-----------------------
KTHY_LACLA       ERFVKIDASQPLE----KVVADTLSVLKKRFVSEF-----------------------
KTHY_LACH4       DRFVTIDATQPIE----DVVNQVIATLEKRLPEIF-----------------------
KTHY_LACAC       DRFVVINATQPID----QVVKQVVTELKQRLPKTILENN-------------------
KTHY_LACDB       DRVKVVDASQDLP----QVVAASVKLVKSTFPELF-----------------------
KTHY_LACDA       DRVKVVDASQDLP----QVVAASVKLVKSTFPELF-----------------------
KTHY_LACJO       DRIKKVDANLPIK----DVAANSVKIIRKQLPDIFM----------------------
KTHY_CLONN       NRIKKINANQPVD----KVFEEVKGFLK------------------------------
KTHY_CLOB8       HRIVKIDANNTKE----NVINQIKNILRPKIWTNIK----------------------
KTHY_BACHD       ERVVEIDANQSFD----QVVADAVRMIKQRLSL-------------------------
KTHY_BACVZ       ERFHTIDASKKKE----LVIQDALQVINEALKKIQL----------------------
KTHY_BACSU       ERFHSVDAGQSKD----LVVQDVLKVIDEALKKIQL----------------------
KTHY_BACLD       GRFRIVDASQSVE----LVLKRVNNIIEEALKENQL----------------------
KTHY_BACP2       ERFHVVDASKPMQ----DVYEEVLRVIQDTLKKNQI----------------------
KTHY_BACHK       DRIVLVNADQPME----KLIEEVIQVIEDKLL--------------------------
KTHY_BACAN       DRIVLVNADQPME----KLIEEVIQVIEDKLL--------------------------
KTHY_BACCZ       DRIVLVNADQPME----KLIEEVIQVIEDKLL--------------------------
KTHY_BACAH       DRIVLVNADQPME----KLIEEVIQVIEDKLL--------------------------
KTHY_BACC1       DRIVLVNADQPME----KLIEEVIQVIEDKLL--------------------------
KTHY_BACCR       DRIVLVNADQPME----KLIEEVVQIIEDKLL--------------------------
KTHY_BACCN       DRIVVVNADQPME----NVVEEVIQLIESKLL--------------------------
KTHY_OCEIH       ERIKTIQAEQALE----AVEQDTMEIISSFLNEKEKGGNNEINYYGDSR---------
KTHY_GEOTN       ERIVVIDASRPLD----DVFSETVATVLSRLEGSKRHFHESNRDDSCWT---------
KTHY_GEOKA       DRIVVIDANRPLD----DVFAETTAAVLSRLKGR------------------------
KTHY_BACSK       ERIKAIDANRSFA----EVFHDTMEEINRMLLSTKD----------------------
KTHY_STAAN       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAAM       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAAC       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAA9       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAA3       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAAR       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAA2       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAA8       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAA1       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAAB       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAAS       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAAW       QRFKSVNADQPLE----NVVEDTYQTIIKYLEKI------------------------
KTHY_STAS1       ERFIVIEADRSID----EVVNATYESISKYLEKL------------------------
KTHY_STAHJ       QRFAVVDATRNID----DVVNETYEIILNFLK--------------------------
KTHY_STAES       HRFIKVNANHSLD----KVVEETYQSIIKYLK--------------------------
KTHY_STAEQ       HRFIKVNANHSLD----KVVEETYQSIIKYLK--------------------------
KTHY_LISMF       ERFMRVDATKTPE----EITETILADILRQLA--------------------------
KTHY_LISMO       ERFMRVDATKTPE----EITETILADILRQLA--------------------------
KTHY_LISIN       DRFMRVDATKTPE----EITTIILADILKQLT--------------------------
KTHY_LISW6       DRFMRVDATMQPE----EITEVILADILQQLS--------------------------
KTHY_MYCMS       KRIKVIDANQDID----QVYNQAIKIILEKLKENEKRTSN------------------
KTHY_MYCCT       KRIKVIDANKDID----QVYNQAIKIILEKLKENEKRTSN------------------
KTHY_MESFL       NRITVIDASKSPE----EVFEETKKVILEKIELWKKEKR-------------------
KTHY_ONYPE       KRIFLIDASKPLE----NIYNIIEQKLKEVFQIEL-----------------------
KTHY_AYWBP       KRIFLIDASKSLE----KIYNIIEQKLKEVFQIDL-----------------------
KTHY_ACHLI       ERIVVIDGNQSID----AIYQIIMDNILKRL---------------------------
KTHY_TROWT       DRIRVIDASQSFS----KIHQQVIYHIERKLGGTHSA---------------------
KTHY_TROW8       DRIRVIDASQSFS----KIHQQVIYHIERKLGGTHSA---------------------
KTHY_CHLCV       NSYLILDGRQPLE----ESLNKVMTAYTELALCK------------------------
KTHY_CHLFF       ENYLILDGRQPLE----ASLNKVMTAYTELALCK------------------------
KTHY_CHLAB       DSYLVLDARQPIE----ESLNKVMTAYTELALCKSKER--------------------
KTHY_CHLPN       SRYLVLDARESLA----SLIDKVM-LHTQLGLCT------------------------
KTHY_CHLTR       DRYKVLDALLPTE----ASVDQALLQIRALI---------------------------
KTHY_CHLTA       DRYKVLDALLPTE----ASVDQALLQIRALI---------------------------
KTHY_CHLMU       DRYKILDALLPTE----VSVDQALLQIRALI---------------------------
KTHY_PARUW       QRIYRIDANESQS----KVLQKALEFLEEQWSDSELKT--------------------
KTHY_PSEPF       ARYVRIDAGQPLV----KVQQSLDTLIPNLLELSRG----------------------
KTHY_PSEF5       QRYVLVDAAQPLA----QVQQSLDSLLPQLLERARG----------------------
KTHY_PSEPG       QRYSLLDAAQSLE----AVQRDIDALLPGIVERCRG----------------------
KTHY_PSEP1       QRYSLLDAAQSLE----AVQRDIDALLPGILERCRG----------------------
KTHY_PSEE4       QRYSLLDAAQPLA----AVQRAIDALLPGILERCRG----------------------
KTHY_PSEMY       QHYRVLDAGQTLA----QVQADIDALLPSLLEACRG----------------------
KTHY_PSEU5       SRYRVIDAGQALN----AVQCDVEALIPELLVRLDD----------------------
KTHY_PSEAE       ERYQVLDAGLPLA----EVQAGLDRLLPNLLERLNG----------------------
KTHY_PSEA7       QRYQVLDAGLPLA----EVQAGLDRLLPNLLERLHG----------------------
KTHY_PSEAB       ERYQVLDAGLPLT----EVQAGLDRLLPNLLERLNG----------------------
KTHY_PSESM       ARYRLVDAAQSLA----DVQASLDKLLPELLELQRG----------------------
KTHY_PSEU2       ARYRLVDAAQTLA----DVQACLDTLLPQLLELQRG----------------------
KTHY_PSE14       ARYRLVDAAQPLA----DVQASLDTLLPQLLELRRG----------------------
KTHY_ALCBS       NRFRTVDASQPLE----SVQQQLARIVEEMQAWP------------------------
KTHY_CHRSD       TRFAVIDADRSLE----AVQASIAAHLTERLASWS-----------------------
KTHY_METCA       GRIRVIDADRPLA----LVQTAIATQVDSLLAGHV-----------------------
KTHY_ALKEH       ERIRRVDAGQPLE----AVLTALEEALASAVTRWLSGTEAH-----------------
KTHY_VESOH       ERIKLIDASQTLK----ETTQQIKVILQAL----------------------------
KTHY_RUTMC       KRIKLIDASKTLE----QTAQQIKIILQVL----------------------------
KTHY_MARMS       KRVKIVDASQSLE----SVKSQIEEQLAKLNEAWAGDC--------------------
KTHY_COXBU       ARFRVIHTDQDLS----NVKNQIMKAIKPLLTASPLPGEKTEIEGL------------
KTHY_NITEU       QRIRVVDGSRLLA----EVKTAVAEIVEDFWSDLSDTQFRG-----------------
KTHY_NITEC       ERIRVVDGSLSLE----EVRTAMVEVVEKFWSAQASSGYRM-----------------
KTHY_NITMU       ERIRVIDANQSLE----DVRRSVEKSIATIYA--------------------------
KTHY_BORBR       GRIRIIDSSRPLE----VVRAQLDSEVRELVAQAA-----------------------
KTHY_BORPE       GRIRIIDSSRPLE----VVRAQLDSEVRELVAQAA-----------------------
KTHY_BORPA       GRIRIIDSSRPLE----VVRAQLDSEVRELVAQAA-----------------------
KTHY_DECAR       SRIRVIDANQSIE----NIRKQLEQIVSTDCL--------------------------
KTHY_BURCH       HRFAIVDATRSIP----EIRQQLERVLAAL----------------------------
KTHY_BURCA       HRFAIVDATRSIP----EIRQQLERVLAAL----------------------------
KTHY_BURCM       HRFAIVDATQSIP----EIRQQLERVLAAL----------------------------
KTHY_BURL3       HRFAIVDATQTIP----EIRHQLERVLAAL----------------------------
KTHY_BURVG       HRFTIVDATQTIP----EIRGRLERVLAAL----------------------------
KTHY_BURM9       HRFAIVDSSESIP----QIRKQLEGVLAAL----------------------------
KTHY_BURP6       HRFAIVDSSESIP----QIRKQLEGVLAAL----------------------------
KTHY_BURMS       HRFAIVDSSESIP----QIRKQLEGVLAAL----------------------------
KTHY_BURM7       HRFAIVDSSESIP----QIRKQLEGVLAAL----------------------------
KTHY_BURMA       HRFAIVDSSESIP----QIRKQLEGVLAAL----------------------------
KTHY_BURP1       HRFAIVDSSESIP----QIRRQLEGVLAAL----------------------------
KTHY_BURPS       HRFAIVDSSESIP----QIRRQLEGVLAAL----------------------------
KTHY_BURP0       HRFAIVDSSESIP----QIRRQLEGVLAAL----------------------------
KTHY_BURTA       HRFVIVDSSEPIA----QIRKQLEGVLAAL----------------------------
KTHY_PARXL       YRFAIIDSAQSIA----QIQRRLEELIAIL----------------------------
KTHY_RALSO       GRFVVIDAARARD----DIRKDLEKLLASL----------------------------
KTHY_HERAR       QRFRIIDSTQAIA----TIQEQLRDIIAGLAP--------------------------
KTHY_JANMA       QRFHVIDSTRSIA----AIQEQLRAIVAGIDS--------------------------
KTHY_NEIG1       ERYAVIDSNRSLD----EVRNSIEKVLDGHFGC-------------------------
KTHY_NEIMB       ERYAVIDSNRNLD----EVRNSIEKVLDGHFGC-------------------------
KTHY_NEIMA       ERYAVIDSNLGLD----EVRNSIEKVLDRHFGC-------------------------
KTHY_NEIMF       ERYAVIDSNLGLD----EVRNSIEKVLDGHFGC-------------------------
KTHY_CHRVO       QRIAVLDASRGIA----DIQADIVLHLERLLERG------------------------
KTHY_HALHL       ERFRCIDANRPEG----EVAEQVRAGVADLLPVGGRP---------------------
KTHY_DICNV       ARF--IDASGDQN----SVFQQIRHHLELLL---------------------------
KTHY_ACISJ       QRFARIDSSQPRE----QVAAQLRAVVAARGWLAQTP---------------------
KTHY_ACIAC       GRFARLDADQPRE----AVRAQLMEILHRRGVLDAAQEGG------------------
KTHY_RHOFT       SRFARIEANQTRE----AVWQDVLHAVQARGWLT------------------------
KTHY_POLSJ       ERFARINASQPRD----VVWQAVRQVFVAKGWLA------------------------
KTHY_VEREI       RRIVRIDAAQECH----RVRQQLRDALVCKGWLAPMVTPQGGAQ--------------
KTHY_ACIAD       ERIKRLDATQAPE----IVFQEALEHIQALV---------------------------
KTHY_SALTY       SRIRTIDATQPLD----AVMRDIRATVTKWVQEQ--AA--------------------
KTHY_SALTI       SRIRTIDATQPLD----AVMRDIRATVTKWVQEQ--AA--------------------
KTHY_SALPA       SRIRTIDATQPLD----AVMRDIRATVTKWVQEQ--AA--------------------
KTHY_SALCH       SRIRTIDATQPLD----AVMRDIRATVTKWVQEQ--AA--------------------
KTHY_SALPB       SRIRTIDATQPLD----AVMRDIRATVTKWVQEQ--AA--------------------
KTHY_SALAR       PRIRTIDATQPLD----AVMRDIRATVTTWVQGQ--AA--------------------
KTHY_ECOUT       KSIHTIDATQPLE----AVMDAIRTTVTNWVKEL--DA--------------------
KTHY_ECOK1       KSIHTIDATQPLE----AVMDAIRTTVTNWVKEL--DA--------------------
KTHY_ECOL6       KSIHTIDATQPLE----AVMDAIRTTVTNWVKEL--DA--------------------
KTHY_SHIDS       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_SHIBS       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_ECOHS       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_SHIFL       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_SHIF8       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_ECOLC       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_ECOLI       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_SHISS       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_ECO24       KSIHTIDATQPLE----AVMDAIRTTVTHWVKEL--DA--------------------
KTHY_ECOL5       KSIHTIDATQPLE----AVMDAIRTTVTNWVKEL--DA--------------------
KTHY_ECO57       KSIHTIDATQPLE----AVMDAIRTTVTRWVKEL--DA--------------------
KTHY_CITK8       ASIRTIDATQPLE----AVMNDIRTTVTAWIKEQ--GA--------------------
KTHY_ENT38       DSIRTIDATQSLE----GVTRSIRETITAWLQEQ--QA--------------------
KTHY_KLEP7       PSIRTVDATQPLD----AVARDIRATIAQWMAEQ--AA--------------------
KTHY_CROS8       PRIITIDACQPLE----AVSHDIRATVTRWVQEQ--Q---------------------
KTHY_YERP3       ASIKTIDASQPIE----QVSASISQALAQWLTNQ--ELV-------------------
KTHY_YERPS       ASIKTIDASQPIE----QVSASISQALAQWLTNQ--ELV-------------------
KTHY_YERPA       ASIKTIDASQPIE----QVSASISQALAQWLTNQ--EPV-------------------
KTHY_YERPP       ASIKTIDASQPIE----QVSASISQALAQWLTNQ--EPV-------------------
KTHY_YERPN       ASIKTIDASQPIE----QVSASISQALAQWLTNQ--EPV-------------------
KTHY_YERPE       ASIKTIDASQPIE----QVSASISQALAQWLTNQ--EPV-------------------
KTHY_YERE8       SSIKTIDASQPLE----QVSESISQVLKQWLTSR--ETA-------------------
KTHY_SERP5       ASIITVDASQSLD----QVTAAIRRCVSQWLQQQ--EGA-------------------
KTHY_PHOLL       KSIVTVDAAQPIE----QVQADIYQVLEQWLKQQ--ENG-------------------
KTHY_PECAS       DSILTIDASQSID----AVSADIQAALQQWLQQQGLQPVVQVQY--------------
KTHY_SODGM       DRMVTLDASQPLA----AVSAALRHQLTQWLRAQAPSP--------------------
KTHY_VIBC3       DSVVMIDAAQSIE----QVTADIRRALQDWLSQV--NRV-------------------
KTHY_VIBCH       DSVVMIDAAQSIE----QVTADIRRALQDWLSQV--NRV-------------------
KTHY_VIBPA       PSIVVINAEQSIE----EVSRDIQDALNEWLSRQ------------------------
KTHY_VIBCB       DSIVIINAEQSIE----DVAQDIKAALNKWLAAQ------------------------
KTHY_VIBVY       ASIVTINAEQSIE----QVANDIRSALNLWLEQL--QD--------------------
KTHY_VIBVU       ASIVTINAEQSIE----QVANDIRSALNLWLEQL--QD--------------------
KTHY_ALIF1       ESIITIDAGQDLE----TVTNSIITALEAWLVKN--GN--------------------
KTHY_PHOPR       PKVIIIDAGQSLE----NVTSDLKQALNHWLEKQ------------------------
KTHY_HAES1       PNAVLINADQPIE----LVQQDIRKAVQKFIEEN--V---------------------
KTHY_HISS2       PNAVLINAGQPIE----LVQQDIRKAVQKFIEEN--V---------------------
KTHY_MANSM       PKAVIINAEQSIE----RVTADIKTAVKNWVNSI--SL--------------------
KTHY_HAEIN       PKAVVINAEQSIE----LVQADIESAVKNWWKSN--EK--------------------
KTHY_PASMU       PKAVTIDASQTMS----KVAEDVESAIETWLTTR------------------------
KTHY_HAEDU       EKAVIINAEQPLE----KVTNDIQQAVQKFLTFA--Q---------------------
KTHY_WIGBR       EKIITIDASKSLE----LVNKEIKHQLLKWLKKQ--I---------------------
KTHY_BAUCH       SRIITIDAQQSIA----ELNATIRNNIERWLKSQ--QK--------------------
KTHY_SHESR       EQIVVIDASQTMA----EVHKDILAVLQAMAW--------------------------
KTHY_SHESM       EQIVVIDASQTMA----EVHKDILAVLQAMAW--------------------------
KTHY_SHESA       ERIVVIDASQTMA----EVHKDILAVLQAMAW--------------------------
KTHY_SHEON       ECIVVIDASQTMA----EVHKDILAVLQAMAW--------------------------
KTHY_SHELP       ESIVVIDASQTMA----QVHKEILAVLQRQDWS-------------------------
KTHY_SHEFN       DSIVVIDASQSME----QVHNDIGIQLQRHLSTLMSEQ--------------------
KTHY_SHEAM       SSIVVIDASKPLN----EVHKDILACLSTAL---------------------------
KTHY_PSEHT       NSIKTVDANQSIE----HVHRDITNVLRTFFAEQK-----------------------
KTHY_COLP3       DSIITVDAAQAML----KVHQDVEKAVIGFITNTDKG---------------------
KTHY_IDILO       PSIIVIDANQSML----DVHQSILRAIEEYLF--------------------------
KTHY_LEGPH       PEIIMIDANRSLE----EVQSSIQSVIEEFIEHNL-----------------------
KTHY_LEGPL       PEIMMIDANRSLE----EVQSSIQSVIEEFIEHNL-----------------------
KTHY_LEGPA       PEIMMIDANRSLD----EVQSSIQSVIEEFIEHNL-----------------------
KTHY_LEGPC       PEIMMIDANRPLE----DVQSSIQSVIEEFIEHNL-----------------------
KTHY_BLOPB       KNIITIDATQSLE----EVSMSIYRHLDWWFLRPQE----------------------
KTHY_BLOFL       ENIIMIDASQPLE----QVCVFIYRYLDQWLCDLYK----------------------
KTHY_BUCAI       KKTIIINANLNIK----KVTQNITKKMLNWLNKQVI----------------------
KTHY_BUCAP       KKIIKINANLNIK----IVTQNIKNQILKWLQQKVV----------------------
KTHY_BUCBP       PGIIKINANRKID----KVKHSCKQQMLSWLNTENL----------------------
KTHY_FRAT1       DNAIEIDAAKSIQ----EVEKQIYLILDKHFNFQN-----------------------
KTHY_FRATW       DNAIEIDAAKSIQ----EVEKQIYLILDKHFNFQN-----------------------
KTHY_FRATT       DNAIEIDAAKSIQ----EVEKQIYLILDKHFNFQN-----------------------
KTHY_FRATN       DNAIEIDAAKSIQ----EVEKQIYLILDKHFNFQN-----------------------
KTHY_FRATF       DNAIEIDAAKSIQ----EVEKQIYLILDKHFNFQN-----------------------
KTHY_FRATH       DNAIEIDAAKSIQ----EVEKQIYLILDKHFNFQN-----------------------
KTHY_FRATO       DNAIEIDAAKSIQ----EVEKQIYLILDKHFNFQN-----------------------
KTHY_WOLTR       DRCSIITEIEAKDN------NQVHVEIVNKVTATKPVLLRK-----------------
KTHY_WOLPM       VRCSVITGIETKND------NHVHNEIIDKIT--------------------------
KTHY_EHRCR       HRCHVITDKSETYD--IDDINFVHLEVIKVLQMV------------------------
KTHY_EHRCJ       HRCHIITDNNEICD--IDGINLIHLKIVKVLQMV------------------------
KTHY_EHRRW       YRCYLITNVDATKN--INEISAIYLKTIKILHAL------------------------
KTHY_EHRRG       YRCYLITNVDATKN--INEISAIYLKTIKILHAL------------------------
KTHY_ANAMM       HRCHMIDCKSDAAE----DVYSTHDRIVALFRAITQDKLKVAK---------------
KTHY_ANAPZ       HRCVLLRCDDYEENG-ICDVYSVHNKIVGLLQGVLHNKMDAASSSVKV----------
KTHY_NEOSM       N-IHVIKCMGVGRTS-EEIVKIVQGKISEKQTSSCR----------------------
KTHY_RICRO       ERIKTIKASDLS-------PLEVHELIKKHL---------------------------
KTHY_RICRS       ERIKTIKASDLS-------PLEVHELIKKHL---------------------------
KTHY_RICCN       ERIKTIKASDLS-------PLEVHELIKKHL---------------------------
KTHY_RICM5       ERIKTIKASDLS-------PLEVHELIKKHL---------------------------
KTHY_RICFE       ERIKTIKASDLS-------PLEVHELIKKHLYTR------------------------
KTHY_RICCK       ARIKTIKASDLS-------MLEVHELIKKHL---------------------------
KTHY_RICAH       ERIKTIKASDLS-------PPEVHELIKKHL---------------------------
KTHY_RICPR       ERIKTIKASHLS-------PLEVHELIQKHL---------------------------
KTHY_RICTY       ERIKTIKASHLN-------PLEVHELIQKHL---------------------------
KTHY_RICB8       ERIVTIKASDLN-------PEQVHELIKKHLNLI------------------------
KTHY_RICBR       ERIVTIKASDLN-------PEQVHELIKKHLNLI------------------------
KTHY_ORITB       ERIVQINGEPMIED----VSSEVINIINNKMKVNLLR---------------------
KTHY_MYCS5       NRFVVVDATKPVNEIVDFIFNYLVKHKDFVKFLK------------------------
KTHY_MYCPU       KRIFVIDASKNQEEIFESVLKILKDHKTFQTHPIYKDFFS------------------
KTHY_UREPA       KKIIFIDANKNENEVLCEVKEQLLKIFKEHKYI-------------------------
KTHY_UREP2       KKIIFIDANKNENEVLCEVKEQLLKIFKEHKYI-------------------------
KTHY_MYCMO       DRFILVNAEENVGTILKNILNEFDKILKK-----------------------------
KTHY_MYCHJ       -NFFKIDGNGTYDEVLDLIIDFFEKYYASWPK--------------------------
KTHY_MYCH2       -NFFKIDGNGTYDEVLDLIIDFFEKYYASWPK--------------------------
KTHY_MYCH7       -NFFKIDGNGTYDEVLDLIIDFFEKYYASWPK--------------------------
KTHY_MYCPN       KRVFLLDGQ-NQTGCLEQFIEQLSQCLTQPTLS-------------------------
KTHY_MYCGE       KNCFLINGD-NKQEHLEKFIELLTRCLQQPTHY-------------------------
KTHY_MYCGA       KKAKIINASLDLDTVYDQVVNIITLFVKNHELN-------------------------
KTHY_MYCPE       RNVIRLDALKPVEELANKICATILERVR------------------------------
KTHY_CAMJR       VEILTLDAKESKE----KLHQQIKEFLQ------------------------------
KTHY_CAMJE       VEILTLDAKESKE----KLHQQIKEFLQ------------------------------
KTHY_CAMJJ       IEILTLDAKESKE----KLHQQIKEFLQ------------------------------
KTHY_CAMJ8       IEILTLDAKESKE----KLHQQIKEFLQ------------------------------
KTHY_CAMJD       IEILTLDAKESKE----KLHQQIKEFLQ------------------------------
KTHY_CAMC1       FETLFIDASKSIE----LISKEIENFINFK----------------------------
KTHY_CAMHC       IDALEIDANGDIN----EIHKKIKEFVK------------------------------
KTHY_SULDN       IELVLIDATKNID----SITQEILNNINI-----------------------------
KTHY_HELHP       LKYIVLDATQDKE----RICAQIREHINILV---------------------------
KTHY_HELPJ       CEVLELDAQKSAK----NLHEKIATFIECVV---------------------------
KTHY_HELPY       CEVLELDAKESVK----NLHEKIAAFIKCAV---------------------------
KTHY_HELPH       CEVLELDAQKSVG----DLHRQIAAFIECVV---------------------------
KTHY_HELAH       CEVLELNAKENAK----NLHERISAFIQCVV---------------------------
KTHY_METMA       GRFVVIDASRPQE----EVEKKVIKKVLEFIQRIS-----------------------
KTHY_METAC       ERFVIVDASGSPE----DVEKAVVQKILDFVQRIE-----------------------
KTHY_METBF       ERFVVIDASRSPE----YIEKEVVKKILEFLSRN------------------------
KTHY_METBU       ERFVVIDTDRDLK----EIEKDVLQAITSIIES-------------------------
KTHY_HALSA       ERFVRIDATQSPE----AVIADAEAALADALPDDAWA---------------------
KTHY_HALMA       ERFVRVDATADPD----TVYERVRAAILD-----------------------------
KTHY_NATPD       ERFHRIDATQSES----AVVEAAVETVETLLSR-------------------------
KTHY_METHJ       ARFLILDGTLPPE----HILKVAGEAIRFRFDEMNRKKKKS-----------------
KTHY_METLZ       ERFLLIDAAQEPE----TILDFVEKSIR----ALPRQ---------------------
KTHY_METMJ       LRFVVVDALLPKE----EVARFIAGEIRAGARSSRRRPRA------------------
KTHY_PYRAB       KEMRIVNAMASVE----EVHEDIVALVKHELLGL------------------------
KTHY_PYRHO       PEMRIVNALSSIE----DIHSDIVALVKHELLGL------------------------
KTHY_PYRFU       DEIKIIDATKSVE----EVHREIISSIK-EIWGKNYGSR-------------------
KTHY_THEKO       PEMKIINAMEDVE----TVHNQIIALIE-TLLGEE-----------------------
KTHY_XANOR       PGKHVVDASADAD----SVLRQAHAIIVAALADRLSGDGAPADTGKAALELLSAGRPA
KTHY_XANOM       PGKHVVDASADAD----SVLRQAHAIIVAALADRLSGDGAPADTGKAALELLSAGRPA
KTHY_XANAC       PGKHVVDASADAD----SVLRQAHAIIVAALADRLSGDAAHTDTGKAALELLSAGRPA
KTHY_XANC5       PGKHVVDASADAD----SVLRQAHAIIVAALADRLSGDA-HTDTGKAALELLSGGRPA
KTHY_XANCP       PGKHVIDASADAD----SVLRQAHAVVVAALADRLRVGATHTDAEKAALELLSAGRPA
KTHY_XANC8       PGKHVIDASADAD----SVLRQAHAVVVAALADRLRVGATHTDAEKAALELLSAGRPA
KTHY_XYLFA       PSKRVIDATANAE----TVLSAALALVMEVLRVRL------GALGAVVLRRLAG----
KTHY_XYLFT       PSKRVIDATANAE----TVFSAALGLVMEVLRVRL------GALGAVVLERLAG----
KTHY_DESPS       PYIRHINACQSID----NVQRDIIMQVKQLLKMA------------------------
KTHY_LEPBJ       KETIRIDGVKGPD----EIVQECLEIFLRNFNKKFL----------------------
KTHY_LEPBL       KETIRIDGVKGPD----EIVQECLEIFLRNFNRKFL----------------------
KTHY_LEPIC       KDTIRIDGNKNQN----QIVQECLEIFLTNIKSKS-----------------------
KTHY_LEPIN       KDTIRIDGNKNQN----QIVQECLEIFLTNIKSKS-----------------------
KTHY_ARCFU       ETTVVVDASKPLE----EVKEEVRKVIESFLNLKKNSN--------------------
KTHY_PYRCJ       -GYPVIDAGRPAG----EVAKDVVAIIERAMASLRR----------------------
KTHY_PYRAE       -GYPVIDASRRPE----EVAADVAELIKRVVRFK------------------------
KTHY_STAMF       -YMVLVDANREFD----KVYRDVEKIVLEHLVF-------------------------
KTHY2_SACS2      -NFITIDGNRPLK----DVQIDIRKILGEYIDNSL-----------------------
KTHY2_SULTO      -NFIVIDGTKTPK----EIQIQIRKFVGELIDNSF-----------------------
KTHY_THEVO       ---IKVDGTDPLD----KITNEVYLYLKNKIGL-------------------------
KTHY_THEAC       ---LIVDGGRDKE----AIISETFEKIIARLRQEKT----------------------
KTHY_PICTO       IKIPVIKINAEMEYN--YVKDEAIKGLNDYL---------------------------
KTHY_SYNY3       GQLCRLDASLPVE----QLHQAIITKVEEML---------------------------
KTHY_METKA       VEIKWIEAEDMDKE---EIAELIVADARRRLDDPLGIPDDLLEG--------------
KTHY_MYCTU       GRWLVVGADVDPG----RLAATLAPPDVPS----------------------------
                      :