CLUSTAL format seed alignment for MF_00168

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TGT_HELPJ       --------------MDFQLQA--VDDNARAGVLNLAHS----QVETPVFMPVGTQGCIKS
TGT_CAMJE       --------------MEFKLKH--KDGMARVCEITTAHS----TFLTPVFMPVGTVGAVKS
TGT_BORBU       -------------MFSVIKND--KHFNARVGFLNLPHG----RVDIPCFMPVGTLGAMKG
TGT_MOUSE       MAAVGSPGSLESAPRIMRLVAECSRSGARAGELRLPHG----TVATPVFMPVGTQATMKG
TGT_RAT         MAAVGSPGSLESAPRIMRLVAECSRSRARAGELRLPHG----TVATPVFMPVGTQATMKG
TGT_HUMAN       MAGAATQASLESAPRIMRLVAECSRSRARAGELWLPHG----TVATPVFMPVGTQATMKG
TGT_XENLA       ------MAATKSHALVHRVLAECPVTKARACELQMPHG----QVKTPVFMPVGTQGTMKG
TGT_XENTR       ------MAAPQCHALVHRVLAECPVTKARACEFRLPHG----PVKTPVFMPVGTQGTMKG
TGT_DANRE       --MASVKAVSSAAPLALRIVAECPVSKARACSLTLPHC----AVNTPVFMPVGTQGTMKG
TGT_DROME       ------MGPSHIPPLTYKVVAECSVSKARAGLMTLRHS----EVNTPVFMPVGTQGTLKG
TGT_SCHPO       -------MASSFPALQFKVVARCSTTRARVTDIQLPHG----LVESPVFMPVGTQASLKG
TGT_CAEEL       --------------MRYDVLARAGF--ARRGNLHLPHS----IVETPVFMPVGTQGTMKG
TGT_CAEBR       --------------MKYDVLARAGF--ARRGNLHLPHS----IVETPVFMPVGTQGTMKG
TGT_NOSS1       ----------MSAIFSFQSLARCSQTKARSGIFLTPHG----IVETPRFMPVGTLANVKT
TGT_SYNY3       -------MPLPSVNFTYQCQARCSHSQARAGIFQTPHG----PVETPRFMPVGTLATVKG
TGT_DEIRA       ------MNQCGTITAVFEFEIKQRDGRARTATFQTPRG----AVTTPMFMPVGTQGTVKG
TGT_LISIN       -----------MSAIRYELIKTDKQTGARLGKIHTPHG----TFDTPMFMPVGTLATVKT
TGT_LISMO       -----------MSAIRYELIKTDKQTGARLGKIHTPHG----TFDTPMFMPVGTLATVKT
TGT_BACSU       ---------MAEQPIRYEFIKECKQTGARLGKVHTPHG----SFETPVFMPVGTLATVKT
TGT_ALKHC       -----------MAAVTYELIKTCKQSGARLGKLHTPHG----TIETPIFMPVGTLATVKT
TGT_STAAM       -----------MPAVTYEHIKTCKQSGARLGIVHTPHG----SFETPMFMPVGTKATVKT
TGT_STRPN       ---------MSDSPIKYRLIKKEKHTGARLGEIITPHG----TFPTPMFMPVGTQATVKT
TGT_STRP1       ---------MTDYPIKYRLIKAEKHTGARLGEIITPHG----TFPTPMFMPVGTQATVKT
TGT_LACLA       ---------MTEHAIKYRLIKKEKHTGARLGEIITPHG----TFPTPMFMPVGTQATVKT
TGT_CLOAB       ---------------MYTLLK--KTGKVRRGRFETVHG----TIETPVFMNVGTLAAIKG
TGT_CLOPE       -----------MTKKRYTLLK--KDGKARRGEFVTPHG----TIQTPIFMNVGTLAAIKG
TGT_BRUME       ---------MTTENFGFKVLA--RDGAARQGEISMPRG----VVRTPAFMPVGTAGTVKA
TGT_RHILO       ----------MAKPFSFKVLA--TDGRARRGIIDMPRG----EIRTPAFMPVGTGGTVKT
TGT_RHIME       ----------MTETFQFKLLA--ADGNARRGEVVTPRG----TIRTPAFMPVGTVGTVKA
TGT_CAUVC       -----------MAAFPFEIEA--TDGKARTGVLKTPRG----DIRTPAFMPVGTAATVKA
TGT_ZYMMO       -MVEATAQETDRPRFSFSIAA--REGKARTGTIEMKRG----VIRTPAFMPVGTAATVKA
TGT_RICCN       -----------MSKFSFNIHH--QHKKARSGIIVTAHG----EMRTPAFMPVGTRGTVKA
TGT_RICPR       -----------MSKFSFTIHS--HYKKARSGVITTAHG----EIRTPAFMPVGTRGAVKA
TGT_ECOLI       --------------MKFELDT--TDGRARRGRLVFDRG----VVETPCFMPVGTYGTVKG
TGT_SHIFL       --------------MKFELDT--TDGRARRGRLVFDRG----VVETPCFMPVGTYGTVKG
TGT_SALTI       --------------MKFELDT--TDGRARRGRLVFDRG----VVETPAFMPVGTYGTVKG
TGT_SALTY       --------------MKFELDT--TDGRARRGRLVFDRG----VVETPAFMPVGTYGTVKG
TGT_YERPE       --------------MKYELQK--TDGRARRGRLVFERG----VVETPAFMPVGTYGTVKG
TGT_HAEIN       --------------MKYELDK--TSGNARRGRLVFERPQGTFSVETPAFMPVGTYGTVKG
TGT_PASMU       --------------MKYELDK--TDGNARRGRLVFERPQGTFTVETPAFMPVGTYGTVKG
TGT_VIBCH       ------------MKLKFELKK--KNGNARRGQLIFERG----TVQTPAFMPVGTYGTVKG
TGT_PSEAE       --------------MNFELLA--TDGKARRGRLTFPRG----VVETPAFMPVGTYGTVKG
TGT_XYLFA       -----------MSRLQFQLQA--TDGAARRGQLSFPCG----TVQTPAFMPVGTYGAVKG
TGT_NEIMA       -------------MLKFTLHK--KDGYARRGTLELNHG----KIETPVFMPVGTYGSVKA
TGT_NEIMB       -------------MLKFTLHK--KDGLARRGTLELNHG----KIETPVFMPVGTYGSVKA
TGT_RALSO       -------------MLNFDLLT--TDGLARRGRMTLNHG----VVETPIFMPVGTYGAVKA
TGT_BUCAI       --------------MNFKVLY--QDNNARCGVFNFNQE----IIETPVFMPVGTYGAVKS
TGT_AQUAE       -------------MFKFHLIT--KDGKARRGRIYTPHG----VIETPVFMPVGTQGTVKA
TGT_THEMA       --------------MEFEVKK--TFGKARLGVMKLHHG----AVETPVFMPVGTNASVKL
TGT_ARCFU       ------------MPLKFRIKH--TLDRMRVGKVKTRHG----SFETPVFIPVATLAAIRG
TGT_CHLMU       ------------MALRFEILHQSKKSRARVGRIETEHG----CIDTPAFVPVATNGALKG
TGT_CHLTR       ------------MALRFEILHQSKKSRARVGRIETAHG----YIDTPAFVPVATNGALKG
TGT_CHLPN       ------------MALKFHLIHQSKKSQARVGQIETSHG----VIDTPAFVPVATHGALKG
                                            *   .          .  * *: *.* . :: 

TGT_HELPJ       LDAMDAQEILGAKLILANTYHMYLRPGEKVVEQLGGLHRFAQFQGSFLTDSGGFQAFS--
TGT_CAMJE       LDANDMKNELDAKIILANTYHMYLRPTSKVVKDFGGLHGFTKFDRSFLTDSGGFQAFS--
TGT_BORBU       LK-HAVLEKLECNLMLANTYHLYLRLGIKTVEKYVGLHNFTIWNKNFLTDSGGFRVFS--
TGT_MOUSE       I-TTEQLDSLGCRICLGNTYHLGLRPGPELIRKAQGLHGFMNWPHNLLTDSGGFQMVS--
TGT_RAT         I-TAEQLDSLGCRICLGNTYHLGLRPGPELIQKAHGLHGFMNWPHNLLTDSGGFQMVS--
TGT_HUMAN       I-TTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVS--
TGT_XENLA       V-TADQLRNLGCEICLGNTYHLGMRPGPEIMKKASGLHGFMNWDRNLLTDSGGFQMVS--
TGT_XENTR       V-TADQLRNLGCEICLGNTYHLGMRPGPEIMKKAGGLHGFMNWGRNLLTDSGGFQMVS--
TGT_DANRE       I-TADQLEDLDCQICLGNTYHLGMRPGPDLIEKANGLHGFMKWRRNLLTDSGGFQMVS--
TGT_DROME       I-VPDQLIELNCQILLGNTYHLGLRPGIETLKKAGGLHKFMGWPRAILTDSGGFQMVS--
TGT_SCHPO       V-LPEQLDALGCKIMLNNTYHLGLKPGQEVLDTVGGAHRFQSWNKNILTDSGGFQMVS--
TGT_CAEEL       I-VPEQLVSMDCRILLCNTYHLGHRPGHERVKAAGGLHKMMNWNRSILTDSGGFQMVS--
TGT_CAEBR       V-VTEQLVAMDCRILLCNTYHLGHRPGHERVKAAGGIHKMMNWNRSILTDSGGFQMVS--
TGT_NOSS1       V-TPAQLKETGAQMVLSNTYHLHLQPGEAIVAGGGGLHKFMGWNGPMLTDSGGFQVFS--
TGT_SYNY3       I-TPAQLADTQAQMVLANTYHLHLQPGEKIIAAAGGVHKFMGWSGPMLTDSGGFQVFS--
TGT_DEIRA       I-SPQELLEIGSQMILANTYHLMLRPGEQLVKAHGGLPGFTAYPGPFLTDSGGFQVMS--
TGT_LISIN       M-SPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFS--
TGT_LISMO       M-SPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFS--
TGT_BACSU       M-SPEELKAMDAGIILSNTYHLWLRPGQDIVKEAGGLHKFMNWDRAILTDSGGFQVFS--
TGT_ALKHC       M-SPEELKQLGAQIILSNTYHLWLRPGHDIVKEAGGLHEFMNWDRPILTDSGGFQVFS--
TGT_STAAM       M-SPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFS--
TGT_STRPN       Q-SPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYS--
TGT_STRP1       Q-SPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS--
TGT_LACLA       M-SPEELKTLGSGIILSNTYHLWLRPGDELVAEAGGLHKFMNWDQPILTDSGGFQVYS--
TGT_CLOAB       AVSSMDLKEINCQVELSNTYHLSLRPGDDVVKKLGGLHKFMNWDRPILTDSGGFQVFS--
TGT_CLOPE       AVSSMDLKEIGCQVELSNTYHLHLRPGDKIVKQMGGLHNFMNWDRPILTDSGGFQVFS--
TGT_BRUME       M-YMDQVKELGADIILGNTYHLMLRPGAERVARLGGLHEFGGWKGPILTDSGGFQVMS--
TGT_RHILO       M-YMDQVRGVGADIILGNTYHLMLRPGAERVARLGGLHEFARWPHPILTDSGGFQVMS--
TGT_RHIME       M-YLDQVRDLGADIILGNTYHLMLRPGAERVARLGGLHKFIRWERPILTDSGGFQVMS--
TGT_CAUVC       M-TVDQVKDTGADIILGNTYHLMLRPSAERVKRLGGLHKFMRWDKPILTDSGGFQVMS--
TGT_ZYMMO       L-KPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMS--
TGT_RICCN       M-LPESVAETGADILLGNTYHLMLQPTAERIVQLGGLHKFMNWDKPILTDSGGFQVMS--
TGT_RICPR       M-LTEAVVETGADILLGNTYHLMLQPSAERIAYLGGLHKFMNWDKPILTDSGGFQVMS--
TGT_ECOLI       M-TPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFS--
TGT_SHIFL       M-TPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFS--
TGT_SALTI       M-TPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFS--
TGT_SALTY       M-TPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFS--
TGT_YERPE       M-TPEEVKETGAQILLGNTFHLWLRPGQEIMKLHGDLHDFMQWHGPILTDSGGFQVFS--
TGT_HAEIN       M-TPEEVRATGAEILLGNTFHLWLRPGQEVMRKHGDLHDFMQWHRPILTDSGGFQVFS--
TGT_PASMU       M-TPEEVRATGAEILLGNTFHLWLRPGQEVMRKHGDLHDFMQWHRPILTDSGGFQVFS--
TGT_VIBCH       M-TPEEVKETGAQILLGNTFHLWLRPGQEVMKMHGDLHDFMNWQGPILTDSGGFQVFS--
TGT_PSEAE       M-LPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFS--
TGT_XYLFA       V-LPGQLCDLGAEIILGNTFHLFLRPGLEVIADHGGLHGFMRWNGPILTDSGGFQVFS--
TGT_NEIMA       M-NPQNLHDIKAQIILGNTYHLWLRPGLEVVEQFGGLHGFIGWDKPILTDSGGFQVFS--
TGT_NEIMB       M-NPQNLHDIKAQIILGNTYHLWLRPGLEVIGQFGGLHGFIGWDKPILTDSGGFQVFS--
TGT_RALSO       M-SPVELKDIGAQIILGNTFHLWLRPALEVIDAHKGLHGFVGWDKPMLTDSGGFQVFS--
TGT_BUCAI       I-STEEIKNTGSRIILSNAFHLYFRPGLEIIKLHGNLHNFMNWSGPILTDSGGFQVFS--
TGT_AQUAE       M-LHKLLDEIGTQIILGNTYHLYLRPGTEIIKKAGGLHRFISWNKPILTDSGGYQVFS--
TGT_THEMA       L-TPRDLEEAGAEIILSNTFHLMLKPGVEIIKLHRGLHNFMGWKRPILTDSGGFQVFS--
TGT_ARCFU       L-DNRDLKDMGVEVILANTYHLHLRPGDELIKELGGLHKFMNFDGVIVTDSGGFQAFSLG
TGT_CHLMU       V-----LDHSNIPLMFCNTYHLIVHPGAEAVAAMGGLHQFIGRNAPIITDSGGFQIFSLA
TGT_CHLTR       V-----LDHSNIPLMFCNTYHLIVHPGAEAIAAMGGLHQFIGRNAPIITDSGGFQIFSLA
TGT_CHLPN       V-----IDHSDIPLLFCNTYHLLLHPGPEAVAKLGGLHQFMGRQAPIITDSGGFQIFSLA
                             : : *::*:  :     :    .   :      ::*****::  *  

TGT_HELPJ       ---------------LSDNV---------------KLQEDGIVFKSHIDGSKHLFTPIKV
TGT_CAMJE       ---------------LSKNS---------------KHFNEGIEFKSHIDGSRHLFTPKSV
TGT_BORBU       ---------------FSDLR---------------KIDLKGVHFKSHIDGSYHYFTSEGI
TGT_MOUSE       ---------------LFSLS---------------EVTEEGVHFRSPYDGEETLLSPERS
TGT_RAT         ---------------LISLS---------------EVTEEGVRFRSPYDGEETLLSPERS
TGT_HUMAN       ---------------LVSLS---------------EVTEEGVRFRSPYDGNETLLSPEKS
TGT_XENLA       ---------------LVELS---------------KVTEEGVQFRSPYDGKEILLTPEKS
TGT_XENTR       ---------------LVELS---------------KVTEEGVQFRSPYDGKEILLTPEKS
TGT_DANRE       ---------------LVELS---------------EVTEEGVTFRSPYDGKEILLTPEQS
TGT_DROME       ---------------LLQLA---------------EIDEHGVNFRSPFDNSQCMLTPEHS
TGT_SCHPO       ---------------LLKLA---------------TITEDGVTFLSPRDGTPMLLTPEHS
TGT_CAEEL       ---------------LSKLM---------------TVDENGVNFESPHTGEMMALPPEKS
TGT_CAEBR       ---------------LSKLM---------------TVDENGVNFESPHTGEMMALPPEKS
TGT_NOSS1       ---------------LSEMR---------------KITEEGVTFRSPRDGQIIKLTPERS
TGT_SYNY3       ---------------LSQLR---------------TIGEQGVLFRSPRDGRLIDMTPENS
TGT_DEIRA       ---------------LGHMR---------------KISEEGVVFKNHLDGSRVELTPERS
TGT_LISIN       ---------------LSKMR---------------DIKEEGVHFRNHLNGDKLFLSPEKA
TGT_LISMO       ---------------LSKMR---------------DIKEEGVHFRNHLNGDKLFLSPEKA
TGT_BACSU       ---------------LSKFR---------------NIEEEGVHFRNHLNGDKLFLSPEKA
TGT_ALKHC       ---------------LSDLR---------------TIEEEGVHFRNHLSGEKLFLSPEGA
TGT_STAAM       ---------------LSNLR---------------KITEEGVEFRHHTNGSKLFLSPEKS
TGT_STRPN       ---------------LADSR---------------NITEEGVTFKNHLNGSKMFLSPEKA
TGT_STRP1       ---------------LADSR---------------NITEEGVTFKNHLNGSKMFLSPEKA
TGT_LACLA       ---------------LVQNKK--------------NITEEGVKFKSHLDGRELFLNPEKA
TGT_CLOAB       ---------------LAEIR---------------KIKEEGVYFNSHIDGRKIFMGPEES
TGT_CLOPE       ---------------LAGMR---------------KIKEEGVYFNSHIDGRKIFMGPEES
TGT_BRUME       ---------------LAQLR---------------KLNEHGVTFRSHIDGKAYEMTPERS
TGT_RHILO       ---------------LSKLR---------------KLTEKGVTFRSHIDGAPYEMSPERS
TGT_RHIME       ---------------LSSLR---------------KLNEQGVTFKSHVDGALYHMSPERS
TGT_CAUVC       ---------------LSGIS---------------KLTEEAVTFSSHVDGSKHVLTPERS
TGT_ZYMMO       ---------------LSSLT---------------KQSEEGVTFKSHLDGSRHMLSPERS
TGT_RICCN       ---------------LSKLC---------------KITEEGVSFSSHINGDKYMLTPERS
TGT_RICPR       ---------------LSKLC---------------KITEEGVSFRSHINGNKYMLTPEYS
TGT_ECOLI       ---------------LGDIR---------------KITEQGVHFRNPINGDPIFLDPEKS
TGT_SHIFL       ---------------LGDIR---------------KITEQGVHFRNPINGDPIFLDPEKS
TGT_SALTI       ---------------LGDIR---------------KITEQGVHFRNPINGDPIFLDPEKS
TGT_SALTY       ---------------LGDIR---------------KITEQGVHFRNPINGDPIFLDPEKS
TGT_YERPE       ---------------LGAMR---------------KIKEEGVHFKNPINGDSVFLSPEKS
TGT_HAEIN       ---------------LGKLR---------------KITEEGVKFQNPINGERIFLSPEKS
TGT_PASMU       ---------------LGKLR---------------KITEEGVKFQNPINGERIFLSPEKS
TGT_VIBCH       ---------------LGDIR---------------KITEEGVHFRNPVNGDKIFMDAEKS
TGT_PSEAE       ---------------LGAMR---------------KIKEEGVTFASPVDGAKVFMGPEES
TGT_XYLFA       ---------------LAHRR---------------KISEQGVTFAAPTDGAQVFLGPEES
TGT_NEIMA       ---------------LSDMR---------------KLTEEGCTFKSPINGDKLFLSPEIS
TGT_NEIMB       ---------------LSDMR---------------KLTEEGCTFKSPINGDKLFLSPEIS
TGT_RALSO       ---------------LGDLR---------------KITEEGVHFASPINGDRLFLSPEIS
TGT_BUCAI       ---------------LSRFC---------------KVNEEGVIFQNHIDGKKTFLTPKIS
TGT_AQUAE       ---------------LAKGKFG-------NRKAKVKVSDEGVEFQDHLQGDKHFFTPEKV
TGT_THEMA       ---------------LPK----------------IRIDDEGVVFRSPIDGSKVFLNPEIS
TGT_ARCFU       FGMEHGVGKIANNIFLEELREERLREAENERKKLAVVTDRGVRFKDPKSGRIVELTPKKS
TGT_CHLMU       YGSV-----------AEEIKSCGKKK---GENSIIKINDEGVWFKSYRDGRKLFLSPEVS
TGT_CHLTR       YGSV-----------AEEIKSCGKKK---GGNTIIKVNDDGVHFKSYRDGRKLFLSPEIS
TGT_CHLPN       YGSV-----------AEEIKSCGKKK---GMSSLVKITDEGAWFKSYRDGRKLFLSPELS
                                                        .  *     .    : .   

TGT_HELPJ       LDIQ-YSLNSDIMMVLDDLVGLP-----APLKRLEESIKRSAKWANMSLEYHKENNRP--
TGT_CAMJE       LDTQ-YDFNSDIMMILDDLVALP-----ATKERVKISVDRTILWAKEAITYHKNMQNKG-
TGT_BORBU       FAMQ-EIFGSDIIMPLDICSSYG-----IDYNEANLYTNITTNWASSTFKSSKNRKEG--
TGT_MOUSE       VEIQ-NALGSDIIMQLDHVVSST-----VTGPLVEEAMHRSVRWLDRCIAAHKHPD----
TGT_RAT         VEIQ-NALGSDIIMQLDDVVSST-----VTGPRVEEAMHRSVRWLDRCIAAHKRQD----
TGT_HUMAN       VQIQ-NALGSDIIMQLDDVVSST-----VTGPRVEEAMYRSIRWLDRCIAAHQRPD----
TGT_XENLA       IEIQ-NALGSDIMMQLDDVVSST-----ISGPRVEEAMHRSIRWLDRCIAANGNPD----
TGT_XENTR       IEIQ-NALGSDIMMQLDDVVSST-----ITGPRVEEAMHRSIRWLDRCIAANSNPD----
TGT_DANRE       IAIQ-NSLGSDIMMQLDDVVSST-----VKGPRVEEAMHRSVRWLDRCIAANKNPD----
TGT_DROME       IEIQ-NAIGGDIMMQLDDVVKTT-----TTGPRVEEAMERTIRWVDRCIEAHARDD----
TGT_SCHPO       ISLQ-NSIGSDIMMQLDDVVHTL-----TESKRMEEAMYRSIRWLDRCIQAHKRPE----
TGT_CAEEL       IEIQ-QALGADIMMQLDHVIHVL-----TTGDIVKEAMHRSIRWLDRCKVAHTR-D----
TGT_CAEBR       IEIQ-QALGADIMMQLDHVIHVL-----TTGDIVKEAMHRSIRWLDRCKVAHTR-D----
TGT_NOSS1       IEIQ-NILGADVIMAFDECPPYP-----ANRQEVEAATERTYRWLERCITAHQRQ-----
TGT_SYNY3       IRIQ-NALGADVIMAFDECPPGQ-----GDRLMVEQATARTYRWLERCIEAHQRPG----
TGT_DEIRA       IQVQ-EALGADVIMAFDECPPYP-----AERPYIEASLDRTVRWLERCHAVKTKD-----
TGT_LISIN       IQIQ-NALGSDIMMSFDECPPYP-----ASHEYMKKSVERTSRWAERGLKAHERPE----
TGT_LISMO       IQIQ-NALGSDIMMSFDECPPYP-----ASHEYMKKSVERTSRWAERGLKAHVRPE----
TGT_BACSU       MEIQ-NALGSDIMMAFDECPPYP-----AEYDYMKRSVERTSRWAERCLNAHNRQD----
TGT_ALKHC       MEIQ-NALGSDIMMAFDECPPYP-----AERDYMRPSVERTSRWAERCLKAHKRPE----
TGT_STAAM       MQIQ-NDLGSDIMMAFDECPPMP-----AEYDYVKKSIERTTRWAKRCLDAHQRPE----
TGT_STRPN       ISIQ-NNLGSDIMMSFDECPQFY-----QPYDYVKKSIERTSRWAERGLKAHRRPH----
TGT_STRP1       ISIQ-NNLGSDIMMSFDECPQFY-----QPYDYVKKSIERTSRWAERGLKAHRRPH----
TGT_LACLA       ISIQ-NNLGSDIMMSFDECPPFY-----QPYDYVKASVERTSRWAERGLNAHRRPN----
TGT_CLOAB       MKIQ-SNLASTIAMAFDECVENP-----SPREYVERSVERTTRWLVRCKEELDRLNSLPD
TGT_CLOPE       MQIQ-SNLGSTIAMAFDECIPNP-----STREYVEKSVARTTRWLERCKKEMDRLNSLDD
TGT_BRUME       IEIQ-GLLDSDIQMQLDECVALP-----SPEKNTERAMELSLRWAERCKVAFGDQ-----
TGT_RHILO       IEIQ-SLLDSDIQMQLDECTALP-----AELKEIERAMELSLRWAERCKTAFGDQ-----
TGT_RHIME       IEIQ-GLLGSDIQMQLDECVALP-----AEPDEIERAMEMSLRWAERCKVAFGDQ-----
TGT_CAUVC       IEIQADLLGSDIVMQLDECVAWP-----AEEARARKGMELSARWAKRSKDAFGTR-----
TGT_ZYMMO       IEIQ-HLLGSDIVMAFDECTPYP-----ATPSRAASSMERSMRWAKRSRDAFDSRKEQA-
TGT_RICCN       TEIQ-YLLGSTITMAFDECTPYP-----ATFEEAKTSMQLTTRWANRSRNAFVKR-----
TGT_RICPR       TEIQ-YLLGSTITMALDECTPYP-----STFEKAKTSMHLTTRWANRSRDAFVKR-----
TGT_ECOLI       MEIQ-YDLGSDIVMIFDECTPYP-----ADWDYAKRSMEMSLRWAKRSRERFDSLG----
TGT_SHIFL       MEIQ-YDLGSDIVMIFDECTPYP-----ADWDYAKRSMEMSLRWAKRSRERFDSLG----
TGT_SALTI       MEIQ-YDLGSDIVMIFDECTPYP-----ADWDYAKRSMEMSLRWAKRSRDRFDSLG----
TGT_SALTY       MEIQ-YDLGSDIVMIFDECTPYP-----ADWDYAKRSMEMSLRWAKRSRDRFDSLG----
TGT_YERPE       MEIQ-YDLGSDIVMIFDECTPYP-----ADWDYAKRSMEMSLRWAARSRQRFDELN----
TGT_HAEIN       MEIQ-YDLGSDIVMIFDECTPYP-----ATFDYAKKSMEMSLRWAKRSRDRFDELG----
TGT_PASMU       MEIQ-YDLGSDIVMIFDECTPYP-----ATFDYAKKSMEMSLRWAKRSRDRFDELG----
TGT_VIBCH       MEIQ-KDLGSDIVMIFDECTPYP-----ATHDEAKKSMEMSLRWAKRSRDHFDKLE----
TGT_PSEAE       MAVQ-RALGSDIVMIFDECTPYP-----ADHDVAKRSMELSLRWAKRSK--IAHGD----
TGT_XYLFA       MKIQ-KVLNSDIVMIFDECTPYP-----ATEDVARDSMELSLRWAQRSRDAHDALD----
TGT_NEIMA       MKIQ-TVLNSDIAMQLDECTPGE-----ATREQARKSLQMSLRWAERSKKAFEDLK----
TGT_NEIMB       MKIQ-TVLNSDIAMQLDECTPGE-----ATREQARKSLQMSLRWAERSKKAFEDLK----
TGT_RALSO       MQIQ-RRLNSDIVMQFDECTPYQIDGRPATEAEAAASMRMSLRWAQRSRNEFERER----
TGT_BUCAI       MKIQ-SDLGSNIVMIFDQCIEYN-----QNWEKTKNAMERSLYWAKKSRIYFDSYK----
TGT_AQUAE       VEIQ-EIFGSDIMMPLDECVEYP-----VDKNYAEKALKRTINWLERSIKAKKRED----
TGT_THEMA       MEVQ-IALGSDICMVFDHCPVPD-----ADYEEVKEATERTYRWALRSKKAFKTEN----
TGT_ARCFU       MEIQ-SNLGSDIIFAFDECTSPL-----SDRDYTEKALERTHRWAEECLQHYDRRQ----
TGT_CHLMU       VQAQ-KHLGADIIIPLDELLPFH-----TDPAYFQQSSQRTYAWEKRSLDYHLANP----
TGT_CHLTR       VQAQ-KDLGADIILPLDELLPFH-----ADPTYFHQSSQRTYVWEKRSLDYHLKNP----
TGT_CHLPN       VQAQ-KDLGADIIIPLDELLPFH-----TDQEYFLTSCSRTYVWEKRSLEYHRKDP----
                   *   : . : : :*                       :  *                

TGT_HELPJ       ----NNNLFAIIQGGTHLKMRS-LSVGLTHEG-------FDGYAIGGLAVGESVDEMLET
TGT_CAMJE       -IGIGQNIFGIIQGGTDYEERKRCALSLNEMP-------FDGLAIGGLSVGEENALMYET
TGT_BORBU       ---YNGLLFLITQGNFFKDLRKRSINDILELD-------SPGIAIGGISVGEPREKYLEI
TGT_MOUSE       ----KQNLFAIIQGGLNADLRTTCLKEMTKRD-------VPGFAIGGLSGGESKAQFWKM
TGT_RAT         ----KQNLFAIIQGGLNADLRTTCLKEMTKRD-------VPGFAIGGLSGGESKEQFWKM
TGT_HUMAN       ----KQNLFAIIQGGLDADLRATCLEEMTKRD-------VPGFAIGGLSGGESKSQFWRM
TGT_XENLA       ----RQNLFAIIQGGLDAELRKQCLQEMTKRD-------VPGFAIGGLSGGEEKDHFWRM
TGT_XENTR       ----RQNLFAIIQGGLDAELRRKCLQEMTKRD-------VPGFAIGGLSGGEEKDHFWRM
TGT_DANRE       ----RQNLFAIIQGGLDAELRKACLKEMTKRD-------VPGFAIGGLGGGEEKDDFWKM
TGT_DROME       ----DQSLFPIVQGGLDVPLRQRCVSALMERQ-------VRGFAVGGLSGGESKHDFWRM
TGT_SCHPO       ----TQNLFCIIQGGLDKRLREICCREMVKRN-------TPGIAVGGLSGGEEKHAFCET
TGT_CAEEL       ----DQAMFPILQGGLNLELRKECAKEMAKRA-------KVGIAIGGLSGGEEKDHFWRV
TGT_CAEBR       ----DQAMFPILQGGLNLDLRKECAEEMAKRA-------KVGIAIGGLSGGEEKDHFWRV
TGT_NOSS1       ----DQALFGIVQGGVYLDLRAKAANTLTELD-------LPGYAIGGVSVGEPPEMMAQI
TGT_SYNY3       ----DQALFGIVQGGTYLDLRSQAAEQLIALD-------LPGYAIGGVSVGEAPALIDKV
TGT_DEIRA       ----DQALFAIVQGGVHEDLRLKSLEATLPFA-------TPGFAVGGLAVGESKEEMYPA
TGT_LISIN       ----DQGLFGIVQGGAYEDLRAQSAKDLVSLD-------FPGYSIGGLSVGEPKDVMNRV
TGT_LISMO       ----DQGLFGIVQGGAYEDLRAQSAKDLVSLD-------FPGYSIGGLSVGEPKDVMNRV
TGT_BACSU       ----EQGLFGIVQGGEYEDLRTQSAKDLISLD-------FPGYAIGGLSVGEPKDVMNRV
TGT_ALKHC       ----DQALFGIIQGGEYEDLRRQSAQDITSLD-------FPGYAIGGVSVGEPKDVMNRV
TGT_STAAM       ----DQALFGIIQGGEYEDLREQSAKDLVELD-------FPGYAIGGLSVGEPKPVMYKM
TGT_STRPN       ----DQGLFGIVQGAGFEDLRRQSAHDLVSMD-------FSGYSIGGLAVGETHEEMNAV
TGT_STRP1       ----DQGLFGIVQGAGFEDLRRQSAADLVAMD-------FPGYSIGGLAVGESHEEMNAV
TGT_LACLA       ----DQGLFGIVQGAGFEDLRRQSARDLTSMD-------FAGYSIGGLAVGESHKEMNAV
TGT_CLOAB       TINKKQMLFGINQGGVYDDIRIEHAKTIAKMD-------LDGYAIGGLAVGETHEEMYRI
TGT_CLOPE       TVNKEQMLFGINQGGVYEDIRIEHAKTIREMD-------LDGYAIGGLAVGETHEEMYRV
TGT_BRUME       ---PGKAMFGIVQGGDIARLRERSAEALKAMD-------LKGYSVGGLAVGEPQEVMLDM
TGT_RHILO       ---PGKAMFGIVQGGDNAALRVRSAQALSAMG-------LKGYAVGGLAVGEPQAVMLEM
TGT_RHIME       ---PGKAMFGIVQGGDIPRLRERSALALRDLD-------LKGYAVGGLAVGEPQEVMLGM
TGT_CAUVC       ---DTQVLFGIQQGSTFENLRRESSERLREIG-------FDGYAIGGLAVGEGHQAMCEV
TGT_ZYMMO       ---ENAALFGIQQGSVFENLRQQSADALAEIG-------FDGYAVGGLAVGEGQDEMFRV
TGT_RICCN       ---EGYAQFGIIQGSVYEELREQSAKDLVELD-------FEGYAIGGLAVGEGQELMFKV
TGT_RICPR       ---EGYAQFGIIQGSVYKELREQSVKDLVKCD-------FEGYAIGGLAVGEGQELMFRV
TGT_ECOLI       ---NKNALFGIIQGSVYEDLRDISVKGLVDIG-------FDGYAVGGLAVGEPKADMHRI
TGT_SHIFL       ---NKNALFGIIQGSIYEDLRDISVKGLVDIG-------FDGYAVGGLAVGEPKADMHRI
TGT_SALTI       ---NKNALFGIIQGSVYEDLRDISVKGLVEIG-------FDGYAVGGLAVGEPKADMHRI
TGT_SALTY       ---NKNALFGIIQGSVYEDLRDISVKGLVEIG-------FDGYAVGGLAVGEPKADMHRI
TGT_YERPE       ---NKNALFGIIQGGVYEDLRDVSVKGLVDIG-------FDGYAVGGLAVGEPKEDMHRI
TGT_HAEIN       ---NKNALFGIIQGGVFEELRKVSLEGLVNIG-------FDGYAVGGLAVGEPKEDMHRI
TGT_PASMU       ---NKNALFGIIQGGVYEELRKVSVEGLVNIG-------FDGYAVGGLAVGEPKEDMHRI
TGT_VIBCH       ---NPNNLFGIVQGGVYEDLRDVSVKGLTEIG-------FDGYAVGGLAVGEPKEDMHRV
TGT_PSEAE       ---SPSALFGIVQGGMHEDLRLRSLDGLQEIG-------FDGLAIGGLSVGEPKEEMIRV
TGT_XYLFA       ---NDAALFGIIQGGVHPDLRGRSLDGLQAIG-------FDGYGIGGLAVGESESERNVI
TGT_NEIMA       ---NPNALFGIVQGAMYEDLREESLKGLEELD-------FPGLAIGGLSVGEPKPEMYRM
TGT_NEIMB       ---NPNALFGIVQGAMYEDLREESLRGLEQFD-------FPGLAVGGLSVGEPKPEMYRM
TGT_RALSO       ---NPNALFGIVQGGMFEPLRDESLAGLQAIDADAGGQGFGGYAIGGLSVGEPKEDMIRV
TGT_BUCAI       ---NKNSLFGIIHGGIYPSLRDISLQELIKID-------FDGYALGGLAVGEPKIEMYKL
TGT_AQUAE       -----QVLFGIVQGAFWKDLRKKAVEETLKFDE----FLF-GYSIGGLSVGEPKEIMYGM
TGT_THEMA       -----QALFGIVQGGIYPDLRR---ESALQLTS----IGFDGYAIGGLSIGEERSLTLEM
TGT_ARCFU       ------ALFGVVQGGEYRDLREKSARFMAERD-------FAGYGIGG-SLGKSKQDMLNI
TGT_CHLMU       ---GYQSMYGVIHGGTFPDQRKLGCQFVEDLP-------FDGSAIGG-SLGKNLRDIVGV
TGT_CHLTR       ---GIQSMYGVIHGGTFPDQRKLGCKFVEDLP-------FDGSAIGG-SLGKNLQDIVEV
TGT_CHLPN       ---RHQSMYGVIHGGLDPEQRRIGVRFVEDEP-------FDGSAIGG-SLGRNLQEMSEV
                        : : :*      *                    * .:** . *.        

TGT_HELPJ       IAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLFTHSG-----
TGT_CAMJE       VQNLNPYLDENRPRYLMGVGTPEDLVENVERGVDMFDCVMPTRNARNGTFFTSFG-----
TGT_BORBU       LEYSFLLIPKEKPRYVMGIGTPHYILNAIYYGIDIFDCFNPARITRHGSLLTDNG-----
TGT_MOUSE       VALSTSMLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVYPTRTARFGSALVPTG-----
TGT_RAT         VALSTSMLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVYPTRTARFGSALVPTG-----
TGT_HUMAN       VALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTG-----
TGT_XENLA       VTLSTDHLPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWG-----
TGT_XENTR       VTLSTDHLPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWG-----
TGT_DANRE       VTLSTDHLPREKPRYLMGVGYAVDLVVCVALGCDMFDCVFPTRTARFGSALVPWG-----
TGT_DROME       VDVCTGYLPKDKPRYLMGVGFAADLVVCVALGIDMFDCVFPTRTARFGCALVDSG-----
TGT_SCHPO       VYTCTSILPDNKPRYLMGVGYAEDLVVCVALGMDMFDCVYPTRTARFGNALTRKG-----
TGT_CAEEL       VAACCAALPPHLPRYVMGVGFPVDLVICSFLGADMFDCVYPTRTARFGTAMVRRGG----
TGT_CAEBR       VAACCAALPPHLPRYVMGVGFPVDLVICSFLGADMFDCVYPTRTARFGTAMVRRGG----
TGT_NOSS1       VQATAPLLPAHKPRYLMGVGTYREMVIAIASGIDLFDCVIPTRWARHGTAMVKGE-----
TGT_SYNY3       VQHTAPLLPAHKPRYLMGVGTYREMARAIFAGIDLFDCVIPTRFGRHGTALVQGE-----
TGT_DEIRA       VAFTAGRLPENKPRYLMGVGHPEDLVAGVALGIDMFDCVYPTRTGRFGYALTDDG-----
TGT_LISIN       LEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSG-----
TGT_LISMO       LEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSG-----
TGT_BACSU       LEFTTPLLPKDKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTVFTAEG-----
TGT_ALKHC       LEFTTPLLPANKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSNG-----
TGT_STAAM       VEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQG-----
TGT_STRPN       LDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQG-----
TGT_STRP1       LDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEG-----
TGT_LACLA       LDFTTPMLPEDKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTLMTHFG-----
TGT_CLOAB       IDAVVPHLPQDKPIYLMGVGTPSNILEAVSRGVDFFDCVLPARNGRHGHVFTKHG-----
TGT_CLOPE       IDAVVPHLPEDKPIYLMGVGLPSNILEAVERGVDFFDCVLPARNGRHGHVFTKEG-----
TGT_BRUME       LEVVCPILPTEKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAFTRFG-----
TGT_RHILO       LDITCPELPADKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAYTRRG-----
TGT_RHIME       LDVTCPVLPADKPRYLMGVGTPDDILKSVAHGIDMFDCVMPTRSGRHGLAFTRYG-----
TGT_CAUVC       LDYAPGFLPEDRPRYLMGVGKPIDLVEAVARGVDMFDCVLPTRSGRHGQAWTWDG-----
TGT_ZYMMO       LDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDG-----
TGT_RICCN       LDYAPEFLPQNKPRYLMGVGKPVDIIGAVSRGIDMFDCVIPTRSGRNGQAFTKYG-----
TGT_RICPR       LDYVPDFLPQNKPRYLMGVGKPSDIIGAVSRGIDMFDCVIPTRSGRNGQAFTKYG-----
TGT_ECOLI       LEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDG-----
TGT_SHIFL       LEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDG-----
TGT_SALTI       LEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDG-----
TGT_SALTY       LEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDG-----
TGT_YERPE       LEHVCPQIPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDG-----
TGT_HAEIN       LEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDG-----
TGT_PASMU       LEYVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSDG-----
TGT_VIBCH       LEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGG-----
TGT_PSEAE       LDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSG-----
TGT_XYLFA       LEYLHPRVPADRPRYLMGVGRPEDLVESVARGVDMFDCVMPTRHARNGQYFTGFG-----
TGT_NEIMA       LRAVGPILPEHKPHYLMGVGTPEDLVYGVAHGVDMFDCVMPTRNARNGWLFTRFG-----
TGT_NEIMB       LRAVGPILPEHKPHYLMGVGTPEDLVYGVAHGIDMFDCVMPTRNARNGWLFTRFG-----
TGT_RALSO       LQHVAPRLPANKPHYLMGVGTPEDLVAGVAAGIDMFDCVMPTRNARNGWLFTRFG-----
TGT_BUCAI       LDHICPQIPKNKPRYLMGVGKPEDLIEGVRRGVDMFDCVIPTRNARNGHLFVTNG-----
TGT_AQUAE       TEVVCELLPEKKPRYLMGVGKPEDILEAVERGVDMFDCVVPTRNARTGTLYTSQG-----
TGT_THEMA       TEVTVEFLPEDKPRYFMGGGSPELILELVDRGVDMFDSVFPTRIARHGTALTWNG-----
TGT_ARCFU       LDWVIPLLPEEKPRHLLGIGAIEDLFNCTEKGVDMYDCVAPARWARRGHLYVSPAEGGNV
TGT_CHLMU       VDVTTANLSIERPRHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGMILTSQG-----
TGT_CHLTR       VGVTAANLSAERPRHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGMILTSQG-----
TGT_CHLPN       VKITTSFLSKERPVHLLGIGDLPSIYAMVGFGIDSFDSSYPTKAARHGLILSKAG-----
                       :  . * :.:* *    :      * * :*.  *::  * .            

TGT_HELPJ       ----KISIKNAPYKLDDTPIEENCACYAC-KRY-------SKAYLHHLFRAKELTYARLA
TGT_CAMJE       ----KFNIKKAEFINDHEVIDSTCSCYTC-RNF-------SRGYLNHLFKAKELTFFRLA
TGT_BORBU       ----IMCIGRKEYKDDTSKVEKNCICTLC-KRY-------SRGYLRHLIKSKELFGIVLA
TGT_MOUSE       ----NLQLKKKQYAKDFSPINPECPCPTC-QTH-------SRAFLHALLHSDNTTALHHL
TGT_RAT         ----NLQLKKQQYAKDFSPINPECPCATC-QTH-------SRAFLHTLLHSDNTAALHHL
TGT_HUMAN       ----NLQLRKKVFEKDFGPIDPECTCPTC-QKH-------SRAFLHALLHSDNTAALHHL
TGT_XENLA       ----SLQLKSKQFAKDFQPIDKNCDCPTC-QRY-------SRSYINALFKSD-TAAMHHI
TGT_XENTR       ----SLQLKNKQFAKDFQPIDKNCDCPTC-QRY-------SRAYINALFKSD-TAAMHHI
TGT_DANRE       ----SLQLKQKQYAKDFQPIDPDCQCPTC-RRH-------SRAYLHALFKSD-TAAMHHI
TGT_DROME       ----QLNLKQPKYKLDMEPIDKDCDCSTC-RRY-------TRSYLHHIATNE-SVSSSLL
TGT_SCHPO       ----VINLRNQKFRNDIGPLEEGCSCPCC-KTELEGGWGITRAYFNSLVSKE-TVGANLM
TGT_CAEEL       ----LMQLNQKRYKEDFLPIDKKCECNTC-KNY-------TRAYIHSIVGKE-TVGCHLV
TGT_CAEBR       ----LMQLNQKRYKEDFLPIDDKCKCNTC-KNY-------TRAYIHSIAGKE-TVACHLV
TGT_NOSS1       ----RWNLKNAKFREDFAPIDETCPCYAC-QNF-------SRAYISHLVRSQEILAYTLL
TGT_SYNY3       ----RWNLKNATFREDHRPLDETCPCYTC-QTF-------SRAYLNHLIRSREMLGYILL
TGT_DEIRA       ----RLNLNSSAPRTQLQPIDAECDCYAC-RHY-------TRAYLAHLLRAEEMLAPRML
TGT_LISIN       ----RLVIKNAKFTHDFRPIDENCDCYTC-KNY-------SRAYIRHLIRCEETFGIRLT
TGT_LISMO       ----RLVIKNAKFTHDFRPIDENCDCYTC-KNY-------SRAYIRHLIRCEETFGIRLT
TGT_BACSU       ----RLNMKNAKFERDFRPIDEECDCYTC-KNY-------TRAYIRHLIRCNETFGLRLT
TGT_ALKHC       ----RLVVRNAKYARDFRSLDENCDCHVC-QTY-------TRAYIRHLVKCDETFGFRLT
TGT_STAAM       ----RLVIKNAKFADDLRPLDENCDCYTC-QNY-------SRAYIRHLIKAEETFGIRLT
TGT_STRPN       ----RLVVKNAQFAEDFTPLDPECDCYTC-NNY-------TRAYLRHLLKADETFGIRLT
TGT_STRP1       ----RLVIKNAKFAEDFTPLDHDCDCYTC-QNY-------SRAYIRHLLKADETFGIRLT
TGT_LACLA       ----RVNIRNAKYEHDFTPLDPMCDCYTC-TNY-------TRAYLRHLIKADETFGLRLC
TGT_CLOAB       ----KINLRNEKFELDASPIDEGCQCPTC-KHY-------SRAYIRHLFKAKEMLAMRLC
TGT_CLOPE       ----KINLMNAKFELDARPIDEGCQCPAC-KNY-------TRAYIRHLFKAKEMLAMRLC
TGT_BRUME       ----KVNLRNARHAEDHRPLDPQSDCPAS-RDY-------SRAYLHHLVKSGEALGAMLL
TGT_RHILO       ----KVNLRNARHADDPRPLDEESDCPAA-RDY-------SRAYLHHLVRSQEALGAMLL
TGT_RHIME       ----RINLRNARHAEDTRPLDEQSSCPAT-RDY-------SRAYLHHLIRSNESLGGMLL
TGT_CAUVC       ----PINLKNAKYAEDETPLDPDSDCPAS-RDY-------SKAYLRHLFKAEEILGQVLL
TGT_ZYMMO       ----PINIRNARFSEDLTPLDSECHCAVC-QKW-------SRAYIHHLIRAGEILGAMLM
TGT_RICCN       ----TVNIRNSKYADDNKPLEHDCLCPAC-RNY-------SKAYLHHLVRIGEILGSMLM
TGT_RICPR       ----TVNIRNSKYADDKEPLEHDCKCPAC-TNY-------TKAYLHHLVRIREILGPMLM
TGT_ECOLI       ----VVKIRNAKYKSDTGPLDPECDCYTC-RNY-------SRAYLHHLDRCNEILGARLN
TGT_SHIFL       ----VVKIRNAKYKSDTGPLDPECDCYTC-RNY-------SRAYLHHLDRCNEILGARLN
TGT_SALTI       ----VVKIRNAKHKSDISPLDAECDCYTC-RNY-------SRAYLHHLDRCNEILGARLN
TGT_SALTY       ----VVKIRNAKHKSDTSPLDAECDCYTC-RNY-------SRAYLHHLDRCNEILGARLN
TGT_YERPE       ----VVKIRNAKHKDDTATLDEHCDCYTC-RHY-------SRAYLHHLDRCNEILGARLN
TGT_HAEIN       ----IVKIRNAKYRDDTSPLDPECDCYTC-KNY-------TKAYLYHLDKCGEILGARLN
TGT_PASMU       ----IVKIRNAKYREDTSPLDPECDCYTC-KHY-------TKAYLYHLDKCGEILGARLN
TGT_VIBCH       ----VIKIRNAAHKTDTTPLDPHCDCYTC-KNY-------SKSYLHHLDRCNEILGARLN
TGT_PSEAE       ----VIKIRNSVHKHDDSTLDPTCDCYTC-KHF-------SRAYLHHLDKCGEMLGSMLN
TGT_XYLFA       ----TVKIRNACYARDVDPIEPGCGCPACVGGY-------TRAYLRHLDRCNEMLASMLG
TGT_NEIMA       ----DLKIKNAKHKLDKRPIDESCTCYAC-QNF-------SRAYLHHLHRAGEILGAQLN
TGT_NEIMB       ----DLKIKNAKHKLDKRPIDESCTCYAC-QNF-------SRAYLHHLHRTGEILGAQLN
TGT_RALSO       ----DIKIKNAVHRNDPRPLDETCGCYTC-RNF-------SRAYLHHLQRVGEILGARLN
TGT_BUCAI       ----VIKIRNKKYKKDLSCLDNTCVCYTC-RYY-------SRSYLHHLDACNEILGARLN
TGT_AQUAE       ----VVDIRHSKWKEDFSPLDPECDCYTC-RNF-------SKAYLRHLFVAEEISAYVLN
TGT_THEMA       ----KLNLKASYNKRSLEPVDERCGCYTC-KNF-------TRSYIHHLFDRGEVLGQILL
TGT_ARCFU       RNKFRIHIKNAAFRIDNRPVDRTCDCLVC-QNY-------SRAYLRHLYKANELLYFRLA
TGT_CHLMU       ----SLKINNQRYASDLNPIEPGCACPACSQGI-------SRAYLRHLFKVHEPNAGIWA
TGT_CHLTR       ----PLKINNQRYSSDLNPIEPGCSCLACSQGI-------TRAYLRHLFKVHEPNAGIWA
TGT_CHLPN       ----PIKIGQQKYSQDSSTIDPSCSCLTCLSGI-------SRAYLRHLFKVREPNAAIWA
                       :       .   ::  . *              ::.::  :            

TGT_HELPJ       SLHNLHFYLELVKNARNAILEKRFLSFKKEFLEKYH-----------------------S
TGT_CAMJE       SLHNLHYYLELARKMREAILNNSFTQFKRNFYHLRG-----------------------K
TGT_BORBU       SEHNIHYMFRLISKIRAAILNDDFLNFRTSYLKKYE-----------------------E
TGT_MOUSE       TVHNIAYQLQLLSAVRSSILEQRFPDFVRNFMRTMYG-------------DHSLCPAWAV
TGT_RAT         TVHNIAYQLQLLSAARSSILEQRFPDFVRNFMRTMYG-------------DHSLCPAWAI
TGT_HUMAN       TVHNIAYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYG-------------DPTLCPTWAT
TGT_XENLA       TIHNIAYQLNLMRSVRESILQGRFPQFVQDFMKTMYG-------------NKDKYPQWAV
TGT_XENTR       TIHNIAYQLNLMRSVRDSILQGRFPQFVQDFMRTMYS-------------SRDKYPQWAV
TGT_DANRE       TIHNISYQLSLMRSVRQSIIDQRFPEFVKEFMKRMFP-------------SSSQYPSWAV
TGT_DROME       SIHNVAYQLRLMRSMREAIQRDEFPQFVADFMARHF--------------KAEPVPAWIR
TGT_SCHPO       TIHNVHFQLQLMRDMRESIIKDEFPSFVKNFFHEWNHG------------DKSNYPSWAV
TGT_CAEEL       SVHNIKHQLDLMRDVRQAIQSNSVEQFLKQFLYDYYGPIQSENPSKQDSEKMREVPQWVR
TGT_CAEBR       SIHNIKHQLDLMRDVRQAIQSNSVEKFLRQFLFDYYGPIQSENPSKQDTEKVQEVPQWVR
TGT_NOSS1       SIHNITELIRFTQKIREAILSDRFLEEFGHWLNSAET---------------DNR-----
TGT_SYNY3       SLHNITELIRFTQSIRQAILNDTFTQDFAHWLTPPE------------------------
TGT_DEIRA       SLHNLRYLHRLVERMRVAINGQQFHPWAADWSERYFH---------------GNVPGWFT
TGT_LISIN       TYHNLHFLLNLMKQVRSAIMEDRLADFREEFFEQYG-----------------------F
TGT_LISMO       TYHNLHFLLNLMKQVRGAIMEDRLADFREEFFEQYG-----------------------F
TGT_BACSU       TYHNLHFLLHLMEQVRQAIREDRLGDFREEFFERYG-----------------------Y
TGT_ALKHC       TYHNLYFLLKLMKDVRQAILDDRLLDFREEFFEQYG-----------------------F
TGT_STAAM       TIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYG-----------------------L
TGT_STRPN       SYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYG-----------------------Y
TGT_STRP1       SYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYG-----------------------Y
TGT_LACLA       SYHNLHFLVNLMKDVRGAIMDDNLLEFREDFCERYG-----------------------Y
TGT_CLOAB       VLHNLYFYNTLMEDIRNAIDADCFEEFKNEKLKAWA-----------------------G
TGT_CLOPE       VLHNLYFYNKLMEDIRDAIDGGYFAEFKAKKLEEWN-----------------------G
TGT_BRUME       TWNNLAYYQYLMKGIRAAIADGKFSDFTAETTEGWA-----------------------R
TGT_RHILO       TWNNLSYYQKLMQDIRAAIETQTFEARGAEITEGWA-----------------------R
TGT_RHIME       SWNNLAYYQELMAGIRKAIEEGRYTDFMAETMEGWQ-----------------------R
TGT_CAUVC       SWHNIAFFQALTAAMRAAIAEGRFEQFRRDFAARHL-----------------------G
TGT_ZYMMO       TEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF-----------------------A
TGT_RICCN       TWHNLTYFQNLMSRIRAYIKLGKDFDFDS-------------------------------
TGT_RICPR       TWHNLTYFQNLMSRIRTYIKLGKDFDFVH-------------------------------
TGT_ECOLI       TIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQG-----------------------R
TGT_SHIFL       TIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQG-----------------------R
TGT_SALTI       TIHNLRYYQRLMAGLRKAIEEGKLESFVTEFYQRQG-----------------------R
TGT_SALTY       TIHNLRYYQRLMAGLRKAIEEGKLESFVTEFYQRQG-----------------------R
TGT_YERPE       TIHNLRYYQRLMAGLRQAIEEGKLEHFVEDFYGRIG-----------------------K
TGT_HAEIN       TIHNLRYYQRLMAEIRQAIEDDRFDDFVVEFYARMG-----------------------K
TGT_PASMU       TIHNLRYYQRLMAQIRQAIEEDRFEAFVQEFYAKMG-----------------------K
TGT_VIBCH       TIHNLRYYQRLMESIRKAIDEDRFDQFVAEFYARRN-----------------------R
TGT_PSEAE       TIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRG-----------------------L
TGT_XYLFA       TLHNLWYYETLMANMRAAITAGTFFAFRRSFYLARG-----------------------L
TGT_NEIMA       TIHNLHFYQVIMAEMREAVEQGKFADWQAQFHENRA-----------------------R
TGT_NEIMB       TIHNLHFYQVIMAEMREAVEQGKFADWQARFHENRA-----------------------R
TGT_RALSO       TIHNLHYYLELMADMRTAIESHSFAVFRARFAADRA-----------------------R
TGT_BUCAI       TIHNLHYYQTLMSNIRNSIKNNTFEQFSVNFYKQKN-----------------------K
TGT_AQUAE       TIHNLRFYLKMMEEVRKAIEEKRFKELKEKYLQRVK-----------------------N
TGT_THEMA       TIHNINFMISLMKEVRRSIESGTFKELKSKVVEVYS-----------------------S
TGT_ARCFU       TYHNIYFVVKLMERIRESIADGSFYELKREWLGF--------------------------
TGT_CHLMU       SIHNMHYMQKIMSKIREKILNDQL------------------------------------
TGT_CHLTR       SIHNMHHMQKVMREIREGILNDRI------------------------------------
TGT_CHLPN       SIHNLHHMQQVMKEIREAILKDEI------------------------------------
                  :*:     .    *  :                                         

TGT_HELPJ       CSH----------------------------------------
TGT_CAMJE       -------------------------------------------
TGT_BORBU       ENFDE--------------------------------------
TGT_MOUSE       EALASVGIMLT--------------------------------
TGT_RAT         EALASVGITLT--------------------------------
TGT_HUMAN       DALASVGITLG--------------------------------
TGT_XENLA       AALETVGITLQ--------------------------------
TGT_XENTR       DALETVGITLQ--------------------------------
TGT_DANRE       EALQSVNICLS--------------------------------
TGT_DROME       EALSAVNIQLPADPERIDEQDQKPKTEKRRETEDVAEEQVASS
TGT_SCHPO       DALRMVNIDLLA-------------------------------
TGT_CAEEL       DAVDHMGYKLDF-------------------------------
TGT_CAEBR       DAVDHMGYTLDF-------------------------------
TGT_NOSS1       -------------------------------------------
TGT_SYNY3       -------------------------------------------
TGT_DEIRA       SAFERSTQSEI--------------------------------
TGT_LISIN       NRPDAKNF-----------------------------------
TGT_LISMO       NRPDAKNF-----------------------------------
TGT_BACSU       NKPNAKSF-----------------------------------
TGT_ALKHC       NQPNAKNF-----------------------------------
TGT_STAAM       NVENPKNF-----------------------------------
TGT_STRPN       NK-SGRNF-----------------------------------
TGT_STRP1       NK-SNRNF-----------------------------------
TGT_LACLA       NQPNAKDF-----------------------------------
TGT_CLOAB       KA-----------------------------------------
TGT_CLOPE       RA-----------------------------------------
TGT_BRUME       GDMPAL-------------------------------------
TGT_RHILO       GDIPVL-------------------------------------
TGT_RHIME       GDLPPV-------------------------------------
TGT_CAUVC       G------------------------------------------
TGT_ZYMMO       RNS----------------------------------------
TGT_RICCN       -------------------------------------------
TGT_RICPR       -------------------------------------------
TGT_ECOLI       EVPPLNVD-----------------------------------
TGT_SHIFL       EVPPLNVD-----------------------------------
TGT_SALTI       PVPPLNVD-----------------------------------
TGT_SALTY       PVPPLNVD-----------------------------------
TGT_YERPE       PVPPLNV------------------------------------
TGT_HAEIN       PVPPLQLADKS--------------------------------
TGT_PASMU       PVPPMQSEIKSDEG-----------------------------
TGT_VIBCH       EVPPLQKDKA---------------------------------
TGT_PSEAE       PTPPLDA------------------------------------
TGT_XYLFA       DLPPLPEVAGCAG------------------------------
TGT_NEIMA       GTD----------------------------------------
TGT_NEIMB       GTD----------------------------------------
TGT_RALSO       GAL----------------------------------------
TGT_BUCAI       IDF----------------------------------------
TGT_AQUAE       KL-----------------------------------------
TGT_THEMA       GGVNV--------------------------------------
TGT_ARCFU       -------------------------------------------
TGT_CHLMU       -------------------------------------------
TGT_CHLTR       -------------------------------------------
TGT_CHLPN       -------------------------------------------