CLUSTAL format seed alignment for MF_00170

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPIA_THEEB       -------MSD-DAVKQMKQVVAKAAADRVQS------GMVVGLGTGSTTAFVIQFLGDRL
RPIA_SYNY3       -------MAELDAANLMKQAVGKAAADRVKS------NTIVGLGTGSTTAYALEFIGDRL
RPIA_NOSS1       ------MTVTADPVTLMKQEVGKAAAALVKS------GSIVGLGTGSTTAYTIQYLGDRL
RPIA_PYRAB       -----------MNIEEMKKIAAKEALKFIED------DMVIGLGTGSTTAYFIRLLGDMI
RPIA_PYRHO       -----------MNVEEMKKIAAKEALKFIED------DMVIGLGTGSTTAYFIKLLGEKL
RPIA_PYRFU       -----------MNVEEMKKAVARAALEFIED------DMVVGLGTGSTTAYFIRYLGEMI
RPIA_METJA       -----------MSNEDLKLKVAKEAVKLVKD------GMVIGLGTGSTAALFIRELGNRI
RPIA_METTH       ----------MEVFMNLKKMAALRAVDEIDD------GDVVGLGTGSTTHYFIEELGRRV
RPIA_METAC       -----MTERNTSTDSPEKRAAGIAAAGLVSS------GMLVGLGTGSTVAYTIKELGRRV
RPIA_METMA       -----MTERNTSTDSPEKRAAGIAAAGLVSS------GMVVGLGTGSTVAYTIKELGRRV
RPIA_ARCFU       ------------MDSSGKYNAAKLALELVKD------GMVLGIGSGSTVEVFLNLLGDKI
RPIA_AGRFC       -----------MDARQMKIKAAEAALSHVQD------GMRLGIGTGSTAEEFVRLLAEKV
RPIA_RHIME       -----------MDARQMKIKAAEAALEHVES------GMRLGIGTGSTAEEFVRLLAEKV
RPIA_BRUME       ----------MDEARKLKIAAAAEALTYVKD------GMRLGIGTGSTAEEFVRLLAEKV
RPIA_BRUSU       ----------MDEARKLKIAAAAEALTYVKD------GMRLGIGTGSTAEEFVRLLAEKV
RPIA_RHILO       -----------MDARQLKVEAARAALAHVSD------GMRLGIGTGTTAEEFVRLLADKV
RPIA_CAUVC       -----------MSADDQKRISGEAAAELVEN------GMVVGLGTGSTAAWFVKALAARG
RPIA_CHLMU       MSKQVAHSFSSEDFSFIKQKLAREAVALVEP------GMRVGLGSGSTAREFILALGERV
RPIA_CHLTR       MSKQPENSFSSDKFFPIKQKLALEAVALVEP------GMCVGLGSGSTAREFILALGDRV
RPIA_CHLPN       --------MEKDLHLHEKKCLAHEAATQVTS------GMILGLGSGSTAKEFIFALAHRI
RPIA1_OCEIH      ----------MNEQDKLKKAVGEKAATMVKD------GMKVGLGSGSTVYWMIRSLGERI
RPIA_STRA3       -------------MDELKKLAGVTAAKYVKN------GMIVGLGTGSTAYFFVEEIGRRV
RPIA_STRA5       -------------MDELKKLAGVTAAKYVKN------GMIVGLGTGSTAYFFVEEIGRRV
RPIA_STRMU       -------------MEELKKIAGVRAAQYVED------GMIVGLGTGSTAYYFVEEVGRRV
RPIA_STRPN       -------------MENLKKMAGITAAEFIKD------GMVVGLGTGSTAYYFVEEIGRRI
RPIA_STRR6       -------------MENLKKMAGIKAAEFVSD------GMVVGLGTGSTAYYFVEEIGRRI
RPIA_LACLA       -------------MDNLKKQVGIKAAEFVKS------GMVVGLGTGSTAAYFVEELGRRI
RPIA_BIFLO       --------MDKAQQDALKKAAGIEAAKLVEN------GMIAGLGTGSTVKFLVDELGRRH
RPIA_THEAC       ----------MADYEKQKMNAAIKAAEYVRS------GMIVGLGTGTTSYYLINEIGRRV
RPIA_BUCAI       -----------MNLNKLKKKAAWAALDYIDP------GTIIGVGTGTTIFYFIEALGTIK
RPIA_BUCAP       -----------MNLNELKKKAAWAALDYIYP------GTVIGVGTGSTVFYFIQALSTVK
RPIA_WIGBR       -----------MIEEKLKKQAAWAAIKYIKP------GDIVGVGSGSTAEYFIDALGSIK
RPIA_HAEIN       -----------MNQLEMKKLAAQAALQYVKA------DTIVGVGSGSTVNCFIEALGTIK
RPIA_PASMU       -----------MDQLEMKKMAAAAALQYVKP------DSIIGVGSGSTVNCFIEALGSMR
RPIA_ECOLI       -----------MTQDELKKAVGWAALQYVQP------GTIVGVGTGSTAAHFIDALGTMK
RPIA_SALTY       -----------MTQDELKKAVGWAALQYVQP------GTIVGVGTGSTAAHFIDALGTMK
RPIA_ENTCL       -----------MTQDELKKAVGWAALQYVQP------GTIVGVGTGSTAAHFIDALGTMK
RPIA1_YERPE      -----------MTQDELKKAVGWAALDYVKP------GTIVGVGTGSTAAHFIDALGSIK
RPIA_EDWI9       -----------MTQDELKKAVGWAALKYVRP------GTIVGVGTGSTASHFIDALATMK
RPIA_VIBCH       -----------MTQDEMKKAAGWAALKYVEK------GSIVGVGTGSTVNHFIDALGTIK
RPIA_VIBVU       -----------MTQDEMKKAAGWAALKYVEK------GSIVGVGTGSTVNHFIDALGTMS
RPIA_SHEON       -----------MTQDEMKKAAGWAALKYVEK------DSIVGVGTGSTVNHFIDALATMK
RPIA_PSEAE       -----------MNQDQLKQAVAQAAVDHILPH--LDSKSIVGVGTGSTANFFIDALARHK
RPIA_RALSO       -----------MTQDELKALVAQAAADYVLAN--VPEGAVLGVGTGSTANLFIDAMAPHK
RPIA_XANAC       -------------MSEAKRLAAEKAIDYVED------GMIVGVGTGSTVAYFIDALGRIG
RPIA_XANCP       -------------MSEAKRLAAEKAIDYVED------GMIVGVGTGSTVAYFIDALGRIG
RPIA_XYLFA       -------------MSEAKRRAAEKAIEYVEN------DMIIGVGTGSTVAYFIDALGRTP
RPIA_NEIMA       ----------MTTQDELKRIAAEKAVEFVPE------NEYIGIGTGSTINFFIEALGKSG
RPIA_NEIMB       ----------MTTQDELKRIAAEKAVEFVPE------NEYIGIGTGSTINFFIEALGKSG
RPIA_BORBU       -------------MENQKILVAKHAIDHYIK-----SNMNLGIGTGTTIYYAIKYLSEKI
RPIA_TREPA       MHERNTTTNTPLDVTAQKLLVAQRSVDTLVQEGVLHAHMSIGLGTGSTAMPAVKRIADHL
RPIA_AERPE       -----------MGGCDPMDEAARGALDLLGRIG--GELGVLGVGTGRTVMRFLREASARG
                                      .  :                *:*:* *    :   .   

RPIA_THEEB       RKGELSNIVGVPTSFQASVLAKKYGIPLVTLDDV---EKLDIAIDGADEVD-PAKNLIKG
RPIA_SYNY3       KKGELENVVGIPTSFQAEVLARKYGIPLTTLDVA---DRIDIAIDGADEVD-PQKNLIKG
RPIA_NOSS1       KSGELTDIVGIPTSFQSEVLSKQYGVPLTTLDAV---DHIDIAIDGADEVD-PHKNLIKG
RPIA_PYRAB       KKGEVSDIVGVPTSYQSRLLAIESGIPVATLDQV---DAIDVAVDGADEVD-PNLNLIKG
RPIA_PYRHO       KRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQV---DAIDVAVDGADEVD-PNLNLIKG
RPIA_PYRFU       EKGKVEDIYGVPPPIKQKFLRMESGVPVLSLDQV---DAIDIAVDGADEVD-PNLNLIKG
RPIA_METJA       REEELT-VFGIPTSFEAKMLAMQYEIPLVTLDEY---D-VDIAFDGADEVEETTLFLIKG
RPIA_METTH       REEGLE-VMGVPTSYQSMFLAAESGIKVTSLAEH---D-VDVAVDGADEVD-PDLNLIKG
RPIA_METAC       REEGLD-ILGVVTSYQSEMLAIEAGIRLTTLAQH---PELDLAIDGADQID-SELRAIKG
RPIA_METMA       KEEGLD-ILGVVTSYQSEMLAIDAGIRLTTLSQD---PELDIAIDGADQID-SNLYTIKG
RPIA_ARCFU       REEGLE-IYGIPSSYQSYFAAIRNGVEIVDLVEF----EPDLCIDGADQVD-AKLNCIKG
RPIA_AGRFC       AA-GLK-VEGVPTSERTARLCVELGVPLKSLDEL---PELDLTIDGADEVD-HVLRLVKG
RPIA_RHIME       AS-GFQ-ISGVPTSERTARLCLELGVPLKSLDEL---PELDLTIDGADEVD-GKLRLIKG
RPIA_BRUME       KG-GFR-VIGVPTSERTAKLCEELGVALTTLEET---PHLDLTIDGADEVD-GELSLIKG
RPIA_BRUSU       KG-GFR-VIGVPTSERTAKLCEELGVALTTLEET---PHLDLTIDGADEVD-GELSLIKG
RPIA_RHILO       AT-GMT-VIGVPTSERTAALCRELGVPLSTLEET---PELDLTVDGADEVD-PELTLIKG
RPIA_CAUVC       LK-DIR---GVPTSDATAALARELGIPLAALDDV---KTVDLTVDGADEIG-PGLSLIKG
RPIA_CHLMU       RNERLA-ITAVASSRISHLLAQALGIPFLDPALS---QELDLVVDGADEVD-ANLRMIKG
RPIA_CHLTR       RTERLV-ITAVASSRISQLLAEAVGIPLSDHSLL---QDVDLVVDGADEVD-PCLRMIKG
RPIA_CHLPN       QTESLA-VHAIASSQNSYALAKQLAIPLLNPEKF---SSLDLTVDGADEVD-PQLRMIKG
RPIA1_OCEIH      QQDGLK-IEGIPSSNQTATWAEEAGIPLTDFSNV---KELDITIDGADEVD-ANNHLIKG
RPIA_STRA3       KEEGLQ-VVGVTTSNRTTEQARGLGIPLKSADDI---DVIDVTVDGADEVD-PDFNGIKG
RPIA_STRA5       KEEGLQ-VVGVTTSNRTTEQARGLGIPLKSADDI---DVIDVTVDGADEVD-PDFNGIKG
RPIA_STRMU       QEEGLQ-VIGVTTSSRTTAQAQALGIPLKSIDEV---DSVDVTVDGADEVD-PNFNGIKG
RPIA_STRPN       KEEGLQ-ITAVTTSSVTSKQAEGLNIPLKSIDQV---DFVDVTVDGADEVD-SQFNGIKG
RPIA_STRR6       KEEGLQ-ITAVTTSSVTTKQAEGLNIPLKSIDQV---DFVDVTVDGADEVD-SQFNGIKG
RPIA_LACLA       AEEQLE-ITGVTTSNVTSSQARALGIPLASIDEV---DYVDLTVDGADEID-SSLNGIKG
RPIA_BIFLO       QEEGLE-FTGVTTSRRTQAQAESYGIKIVDIDDV---DHIDVTIDGADEVD-KNFNGIKG
RPIA_THEAC       REEGLK-IRAVCTSRRTEDLAKQNGIEVIQ-GTK---DQIDLTIDGADQVG-MYGTLIKG
RPIA_BUCAI       NL----IYGAVSSSNSSTVLLKKHGIEVFDLKNF---SSLAIYVDSADEIN-NHMQMIKG
RPIA_BUCAP       HL----ISGAVSSSNSSTVLLKKNGIRVLDLNTF---DFLEIYVDSADEIN-NDMQMIKG
RPIA_WIGBR       NL----IKGTVSSSRISSSKLKDLNIPLFDLNEV---SLLNIYVDGADEIN-QKKHMIKG
RPIA_HAEIN       DK----IQGAVAASKESEELLRKQGIEVFNANDV---SSLDIYVDGADEIN-PQKMMIKG
RPIA_PASMU       DQ----IKGAVAASKASEALLAKQGIEVFSANEV---SSLDIYVDGADEIN-PQKMMIKG
RPIA_ECOLI       GQ----IEGAVSSSDASTEKLKSLGIHVFDLNEV---DSLGIYVDGADEIN-GHMQMIKG
RPIA_SALTY       GQ----IEGAVSSSDASTEKLKGLGIHVFDLNEV---DSLGIYVDGADEIN-GHMQMIKG
RPIA_ENTCL       GQ----IEGAVSSSDASTEKLKSLGITVFDLNEV---DRLGIYVDGADEIN-GHMQMIKG
RPIA1_YERPE      HQ----IEGAVSSSDASTAKLKSYGIPVFDCNDV---DVLDIYVDGADEIN-GQMQMIKG
RPIA_EDWI9       GQ----IEGAVSSSDASTARLKSLGIPVFDLNEV---DSLDIYVDGADEIN-GAMQMIKG
RPIA_VIBCH       DE----IKGAVSSSIASTAKLEALGIRVYDCNDV---SELDIYVDGADEIN-PERDMIKG
RPIA_VIBVU       EE----IKGAVSSSVASTEKLEALGIKIFDCNEV---ASLDIYVDGADEIN-ADREMIKG
RPIA_SHEON       AD----IEGAVSSSEASTQKMKALGIPVYDLNSV---DKLSVYVDGADEIN-GHMDMIKG
RPIA_PSEAE       AE----FDGAVASSEATAKRLKEHGIPVYELNTV---SELEFYVDGADESN-ERLELIKG
RPIA_RALSO       AR----FAGAVSSSEASTRRLQGHGFAVLDLNEV---DTIPVYVDGADEID-DTGAMIKG
RPIA_XANAC       HR----IKGAVSSSEQSTARLRQHGIEVLDLNHT---GNLSLYVDGADECD-PNRCLIKG
RPIA_XANCP       HR----IKGAVSSSEQSTARLRQHGIEVLDLNHT---GTLSLYVDGADECD-PNRCLIKG
RPIA_XYLFA       KR----IKGAVSSSEQSTAHLKQHGIEVLELNHT---GTLPLYVDGADECD-PYKRLIKG
RPIA_NEIMA       KK----IKGAVSTSKKSSELLAQYDIPVVSLNEV---SGLAVYIDGADEVN-HALQMIKG
RPIA_NEIMB       KK----IKGAVSTSKKSGELLAQYDIPVVSLNEV---SGLAVYIDGADEVN-HALQMIKG
RPIA_BORBU       KSGSLKNLKFYTTSSDTKYLLSKEQIPYESNFSK-LNKNLDIAIDGADEILLEKKSLIKG
RPIA_TREPA       ARGTLSDIAAVPTSFQTALICERYNIPLFSLSSKRIGGKLDVTIDGADEIDTQN-FVIKG
RPIA_AERPE       VEPG----VAVPSSFETAVELAGLGWSVGDPRVY---RGVNVYVDGADEAEPGRGYMVKG
                             ..                           . .*.**:        :**

RPIA_THEEB       GGAAHTREKIVDSLAEQFLVVVDSSKLVQKLGSTFPVPVEVLPFAVAPVTRALKALG-GE
RPIA_SYNY3       GGAAHTREKIVDALAETFLVVVDSGKLVDKLGSTFLLPVEVIPMALTPVMRALAKLG-GK
RPIA_NOSS1       GGAAHTREKVVDYLANQFIVVVDSGKLVDRLGSVFAVPVEVIPMAITPVTNAIKQLG-GK
RPIA_PYRAB       RGAALTMEKIIESRAGMFIVLVDERKLVDYLCQKMPVPIEVIPQAWRAIVEELSIFN-AE
RPIA_PYRHO       RGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFN-AK
RPIA_PYRFU       RGAALTMEKIIEYRAGTFIVLVDESKLVDYLCQKMPVPIEVIPAAWKAILEELSIFN-AK
RPIA_METJA       GGGCHTQEKIVDYNANEFVVLVDESKLVKKLGEKFPIPVEVIPSAYRVVIRALSEMG-GE
RPIA_METTH       GGAAHTLEKIVDSSAASFIVIVDESKLVERLGA-FPLPVEVIPAACRPVKLKLESMG-AS
RPIA_METAC       GGAAHTREKIVSVSARRFVVVADESKTSKQLDK--LVPVEVLPFAKEPVVKKIRELG-GK
RPIA_METMA       GGAAHTREKIVSVSAKRFVVVADDSKTSTQLDK--PVPVEVLPFAKEPAVNRIRKLG-GE
RPIA_ARCFU       GGGAMTREKIVAKASRKVVIIVDESKLVEKLSM--PVPVEVLPFAYGWVLREIEKMG-CK
RPIA_AGRFC       GGGALLREKIVAAASGRMIVIADQSKV-VETLGAFPLPIEINPFGQVATRIAIEKLA-AR
RPIA_RHIME       GGGALLREKIVASASTRMIVIADESKV-VDVLGAFKLPIEINPFGQVATRLAIEKTA-SR
RPIA_BRUME       GGGALLREKIVAAASDSMIVIADQSKV-VETLGRFPLPIEVNRFGLGATIRAIEAAA-VK
RPIA_BRUSU       GGGALLREKIVAAASDSMIVIADQSKV-VETLGRFPLPIEVNRFGLGATIRAIEAAA-VK
RPIA_RHILO       GGGALLREKIVAAASQRMIVIADRSKM-VETLGRFPLPIEVNQFGLRATEIAIAKTA-AD
RPIA_CAUVC       GGAALLREKLVWEASTRCVVIADAAKR-VPALGKFPLPIEVVRFGHVHTGYRLADIA-AE
RPIA_CHLMU       GGGALFREKILLQSGKRNIILVDERKL-VSVLGTFPLPIEISPFGCSSVEKVLNQQG-YI
RPIA_CHLTR       GGGALFREKILLQSGKRNVILVDERKL-VPTLGKFSLPIEIAPFGCSSVQRILNKQG-YF
RPIA_CHLPN       GGGAIFREKILLRAAKRSIILVDESKL-VPVLGKFRVPLEISRFGRSAIIEEIRHLG-YE
RPIA1_OCEIH      GGAALFREKIIAQAAKEFVIIVDQSKV-VETLGEFSLPVEVLPFSWQRTANEISKLG-CV
RPIA_STRA3       GGGALLMEKIVATPTKEYIWVVDESKL-VETLGAFKLPVEVVRYGSERLFRVFKSKG-YC
RPIA_STRA5       GGGALLMEKIVATPTKEYIWVVDESKL-VETLGAFKLPVEVVRYGSERLFRVFKSKG-YC
RPIA_STRMU       GGGALLMEKIVGTLTKDYIWVVDESKM-VDTLGAFRLPVEVVQYGAERLFREFEKKG-YK
RPIA_STRPN       GGGALLMEKVVATPSKEYIWVVDESKL-VEKLGAFKLPVEVVQYGAEQVFRHFERAG-YK
RPIA_STRR6       GGGALLMEKVVATPSKEYIWVVDESKL-VEKLGAFKLPVEVVQYGAEQVFRHFERAG-YK
RPIA_LACLA       GGAALLMEKIVATYSKDYIWIVDESKL-SENLGSFKIPVEVIPYGSQQVFKKFEAAG-YA
RPIA_BIFLO       GGAALLWEKIVATNSNQIVWIVDESKV-VDTIGKFPLPVEVIPFGAGQVIKKFEARG-YK
RPIA_THEAC       GGGALLREKIVAYNSKEMYVIVDSRKIEAAHFGSFPLPVEIVPFMHMRTLENLRGIC-TQ
RPIA_BUCAI       GGGALTREKIIASMSKKFVCIIDKSKKVDVLG-TFPLPIEIIPMALSYIFREMIKIG-GT
RPIA_BUCAP       GGAALTKEKIIAAMSKKFVCIIDESKKVNILG-TFPLPIEIIPIAFSYISKEILKIG-GQ
RPIA_WIGBR       KGAALTREKIIASAAKKFICIVDSSKFVHVLG-RAPLPIEVIPMARTLVSKKIIDIG-GS
RPIA_HAEIN       GGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALG-GS
RPIA_PASMU       GGAALTREKIVAALAKKFICIVDTSKQVDVLGSTFALPVEVIPMARSQVARKLVALG-GS
RPIA_ECOLI       GGAALTREKIIASVAEKFICIADASKQVDILG-KFPLPVEVIPMARSAVARQLVKLG-GR
RPIA_SALTY       GGAALTREKIIASVAEKFICIADASKQVDILG-KFPLPVEVIPMARSAVARQLVKLG-GR
RPIA_ENTCL       GGAALTREKIIASVADKFICIADASKQVDILG-NFPLPVEVIPMARSAVARQLVKLG-GR
RPIA1_YERPE      GGAALTREKIIAAIARKFICIADESKQVGVLG-KFPLPVEVIPMARSYVARELIKLG-GL
RPIA_EDWI9       GGAALTREKIVAAVAKKFVCIVDASKQVDILG-SFPLPVEVIPMARAYVARELVKLG-GQ
RPIA_VIBCH       GGAALTREKIVAAIAKKFVCIVDGTKAVDVLG-NFPLPVEVIPMARSYVARELVKLG-GD
RPIA_VIBVU       GGAALTREKIVAAIADKFICIVDGTKAVDVLG-TFPLPVEVIPMARSYVARQLVKLG-GD
RPIA_SHEON       GGAALTREKIVAAVAEKFVCIVDNTKQVDILG-EFPLPVEVIPMARSYVARQLVKLG-GD
RPIA_PSEAE       GGAALTREKIVAAVAKTFICIADASKLVPILG-QFPLPVEVIPMARSHVARQLVKLG-GD
RPIA_RALSO       GGGALTREKIVASVAGRFVCIADGSKLVDVLG-AFPLPVEVVPMARAAVARQLAALG-GQ
RPIA_XANAC       GGAALTREKIIAEASERFICIVDPSKQVPVLG-KFPLPVEVIPMARSLVARQILALTGGQ
RPIA_XANCP       GGAALTREKIIAEASERFICIVDPSKQVPVLG-NFPLPVEVIPMARSLVARQILALTGGQ
RPIA_XYLFA       GGASLTREKIIAEASKQFICIIDPNKQVATLG-KLPLPIEVIPMARSLVARQIMARTDGQ
RPIA_NEIMA       GGGAHLNEKIVASASEKFVCIADESKYVSRLG-KFPLPVEVVESARSLVSRKLLAMG-GQ
RPIA_NEIMB       GGGAHLNEKIVASASEKFICIADESKYVSRLG-KFPLPVEVVESARSLVSRKLLAMG-GQ
RPIA_BORBU       MGGAHLMEKVIAYNSETLLIIADETKIVKKLGTKMPIPIEVAQNAVGFIMTRLEEMNLEA
RPIA_TREPA       GGAALLQEKIAAYNSAHFVIIVDETKVVETLGTRAALPIEVVPEARMSVMRTLQDWGLSV
RPIA_AERPE       GGGALLGEKILSSRSKLNIFIVGEDRLVGRLGEKTPVPVEVEPGFVSMVLASLEELGLNP
                  *..   **:          : .  :          :*:*:           :       

RPIA_THEEB       P---ELRMG----VKKDGPVVTDQGNFVLDVR-FDD-IPDP--AELEKAINNIPGVVENG
RPIA_SYNY3       P---ELRMG----VKKAGPVVTDQGNLVIDVK-FDA-ITNP--AELEKTINNLPGVLENG
RPIA_NOSS1       P---ELRMG----VKKAGPVITDQGNFVLDVR-FDS-IDDP--VNLEKILNNIPGVLENG
RPIA_PYRAB       A---KLRMG----VNKDGPVITDNGNFIIDAK-FPR-IDDP--LDMEIELNTIPGVVENG
RPIA_PYRHO       A---ELRMG----VNKDGPVITDNGNFIIDAK-FPR-IDDP--LDMEIELNTIPGVIENG
RPIA_PYRFU       A---ELRMG----VKKDGPVVTENGNFIIDAK-FPR-IDDP--LDMEIELNTIPGVVENG
RPIA_METJA       A---VIRLG----DRKRGPVITDNGNMIIDV--FMN-IDDA--IELEKEINNIPGVVENG
RPIA_METTH       V---NIRSS----EGKDGPVVTDNGNFVLDAA-FGV-IDDP--GAMESRLNNIPGVVENG
RPIA_METAC       P---QLRSA----VKKDGPVITDNGNFVLDVE-FGV-IKDP--EALALQLSSIPGVVEHG
RPIA_METMA       P---RLRSA----VKKDGPVITDNGNFVLDVE-FGV-IKDP--EALALQLSAVPGVVEHG
RPIA_ARCFU       A---RLREG----KGKIGPVITDNGNFVVDCD-FGV-IEEDRVEGLEGEIKLISGVVENG
RPIA_AGRFC       S---GLSGELTMRSSGDGAFMTDGGHLILDA-SFGR-IPDA--EALARELNTIPGVVEHG
RPIA_RHIME       L---GLAGEIVVRSSGDGVFMTDGGHLILDA-SFGR-IPDA--DALAVELNAIPGVVEHG
RPIA_BRUME       C---GLAGPLNLRLKDGSPFLTDGGHYIVDA-SFGR-IPDP--KTLSDALFAIPGVVEHG
RPIA_BRUSU       C---GLAGPLNLRLKDGSPFLTDGGHYIVDA-SFGR-IPDP--KTLSDALFAIPGVVEHG
RPIA_RHILO       L---GLSGPITLRMTGGQAFVTDGGHFILDA-SFGR-IPDT--RALSNALHAIPGVVEHG
RPIA_CAUVC       F---DLPPP-RLRTAERGMVVTDGGNLIYDM-ASGK-IEDP--TALAAALKSVTGVVDHG
RPIA_CHLMU       G---DWRKT-----SHGERFITDNGNYIYDVSSPDS-YPHP--EEDLIRLLQIRGIIDVG
RPIA_CHLTR       G---EWRET-----SAGERFITDNGNYIYDVRTPDS-YANP--EEDMIRLLQIRGIIDVG
RPIA_CHLPN       G---EWRLQ-----DTGDLFITDSSNYIYDIFSPNS-YPNP--EKDLLKLIQIHGVIEVG
RPIA1_OCEIH      P---TVRVH-----EE-EPLVTDNGNYILDC-PFKV-IPHP--DKLNKEIKSIVGVIETG
RPIA_STRA3       P---SFRET-----E-GDRFITDMGNYIIDL-DLKK-IEDP--KQLANELDHTVGVVEHG
RPIA_STRA5       P---SFRET-----E-GDRFITDMGNYIIDL-DLKK-IEDP--KQLANELDHTVGVVEHG
RPIA_STRMU       P---SFREY-----D-GVRFVTDMKNFIIDL-DLGS-IPDP--IAFGNMLDHQVGVVEHG
RPIA_STRPN       P---SFREK-----D-GQRFVTDMQNFIIDL-ALDV-IENP--IAFGQELDHVVGVVEHG
RPIA_STRR6       P---SFREK-----D-GQRFVTDMQNFIIDL-ALDV-IENP--IAFGQELDHVVGVVEHG
RPIA_LACLA       P---TWRLN-----EENERLITDMHHFIIDL-HISQ-IKEP--EKLAEELDLMGGVVEHG
RPIA_BIFLO       P---VLRLD-----ADGKEVRTDENNFVVDL-HLER-IDHP--QELAEDLINTVGVVEHG
RPIA_THEAC       T---DLRMN-----EKGEPFVTDNGNYIADM-HMGM-IDDP--INLERSLKSIPGVVEVG
RPIA_BUCAI       P---KYRKNVI----------TDNGNIIIDVYNLCI-KDPI---SMEKKINSLPGVVTVG
RPIA_BUCAP       P---KLRENII----------TDNGNVIIDVYNLFI-NDPI---SVEKKINSLPGVVSVG
RPIA_WIGBR       P---KYRKGII----------TENGNVLLDVHNLII-LDSL---FLEEKINNIPGVVSVG
RPIA_HAEIN       P---EYREGVV----------TDNGNVILDVHNFSI-LNPV---EIEKELNNVAGVVTNG
RPIA_PASMU       P---EYREGVV----------TDNGNVILDVYHFAI-MNPV---EMEKELNNVPGVVTNG
RPIA_ECOLI       P---EYRQGVV----------TDNGNVILDVHGMEI-LDPI---AMENAINAIPGVVTVG
RPIA_SALTY       P---EYRQNVV----------TDNGNVILDVYGMEI-LDPI---ALENAINAIPGVVTVG
RPIA_ENTCL       P---EYRQGVV----------TDNGNVILDVHGLEI-LDAI---ALENAINAIPGVVTVG
RPIA1_YERPE      P---EYRQNVL----------TDNGNVILDVHNLSI-LDAI---ALENQINGIAGVVTVG
RPIA_EDWI9       P---VYRQGVL----------TDNGNVILDVHNLQI-MEPC---KLENAINAIAGVVTVG
RPIA_VIBCH       P---VYREGVI----------TDNGNVILDVYNMKI-THPK---DLESKINGIAGVVTVG
RPIA_VIBVU       P---CYREGVI----------TDNGNVILDVYGMKI-TNPK---QLEDQINGIPGVVTVG
RPIA_SHEON       P---VYREGVI----------TDNGNVILDVYNLKI-LNPK---ELEDKINAIVGVVTNG
RPIA_PSEAE       P---VYREGVL----------TDNGNIILDVHNLRI-DSPV---ELEEKINAIVGVVTNG
RPIA_RALSO       PRLRMTKEGQIY--Q------TDNGNVILDVSGLRI-GEPK---TLEAQINDIPGVVTVG
RPIA_XANAC       P---VWRDGVV----------TDNGNVVLDVHHLQV-TDPV---GLERSLNQIPGVVCVG
RPIA_XANCP       P---VWRDGVV----------TDNGNVVLDVHNLHI-TDPV---ALERNLNQIPGVVCVG
RPIA_XYLFA       P---VWREGVI----------TDNGNVILDVHHLRI-TDPV---KLEQELNQIPGVVCVG
RPIA_NEIMA       P---ELRIGYT----------TFYGNQIVDVHGLNI-DQPL---TMEDEINKITGVLENG
RPIA_NEIMB       P---ELRIGYT----------TFYGNQIVDVHGLNI-DQPL---TMEDEINKITGVLENG
RPIA_BORBU       TLRICKEKK--------GPTITDNNNYILDVKMHVE---NP--EGTEKYFKLFPGILEIG
RPIA_TREPA       HIREAVRKK--------GPVVTDHGNFILDARWQSLPTRTP--QDMERALNALPGVIENG
RPIA_AERPE       RVRTSPGKR--------GPVVSDWGGVIVDL--LTGPLEDP--RGLESMLRNVPGVRETG
                                      :     : *                   :    *:   *

RPIA_THEEB       LFVN-VADVILVGEIVDGQPQVREIFH----------
RPIA_SYNY3       LFVG-VADVILVGEIIDGQPTVREF------------
RPIA_NOSS1       IFVN-CADIVLVGEVKDGQPLVRRL------------
RPIA_PYRAB       IFAD-IADIVIVGTKEGVKTLER--------------
RPIA_PYRHO       IFAD-IADIVIVGTREGVKKLER--------------
RPIA_PYRFU       IFAD-IADIVLVGTKEGVKRLER--------------
RPIA_METJA       IFTK-V-DKVLVGTKKGVKTLKK--------------
RPIA_METTH       IFAG-IADMVIAGTSEGLKILR---------------
RPIA_METAC       IFCN-VSELYIGNKDGAIKIITRQK------------
RPIA_METMA       IFSN-VDELYIGKKDGSVKIISRQK------------
RPIA_ARCFU       IFSKELIDAVIAGSSRSARFL----------------
RPIA_AGRFC       LFIN-LASLAIIAGPEGARMMQAV-------------
RPIA_RHIME       LFID-VASMAIIAGPEGARTLTAS-------------
RPIA_BRUME       LFIE-LARAAIIAGTDGIRTMNRS-------------
RPIA_BRUSU       LFIG-LARAAIIAGTDGIRTMNRS-------------
RPIA_RHILO       LFIG-LASTAIIAGGDGIQTVHAARKPGSSTNHDVA-
RPIA_CAUVC       LFLD-LADEALVGTDEGVVRLQP--------------
RPIA_CHLMU       FVIA-KAEVWVGYADGTVVRKEIT-------------
RPIA_CHLTR       FVIA-KAEVWVGYADGSIVRKKEHNEY----------
RPIA_CHLPN       FVIE-KVEVWSSNSQGLISKKYSV-------------
RPIA1_OCEIH      LFID-MATTVIVGEKDNIYIK----------------
RPIA_STRA3       LFNS-MVNKVIVAGKNGLDILEK--------------
RPIA_STRA5       LFNG-MVNKVIVAGKNGLDILEK--------------
RPIA_STRMU       LFNG-MVNRVIVAGKDGVRILEANK------------
RPIA_STRPN       LFNQ-MVDKVIVAGRDGVQISTSKKGK----------
RPIA_STRR6       LFNQ-MVDKVIVAGRDGVQISTSKKGK----------
RPIA_LACLA       LFNN-MVKKVIVAGNEGVRIINK--------------
RPIA_BIFLO       LFLN-MVDKVIVGDPNGPRVMTNANK-----------
RPIA_THEAC       LFNG-IAKRIFEGTDEGCNIYSITNSGIKKEEVYFDP
RPIA_BUCAI       LFASRSADIVLIGTQKGIRTINKKENR----------
RPIA_BUCAP       LFASRVADVVLIGTQKGVEIIKN--------------
RPIA_WIGBR       LFAHRAADIAIISGKNGIKIID---------------
RPIA_HAEIN       IFALRGADVVIVGTPEGAKVID---------------
RPIA_PASMU       IFALRAADIIIVGTPEGAKVIE---------------
RPIA_ECOLI       LFANRGADVALIGTPDGVKTIVK--------------
RPIA_SALTY       LFANRGADVALIGTPDGVKTIVK--------------
RPIA_ENTCL       LFANRGADVALIGTADGVKTIVK--------------
RPIA1_YERPE      LFANRGADVALIGTANGVKVIG---------------
RPIA_EDWI9       LFANRGADVALVGCADGVKTLTL--------------
RPIA_VIBCH       LFAHRGADVVITGTPQGAKIEE---------------
RPIA_VIBVU       LFAHRGADVVITGTPEGAKIEE---------------
RPIA_SHEON       LFAKRGADVLLVGTPEGVKTFTA--------------
RPIA_PSEAE       LFAARPADLLLLGTADGVKTLKA--------------
RPIA_RALSO       LFAKRGADVLLLGTEAGVQRRDF--------------
RPIA_XANAC       LFARRPADVVIVGG-EPPQVI----------------
RPIA_XANCP       LFARRPADVVIVGG-ETPRVL----------------
RPIA_XYLFA       LFARRCADLVIIGS-EPPHIL----------------
RPIA_NEIMA       IFARDAADVLILGTEEGAKVIYPCQG-----------
RPIA_NEIMB       IFARDAADVLILGTEEGAKVIYPCQG-----------
RPIA_BORBU       IFNHKNTRIVYYQDKQIKEA-----------------
RPIA_TREPA       LFTERTVRVFVAHADGSVEERSASF------------
RPIA_AERPE       LFLGLADYIVVGLSSCGYRVLGPYRGRAV--------
                 :.