CLUSTAL format seed alignment for MF_00171

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRUA_CAMJE       --------------MMKIKIIFSYDGSAFLGSATQPHK------KGVQDALSGALSHLGI
TRUA_WOLSU       --------------MPTLLAFLEYDGSAFFGSQIQKEE------PSVALALQRGLKSMGI
TRUA_HELPJ       --------------MRCFKAIVAYDGAYFLGYAKQPNK------LGVQDKIESALNALGI
TRUA_HELHP       --------------MPTYKAVIAYDGSVFSGFALQKDKRL----KSVLGTLKEGFARVGI
TRUA_UREPA       ---------------MNYKISLRYDGSLFYGWARQPQK------RTVQGDLEEIFKSIFK
TRUA_MYCPE       ---------------MTYKLKISYDGSFFRGYAKQKDENL----ITVQSELEK-YLSLFF
TRUA_MYCPN       --------------MPRYLAIVAYNGAPFRGWAKQPGY------HTVQGQIEQ-NLALIY
TRUA_BIFLO       --------------MTRLRIDLAYDGGGFYGWAKQ--PNLRTVQGTIEDALHKVLRVPTD
TRUA_TROWT       ------------MNKTRYRLDVAYDGANFCGWAPQ--PGLRTVGGLILDALRLICSEPPD
TRUA_CORGL       ---------------MRIRLDLAYDGTDFHGWAKQGTSDLRTVQKVLEDNLSMVLRETVE
TRUA_CHLTE       ----------MARSKRTIKMQIEYDGTGYSGWQRQ-PGDVVTVQGEIERVLERIMQEPVS
TRUA_BACTN       --------------MQRYFIYLAYDGTNYHGWQIQ--PNGSSVQECLMKALSTFLRRDVE
TRUA2_BACCR      --------------MHNYKLTIQYDGARFKGWQRLGNNDN-----TIQGKIESVISEMVG
TRUA1_CLOTE      --------------MRNLKMILEYDGTRYKGWQKQKKDVL-----TIQDKIETVLSKMTG
TRUA2_CLOPE      --------------MRNIKLTIEYDGTSYFGWQKQ-PIGN-----TIQQKVEEAIKKVTK
TRUA_BUCAP       ------MKEKKNK---KFALGVEYDGSYYHGWQSQ-KGLS-----TIQSEIEKALSKIAN
TRUA_ECOLI       ------MSDQQQPPVYKIALGIEYDGSKYYGWQRQ-NEVR-----SVQEKLEKALSQVAN
TRUA_WIGBR       ------MK--------KLAAGISYQGNNYCGWQSQ-KNII-----SIQEYVELALFKFSG
TRUA_BORBU       --------------MKKILAEIAYDGSIYHGFQIQPT------KPTVQGEIEKALMKINK
TRUA_TREPA       -----------MNDVRKILLRISYDGTRFCGWQKQVSGSRE-RAPSVQGELEKVAEKIHH
TRUA_DEIRA       MDADPPRLYAPPPGFTRLRLTVAWDGRDYAGWQEQRNAVS------VQETLQTALHALGG
TRUA_RHOPA       -----------MSRMPRYKLTIEYDGAPFCGWQLQPALPS------VQGALEAAALATCG
TRUA_CHLTR       -------------MTKKIVLQIAYQGTSYSGWQYQPNALS------IQEVLETILKKIAG
TRUA_GEOSL       --------------MRTIKLILEYDGTNYAGWQLQPNGLS------IQEVVEGALARLLK
TRUA_RHOBA       --------MQANDRPRTFHLTVAYDGTEYCGWQVQPEQRS------IQSELERVIRPLAG
TRUA_GLOVI       MSVDAVGGAVEGA-PARLALRVQYLGGHFFGWQWQPGQRT------VQQCLEEATERIAR
TRUA_SYNPX       MSSEPSSAAPESTIPRRIALSLQYEGSAFCGWQRQRNGNS------VQAQLEAAIEQLDP
TRUA_LACPL       -------------MTTRYKVVLAYDGTNFAGFQRQPHQRT------VEQVVTKAVNKMAK
TRUA_STRA5       --------------MTRYKAQISYDGSAFSGFQRQPNCRT------VQEEIERTLKRLNS
TRUA_STAES       ---------------MRILVEIAYQGNQFLGFQIQQQGRT------VQQQFEKILKRMHK
TRUA_THEMA       --------------MKRVAAVIEYDGSNFFGYQGQPDVRT------VQGVIEDALERIFK
TRUA_AQUAE       --------------MPNYLLRLAFVGTNFYGWQVQPNLRT------VQGEIQKALSQILC
TRUA_METMA       ---------------MRVALKLAYIGTEFHGSQIQPSVET------VEKELFKALRNLRI
TRUA_ARCFU       --------------MMKFAFKIAYFGDNFHGSQFQPDQRT------VEGEVINALRRLGV
TRUA_METJA       ----------------MYILKIAYDGRY--SFQQQPHKQT------VCDILLDALEETGF
TRUA_METMP       ----------------MYIFKIAYDGKL--SFQTQPHGET------VCDKISNALLDCGY
TRUA_THEVO       -------------MTHAYFFKFGYIGYMFTGYQRGNGVKS------VEDTIIKALNLNS-
TRUA_THEAC       --------------MTNYAFKFGYEGSYFTGFQRGNGDHS------VEDTIIDTLKASGF
TRUA_PICTO       ---------MASQREMHLLIKYGYDGTKFEGFDRSNSKNS------VESVIINVLSEYNI
TRUA_PYRHO       ---------------MKVALKIAYDGTKFHGFQRQPNVRT------VEGEIIKALNNSGI
TRUA_FUSNN       ----------MLMRRKNIKIEFRYDGSSYYGFQRQPNKIT------VQGEIEKVLRIVTK
TRUA_METTH       --------------MRKIALKVAYIGTNYHGFQRQPDVPT------VEGKLLEALEGAGI
TRUA_ONYPE       ------------MQHFFYKLILSYDGTCYYGYQKQPQKIT------VQQTFEKALKKMTH
TRUA_METKA       ---------------MRVALRVAYDGSRYHGFQYQPDVPT------IEGALRKALSELGL
TRUA_MYCMS       -------------MKTGILLSLCYDGSNYHGWINQTNAIS------IQTTLNKAIKKVIK
TRUA_HALSA       --------------MPRRAFRVAYDGRPYHGFQRQPDVST------VAGELFGALRRLDV
TRUA_PYRAE       ---------------MPYLYRIAYDGTMFYGFTGHPNS--------LEPRLRLIFGEILG
                                        : *    .               :   .         

TRUA_CAMJE       F---SPL--LMASRTDKGVHASYAVASVECGDY------FTN----LEYLQKQLNKFSHP
TRUA_WOLSU       A---SKV--RFSGRTDRGVHATRQAVSFEVPYK------KSD----WGYFKEELNKKLFP
TRUA_HELPJ       K---SGV--IAAGRTDKGVHANNQALSFHAPKH------WNA-----AKLFHYLAPKLAP
TRUA_HELHP       K---SDI--IGAGRTDKGVHATGQVICFQSAHF------LDSQVQAIESLRFLLNAKLYP
TRUA_UREPA       I---NNIRIIGSGRTDKGVHAYEQTFSVKHSAL------KYDSH----IIYQALCSRTSS
TRUA_MYCPE       N---TKISTFGSGRTDKYVHAIDQTVSFKCDS-------DYDPK----SIQNFLNSKLT-
TRUA_MYCPN       Q---TPINIYGSGRTDKGVHAINQTFHVDLPD-------KLPLK----QLIAKLNQLNYP
TRUA_BIFLO       DAA-EPLRLTVAGRTDTGVHASHQVAHLDVSDEVLNRCVGHMTIPVTEALTRRLKAVL-P
TRUA_TROWT       --------IVVAARTDAGVHALQQVCHVDL-----------ISSPDPVWLLHRLRSLL-K
TRUA_CORGL       --------LTVAGRTDAGVHAAGQVAHFDIPAHALEQ---RSIDGDPSKLVRRLGRLL-P
TRUA_CHLTE       --------IDGAGRTDSGVHARRQVASFAT-----------CSPMPLGRLIYSANSLL-P
TRUA_BACTN       --------VIGAGRTDAGVHASLMVAHFDH-----------EDVLDTVTVADKLNRLL-P
TRUA2_BACCR      K----EIEIIGCSRTDAGVHALNQVANFQ----------SDEK-LVEHKVKKYLNQYL-P
TRUA1_CLOTE      E----DIQVIGCGRTDAGVHAENYVANFH----------TNCD-FTVDYMLDYLYEFL-P
TRUA2_CLOPE      E----EVEILGSSRTDSGVHAKAYVANFK----------TNSN-IPGKNFKAALNSKL-P
TRUA_BUCAP       H----QVNVICAGRTDSGVHSIGQVIHFT----------SISF-RSDFSWIVGVNSYL-S
TRUA_ECOLI       E----PITVFCAGRTDAGVHGTGQVVHFE----------TTAL-RKDAAWTLGVNANL-P
TRUA_WIGBR       E----KIKIYCAGRTDAKVHALLQVVHFY----------TDIK-RSYRQWILGVNSYL-P
TRUA_BORBU       K----KVKIHSSGRTDKGVHAKKQIITFD----------IKINIQLNNLKKALNAILL-K
TRUA_TREPA       Q----KIAVIGSGRTDSGVHAVGQAAHFC----------TPMRNILAYRFIPAFNSLL-P
TRUA_DEIRA       EG---ALRPVSAGRTDAGVHAEAMPLHWD---------VPTTFRVPLVQLPRALNAWL-P
TRUA_RHOPA       E----AVRVHGAGRTDAGVHALGQVAHVD---------IPKPFRAD--KLRDALNAHLRP
TRUA_CHLTR       F----RISVISSGRTDAGVHAQGQIAHFHC--------PDHPHFTDPRQIQKMLNALL-P
TRUA_GEOSL       E----PVRLRASGRTDAGVHARGMVAAF-----------DTDRSIPLRAFSDGLNALL-P
TRUA_RHOBA       R----PVRVLGSGRTDAGVHAIGQVARC----------VLPVWKADTVALQRAINSKL-P
TRUA_GLOVI       H----PVRYHAAGRTDTGVHASGQVVHFDT-----------HKKLAPETWVRGLNSLL-P
TRUA_SYNPX       YR---PIQTFAAGRTDTGVHAAGQVVHFDC-----------GDRIPPAKWAPALNGRL-P
TRUA_LACPL       DPV-EPIVIYGAGRTDAGVHAFGQTLHFDLPYE-----------INPEGVRRGLNSML-P
TRUA_STRA5       G---NDVIIHGAGRTDVGVHAYGQVIHFDLPQA-----------RDVEKLRFGLDTQC-P
TRUA_STAES       H----HVRIHPSSRTDRGVHAYQQFFHFDTELN-----------IDNKQWQYAMNRAL-P
TRUA_THEMA       Q----RIYTQAAGRTDTGVHANGQLIAFNCPNDR----------MTTEDIRNAMNANL-P
TRUA_AQUAE       E----DVKVTGCCRTDSGVHALDYIANFKTQKD-----------FPEEKLLKALNGIL-P
TRUA_METMA       IESPKSANYICAGRTDAGVHALGQVIAFDTDRP-------------NLAIPRIINSGLPP
TRUA_ARCFU       -ENPR---LRSAGRTDAGVHAYGQVISFYSE---------------DKIFPRMLNAELPE
TRUA_METJA       LAKKK--VIYSGGRTDKGVSALGNFVVVELKKE-------------PILSYINAKLKD-K
TRUA_METMP       LDNKDRVPLYHGGRTDRGVAALGNYVVYEMDKK-------------PVLPRVQSKLKW-D
TRUA_THEVO       -----PSLIKTAARTDRGVSALSNVFYIETERR-------------PQDIAGIINSKN-E
TRUA_THEAC       -----DYAIKAAARTDRYVSALSNVFSLETGRS-------------PEAVAGLINSRI-D
TRUA_PICTO       -----TKNIESAARTDKNVSAAGNVFYIKTEER-------------PEKILGILNGNI-K
TRUA_PYRHO       M----FNELKSASRTDKGVSALGNVVAITTEDE-------------RITNPMILNAKL-K
TRUA_FUSNN       E----EINLISAGRTDRGVHANHQVSNFYTSSN------------IPIEKYKYLLTRALP
TRUA_METTH       IEDPKRARFQIAGRTDRGVHALGNFVSFFTEED---------------IHVNQINDLLPR
TRUA_ONYPE       Q----NIPTFAASRTDKGVHSQGQTLHFQTTFF-----------LKPTHFQKTLNYLLPP
TRUA_METKA       E------LVGYASRTDAGAHARYQVVVVEGDPE--------------LAQPDPINARLPK
TRUA_MYCMS       TG---QFKTIGASKTDTNVHALDQKVLLIIYFT-----------PILEKFIKAINKALPS
TRUA_HALSA       FDGAKPPGYAAAGRTDAGVSARAQTVAFDAPAW---------------LTPDAFTGALPD
TRUA_PYRAE       R----------GSRTDPGVSAVGNVVMTGR-----------------KMALGYVNSKMPK
                              :**  . .                                       

TRUA_CAMJE       FIHIKKIEKV---KDDFEVRFDVKSREYRYIFSHA--SYSPFMASYVHFYPKF-DLGKAN
TRUA_WOLSU       YLRVRRLYPI---REGLDPRFEAKSRAYRYLLSEE--PLSAFASRYVTHAHLG-DERKIQ
TRUA_HELPJ       HIVLKKLE-----EKNFHARFDAQKRAYRYLLTKN--LKTPFLAPYIACGDYG-SLDALN
TRUA_HELHP       HIMVRSLHIV---DDTFHPRFDALWRSYRFLLSPT--QPSPFAAPYVSYEKIG-DETLFK
TRUA_UREPA       DIQILEVQKV---DDSFHAQYNATSKTYQYVINDY--EFDLFRNNYELFVNQKINDQKIL
TRUA_MYCPE       NIYVNSIEKV---PNSFHARFSIKSKTYMYVINTG--EFDVFKQRYEYQYNKSIDIKKCE
TRUA_MYCPN       DIFVKALVPV---APRFHARFAVKTKVYEYLINTR--AFNPAQYHTVWQYNHPLDLAQLE
TRUA_BIFLO       SDIVIHGIAV--APVGFDARFSALERTYVYRVADRSSEVDPRLRGCVLTVDEALDLELMN
TRUA_TROWT       SETDLHILSAVKAPVNFHARFSAIGRRYVYRVIDKRSSWYPQNRYFVYRVNAFLQDYRMR
TRUA_CORGL       DDIRVHGVRF--AEPGFDARFSAMRRHYVYRITTHPAGALPTRRHDTAQWPKPVELERMQ
TRUA_CHLTE       STIRINAMRQ--APESFHARFSATSREYRYFLLEHPSAIDSRFAGCSHGKP---DVGAMN
TRUA_BACTN       PDISVYRVRQ--VKPDAHARFDATARTYKYYVT---TAKYPFNRQYRYRVYGSLDYERMN
TRUA2_BACCR      NDISITNVEE--VHDRFHARYNSKAKTYLYKIWNE-EHTNPFMRKYSMHVNKKLNVKSMK
TRUA1_CLOTE      EDIVVKTMKD--TSERFHARYNVKSKTYVYRINNN-KFRSVFNKKYAYHDNEKLNISAMK
TRUA2_CLOPE      KDIVIINSEE--VAEDFHARYMTTGKTYCYTILNR-EEPPALERNYVYHVKKQLDVESMK
TRUA_BUCAP       KNISVKWIKE--VSENFNARYSAISRSYRYIIYNH-KCRSAIFRNRSNHVYKELNVDKMY
TRUA_ECOLI       GDIAVRWVKT--VPDDFHARFSATARRYRYIIYNH-RLRPAVLSKGVTHFYEPLDAERMH
TRUA_WIGBR       YDISIMWVIK--VHNNFHARYSAIAKKYLYLIHNN-ISRSGIFRKYCFNVFISLNINDMK
TRUA_BORBU       NSIKILKLRY--VKNSFHPRFSAQKRKYSYCILNS-DNYYPWEGYQAHYVNKKLSISNLN
TRUA_TREPA       HSIRITDARE--VSSQLHARFSAVMRTYRYHLHCA-PVAYAHELPYCWHIARMPDIHLLN
TRUA_DEIRA       ASVSVLSAEV--APAGFHARFSCTERRYVYRLWVA-PQRHPLWAGRALHVPGPLDAEAMN
TRUA_RHOPA       NPVAVLAAEI--VPDTFEARFSAVRRHYRYRIANR-RSNLALDLGKVWRVPKPLDTDAMH
TRUA_CHLTR       HDIVIRDAVM--TDEDFHSRFSAIAKEYRYTLSLL-PKPLPHHRLFCFSPRYKLNIARMQ
TRUA_GEOSL       PDIAVRSADE--ALPGFNPRFAATGKHYRYTIHRG-ERRSPLVRLQSWHVRGALNLAAMR
TRUA_RHOBA       NDIRVKAVRE--TRERFHPIADATGKQYQYLVQVG-GSRDPFANRFVNRVGGPIDHSAMQ
TRUA_GLOVI       DDIAVRAAAYV--SDHWHARFTALWREYRYCIHNSTVPDLFVRAQSWYYPYCPLDSEAVA
TRUA_SYNPX       FTIRVRESVLR--PKDWHACYSATYRRYRYTIHNGRRPNLFLAPWSWHRYQLRLDESRMR
TRUA_LACPL       MDTIVKAVSI--VPNDFHARYDTVGKRYWYRAYQN-EFVDPFKRHYTGHFKFAADIDRIQ
TRUA_STRA5       DDIDIVKVEQ--VSDDFHCRYDKHIKTYEFLVDIG-RPKNPMMRNYATHYPYPVIIELMQ
TRUA_STAES       DDIYVKNVRN--VDEYFHCRYDCVGKRYRYKVYQG-NHRNPFKSGTETFVNETLDYDKMN
TRUA_THEMA       DDVYVKEVFE--VPVNFHPRFDVTKRIYHYFILTS-RQKNVFLRKYVWWFPYELDLDAMR
TRUA_AQUAE       KDVGVYAVKK--VSEEFNARYSVKGKVYLYKIWNS-EVRNPFLYPFSWQVKREINTEVLR
TRUA_METMA       TIWVWAHAEV---PYDFDARRHAVSRHYRYVISGE-----------------GYDISKMR
TRUA_ARCFU       DITAWAWAKV---SEDFDPRR-AKSRVYTYVMYGS-----------------DYDISAMR
TRUA_METJA       GIWVLGYREI---DEIPKVK----YRHYRYILPNI-----------------GYDVDAIK
TRUA_METMP       GIWVLGCKKI---EIFPEIE----HRHYQYTLPNK-----------------NHDVELMK
TRUA_THEVO       YVFVHSFAEV---EHGRNPR-YCDTKTY-MYMLPG-----------------ETECDSLM
TRUA_THEAC       HIYVHSYAEV---PDDFNPR-HCTFKTYRYYILRQ-----------------DLDCISLD
TRUA_PICTO       NMFFHSYYLS---NSYINPR-YNSMKIY-KYIIPY-----------------RIDS-RLK
TRUA_PYRHO       DVWVLSAVKV---PSDFHPRFWARSKVYRYYLPSF-----------------DLDVEKVK
TRUA_FUSNN       NDIDILSVEE--VDENFNARHNAKMREYIYIISWE---KNPFEARYCKFVKEKIVAEKLE
TRUA_METTH       DIRVLAWASV---MYPFKVRY-PLERHYRYILHRE----------------ESMDTYSMA
TRUA_ONYPE       DIRVRQMNFA---TPNFHARYSAKSKIYQYVFSKK---PLNAFNHHFQIFADKLYFDKIT
TRUA_METKA       DIRVIAKTEV---HEEFDPRRDALRKEYRYFLGPL------------------NRPEAAA
TRUA_MYCMS       DIKILDAKFV---DPNFNIR-EVEYKIYHYYINDH-QFDIFTNRYEYFWKHQKIDIIKLQ
TRUA_HALSA       PIQVWAHADA---PPEFHATHDAVARTYVYYWYAP---------------DSRATDDRAA
TRUA_PYRAE       GAWAWGIAEV---PEGFNPR-RAKLRRYLYVAPHW-----------------GEDVDVMR
                                  .       : *                                

TRUA_CAMJE       ELLGFFVGKKDLKFFCKSG---GDNKTTLREIFIARAYAYKDFS----------------
TRUA_WOLSU       EAMKLLVGWHDFALFKKSG---SQEKSTLREMRRCWLYRYRSYW----------------
TRUA_HELPJ       IALKQFIGKHDFSMFKKEG---GATTNPNRIIFNALAYKTFIMG----------------
TRUA_HELHP       NALQAFQGQHNFVFFKKNG---SYTKNCIRTIFAIKHYTYKGLD----------------
TRUA_UREPA       EALELFVGEHDFKSFSTSE-----LTMTIRRINWVKI-KRDTH-----------------
TRUA_MYCPE       DIINLFIGTKDFLSFSTSK-----LENTTRTIRWIRIIKKNKK-----------------
TRUA_MYCPN       ADTTLFLGRKDFWSFSTAS-----QKDTQRTISKIIVQQDHTGT----------------
TRUA_BIFLO       RAASLTIGLHDFGSFATPN---PGGTTIREVKTAYWRRVPITPLVPDEMASHEAYRTPSL
TRUA_TROWT       RAASGLIGLKDFGAFCKPR---RMGSTVRHLR------------------QFEVIRQPD-
TRUA_CORGL       LAADALLGLHDFVAFCKAK---PHATTVRELQK-----------------FAWKDVSTDI
TRUA_CHLTE       RLALMLIGTHDFAAFSKET---PDQYGTLCTVT-----------------AARWYRSGR-
TRUA_BACTN       EAARTLFEYIDFTSFSKLH---TDVKTNICHIS------------------HAEWTKMEG
TRUA2_BACCR      AAAKHLVGSHDFTAFSNAK---SKKKSMVREVYTLDVME---------------------
TRUA1_CLOTE      DAAEFLIGTHDFKSFTRLK---SNSKSTIRAIKYINITE---------------------
TRUA2_CLOPE      EACKYFLGKHDFKAFQRPG---GTVKTSVRTITDIHIET---------------------
TRUA_BUCAP       FEAQSLLGEHDFSSFRSSG---CQSRSPFRTITDLNIRR---------------------
TRUA_ECOLI       RAAQCLLGENDFTSFRAVQ---CQSRTPWRNVMHINVTR---------------------
TRUA_WIGBR       KAAQKLIGKHDFSSFKGSE---CQSKTTYRVIYYIRINK---------------------
TRUA_BORBU       QMAKTLIGKHDFTTFSCIK---DKSKSKFRHIYFAKFKK---------------------
TRUA_TREPA       QYAATLKGELDCTSFAAAG---DKSASKSRYFYDTHFSF---------------------
TRUA_DEIRA       RAAQSLIGLHDFAAFATRE---DRQTV--RDLLRLEVQP---------------------
TRUA_RHOPA       RAAQVLIGKHNFTTFRDTE---CQAASPEKTLDVLDVIR---------------------
TRUA_CHLTR       EAAQYLVGTHDFASFANLG---REYSSTIRTLYTLDLSE---------------------
TRUA_GEOSL       EAARHLTGERDFASFRTAG---CAARTTIRRVDAVEISD---------------------
TRUA_RHOBA       SAAAKFVGRHDFKAFQGTG---AERPSTVRTIHSARWIPR----------VATGPTGAEL
TRUA_GLOVI       AALATLPGHHDFRAFRRAG---SSRPHSLVHVYTAECTR---------------------
TRUA_SYNPX       DALNGMLGLHDFSAFMRAG---SRRAHARTTVQEVDLVR---------------------
TRUA_LACPL       QAIGDLEGRHDFSTFVASG---SQAHDHVREIYSAKAWA-------------------LP
TRUA_STRA5       EAIKDLVGTHDFTGFTASG---TSVENKVRTIFDAKIQF-------------------EA
TRUA_STAES       KAAQEFIGTHDFTGFCSQK---TEVESKVRTLYQSEI---------------------VA
TRUA_THEMA       KAVKYLEGTHDFTSFKTG----SDERDPVRTIYRIRILR-------------------LK
TRUA_AQUAE       NILKKFEGTHDFRALTKLE---EERN---TVINLEEVSL-------------------NV
TRUA_METMA       EASKLLLGTHDFENFSRSN---GE-KSTVRTLERINVRV---------------------
TRUA_ARCFU       KAVKELIGVHDFSNFTKKF---GEGESCVREIISADIRA---------------------
TRUA_METJA       EGAKKMIGTHSFHNLSKRDR--TKEKSPIRTIYDIKISE---------------------
TRUA_METMP       KASEKLIGTHYFQNLSKRDK--TKVKDPVRTLYDIKISS---------------------
TRUA_THEVO       VTASGFLGFHDFSKFSKKD-----TRNPWRSIDEVKCHR---------------------
TRUA_THEAC       INLGKFIGTHDFRRFVRAD-----SRNTVRTIINASCKN---------------------
TRUA_PICTO       NNIARFLGTHDFTNFSKND-----YRNPVRTINKIEFEE---------------------
TRUA_PYRHO       ECSKLFLGVHDFSAFSRVD-----GRETVRSIDRIEVLD---------------------
TRUA_FUSNN       KIFSDFIGVHDFKNFRLSD---CVSKVTVREIYQIEVKYFG-------------------
TRUA_METTH       EAAAHFRGTHDFSNFSRRS-----DRDPVRRINDVRISE---------------------
TRUA_ONYPE       KALKFIEGTHNFFAFTSET----QPKNFSKTIFQAFLKE---------------------
TRUA_METKA       RAARKLEGKHDFSAFRRED-----GRNPIITVERCELVEI--------------------
TRUA_MYCMS       EIFNLFIGEHEFKLFSGLKENEWNQYQTKRTIDDIKVLR---------------------
TRUA_HALSA       GALDRLTGTHDFHNLTPNT------TNTVRELDATLDRD---------------------
TRUA_PYRAE       EAAKLLTGTHDYSSFIQLRG--EKHTPTVTTVYDIDVTL---------------------
                               :                                             

TRUA_CAMJE       -IFHFK----ANGFLRGQIRLSVASVLKVLEGKMSEKELKEQIE-AKKQY----------
TRUA_WOLSU       -VFYFE----ANGFLRLQIRLLVGALLKVGRGEMSLEEFKEQLE-AKRRF----------
TRUA_HELPJ       -HECVVFKIIGDAFLRSSVRLIIQACVQYSLEKITLAEIQAQIH-NLKAT----------
TRUA_HELHP       -IVYVR----GNGFLRAQVRLMVGAALAYSRAELSFHSLQEQIN-GQKQH----------
TRUA_UREPA       -LIIYIN---ANGFLKNMVRMIVASCLDYAFNKISLAKIHELLIYPKKGA----------
TRUA_MYCPE       -IYIFIN---GEGFLRNMVRMIVGIILTYCENKITYQEVLDLFKNPKKGS----------
TRUA_MYCPN       -VKLTFF---GNGFLRNQIRMMVASLVALNNRTLMRETVQQLFDQPQKGG----------
TRUA_BIFLO       ESGLVVFTIVADAFARNMVRSLVGSCIKVGSGRKSLEWFAGKMAEPVREG----------
TRUA_TROWT       --GQIHFFLESDAFCHSMVRNLVGSLIEVGRGALTLQDLFCYTKIAKRTP----------
TRUA_CORGL       EPQVYEAHVVADAFCWSMVRSLVGSCMAVGEGRRGSGFTAELLDASERSP----------
TRUA_CHLTE       ---FHVFRIEANRFLRSMVRFLVAGMIEVGMGRLEEGAFARMLESGHRPP----------
TRUA_BACTN       EDTTWVFTIRADRFLRNMVRAIVGTLLEVGRGKLTVEGFRKVIEQQDRCK----------
TRUA2_BACCR      EAGFVQIRVSGNGFLHNMVRKIVGALIEVGLGQLDAEAIPNILEEKQRNQ----------
TRUA1_CLOTE      NQGIISIEVNGNGFLLNMVRIVAGALLEVGKENIKPIDIEKMLNEKKRAD----------
TRUA2_CLOPE      EGNKIKIYVSADGFLYNMVRLIVGTLLKVGRGKEKPEYIKEVIDSGDRKK----------
TRUA_BUCAP       LKNLVIIDITANSFLYHMVRNIVGSLIQINDNTK-KNYIKKILDKKDRNY----------
TRUA_ECOLI       HGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTL----------
TRUA_WIGBR       YKEYIFVEIKANSFLNHMMRNIIGNLIEIGKGKKSKEWMSELLFLKNNKF----------
TRUA_BORBU       RGKYIIFEIIGSSFLWKMVRSIIGTMLDIEIKNESISTFETILKSKNRNL----------
TRUA_TREPA       NHRVLTFEISANAFLWKMVRSLTGTLLHCEKKRCSVREFVRILHAKDRRLQGPPHRRMGY
TRUA_DEIRA       QGELWDIHVAGESFLRHMVRGLVGTLLLVGQGKLGAAEVEGILASRERAR----------
TRUA_RHOPA       DGDAVDIITNARSYLHSQVRSMVGSLVWVGEGRWTADDLAAALAARRRSA----------
TRUA_CHLTR       QEHLVTVICRGNGFLYKMVRNIVGALLDIGKGKYPPEHLLDMLATKDRRK----------
TRUA_GEOSL       DGEMLTVDVHGSGFLRNMVRIMVGTLVEVGRGKLTPEHVAQMVVCPGVVP----------
TRUA_RHOBA       EGEHWCFEIDGEGFLYNMVRNLMGTMLEVGRGKKSPNWIDEVLASRDRKM----------
TRUA_GLOVI       EGEQIAIRVRANSFLYGMMRLLIGALAEVGSGRWSVERFAGLWQAGNREQ----------
TRUA_SYNPX       QGDMVRVEIQASGFLYGMVRLLIAQLVAVGEHRLSVQDFEQRWRQRRRHE----------
TRUA_LACPL       DEREIQFEFCGSGFLYNQVRIMVAVLMEIGQGRRAVDCIPALLAAKDREQ----------
TRUA_STRA5       SKNLLIFTFTGNGFLYKQVRNMVGTLLKIGNGRMPISQIKTILQAKNRDL----------
TRUA_STAES       TKEGFDYVVTGSGFLYNMVRVLVAFLIEVGKGKREPNDVPKLLEDKNRNN----------
TRUA_THEMA       ND-LVLIRVEGRSFLRRMVRNIVAALVKVGLKQWEPEKMKEVLEARDRSA----------
TRUA_AQUAE       EYPLIEIRLKASHFLRYMVRRIVGTAVKISLGLYSEEVLEELLQGKG--N----------
TRUA_METMA       DGDITKIDVVGNSFLWNMVRKIVTALSMIGKGVRDNDWLIQMLNPDIYEEGIEPA-----
TRUA_ARCFU       DREFIIFEIEGNAFTWNMVRCIVTAIMEIGKQHRSIEWFRDLLNPEKHKERVEPA-----
TRUA_METJA       NEFYLTVDIIGESFLWNMVRKIVGALDLVGRGKK---PVEWIDKLLDENHREGVP-----
TRUA_METMP       NDYFITIDIFGESFLWNMVRRIIRLLSDIGKHKIEN-PEKFIELILSEDYKKGYP-----
TRUA_THEVO       ESFGVVLEFSAKSFLWNQVRRMLAFILEFRGNKIDPFSVSNIYSHIAP------------
TRUA_THEAC       DNGLLYLEFSARSFLWNQIRTMVAFILDNIGVETDPFSTSERYPRVAR------------
TRUA_PICTO       YNDFTVVNFYGKSFVWHQLRSIIGFAMHS---DEDPFSIKYHNRFLAE------------
TRUA_PYRHO       LGPVLAIEVEAKSFLWEMVRRIVKTLELCGLGKLSSEEVRKMLRGKFEKSRKVPP-----
TRUA_FUSNN       -ENKIKIYIKGSAFLKSQVRIMVGTALEIYYGRLLENHIRLMLNDFTKEY----------
TRUA_METTH       VGDSIIIDVYGESFLWQMVRKMVRALLMVSEGELAPDDMAGLLDTDRRVFLEPMP-----
TRUA_ONYPE       TSHKYILVFHGNGFLKYMIRFLVGSLIEIGKNKLSLEQFQAMLLGNTTKK----------
TRUA_METKA       TPNAYVLRVVAPRFLWEMVRRIAGFVWEVGHGLREEGDAEALLSGKFEPS----------
TRUA_MYCMS       INNKVVIQFKASGFIRYQIRIIIANCLNAYLNHKISTTKLVEMLQGIGKK----------
TRUA_HALSA       -GAFRVITVRAGGFCRELVRRVVSLVQLVTETGDTDRIDTVLGDEPVAGP----------
TRUA_PYRAE       RGDLIFIYFAGRGFRNKMIRKMAWALLAAGRGVLSVDDLADLLKKPRPGA----------
                           .  :    :*                                        

TRUA_CAMJE       -------NHFLAPPNGLYLSRICY------------------------------------
TRUA_WOLSU       -------FCEGAPPYGLYLCKVSFESSIWEVRDRNH------------------------
TRUA_HELPJ       -------IRTPIMANGLYLHRVYY------------------------------------
TRUA_HELHP       -------YTYPISPNGLYLCEVGYR-----------------------------------
TRUA_UREPA       -------SIKLAPACGLYLYKVYY------------------------------------
TRUA_MYCPE       -------AVIKVPGCGLYLYRTIY------------------------------------
TRUA_MYCPN       -------CKVKAPACGLYLKTVLYE-----------------------------------
TRUA_BIFLO       -------SSGPIAPQGLTLEHIAYPADDQLAARAEAIRAVRTL-----------------
TRUA_TROWT       -------KIPTLPPHALTLIGIDYPQEHLFECQNRKTRQKRT------------------
TRUA_CORGL       -------MVPVAPAKGLSLVGVDYPSADKLQERALETRAVREFPDASASLKLDDE-----
TRUA_CHLTE       -------KLKPADAAGLFLWKVRY------------------------------------
TRUA_BACTN       -------AGTSAPGNALFLVNVEYPEDIFSEETKKSVLSTLLPEGGEC------------
TRUA2_BACCR      -------INCLAEASGLYLENVEF------------------------------------
TRUA1_CLOTE      -------ASLILPAKGLCLKDIQY------------------------------------
TRUA2_CLOPE      -------AGICVPPTGLCLEKVFY------------------------------------
TRUA_BUCAP       -------AGPTVSARGLYLFFVKYPMCFNLPIFKDDFII---------------------
TRUA_ECOLI       -------AAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD------------------
TRUA_WIGBR       -------SIFSADPKGLYLSNVYYPFYFNIPKFNFKLKNFLKIF----------------
TRUA_BORBU       -------ARTTAPANALFLERVYYE-----------------------------------
TRUA_TREPA       SYGTSVTPNTYSVQNRNTLARELASTGNARWKTY--------------------------
TRUA_DEIRA       -------AGANVPPGGLYFAGAEYGVRRVEGRSGNGGEPGTHRGR---------------
TRUA_RHOPA       -------CGPVAPPEGLYLMQVDY------------------------------------
TRUA_CHLTR       -------GPPSAPPYGLSLHHVCYPPPYQWFCKHEHNNSSEGK-----------------
TRUA_GEOSL       -------AGPTAPPQGLCLQKVRF------------------------------------
TRUA_RHOBA       -------AGPTAPPQGLFLCRVDYPDEVFQVEEPDVIE----------------------
TRUA_GLOVI       -------VKYAAPPQGLCLVGVGYPDDPFKTNGIGFARCHTGQEKPEARLGNGDLESREE
TRUA_SYNPX       -------VREAAPGHGLCLLRAGYEQEIFTRA--GWYDCQPWFFLAESDP-PPDPPPLPE
TRUA_LACPL       -------ARGTAPAAGLYMKKVYYEQNELQADLIKY------------------------
TRUA_STRA5       -------AGPTAAGNGLYLKEIIYEDEECFSNFRK-------------------------
TRUA_STAES       -------VPLTAPPDGLYLEKIYLSPEELIQEYGKDIKIHYKKSLEKH------------
TRUA_THEMA       -------AAGTAPAHGLYFYKVLF------------------------------------
TRUA_AQUAE       -------SPYTAPPQGLHLEKVLL------------------------------------
TRUA_METMA       -PAYGLTLMGVNYGEEINWIEDNYSIRRASDQNSKRILRYRVMAEVLEELIYHE------
TRUA_ARCFU       -PPYGLILKDVKY-DDVEFEIDDYAFKTLQSRIEDRIIYHGTIFKLFSLFRQSGIS----
TRUA_METJA       -TFPPEGLILVEAKVDIEYIYDNYSIRKFKEYWGEFFKLQVMKIGIAKTVLEFTK-----
TRUA_METMP       -PSPAEGLILVDVKTNIDIDLDSYVIRNLKNSWEKSLNNSLMRLGLCKTVLSKT------
TRUA_THEVO       ---PENLILKDIVYKDLSFKPLNNGLKRQRLMMEKSLISYIVLKNVLG------------
TRUA_THEAC       ---AQNLLLWDIYYDGIEFRKVKKIPKKMQGVYENSIMNYILAENLMHRFGIA-------
TRUA_PICTO       ---PEPLILYDIIYDNISFIKYRFNNRYIKNKYNSLFIESIIYRVFLRSIDV--------
TRUA_PYRHO       -APAEGLLLVEVKYKGIEFPIHDKALEKFRKDMEKRFREKIARAYLLWDMTKI-------
TRUA_FUSNN       -------KKNLVEAEGLYLNKIEY------------------------------------
TRUA_METTH       --PENLILMDLKYGVKIKLRHDEYAFKRFISLLEEEFKVYREMSMVRRAMSDHLRDLQEH
TRUA_ONYPE       -------ATLLAPSKALVLKKIFY------------------------------------
TRUA_METKA       ------KKPRCLPAEGLILWHIEYDEVRFERTKAWFEDHKVIQLGGRLLLRLPEGAESC-
TRUA_MYCMS       -------TPFIIDAKGLVLQKIQFNKN---------------------------------
TRUA_HALSA       ------DGVPPADPHPLVLHAVAYDGLSFTVDEDAAERARTTFRAARADHHERARVAGHL
TRUA_PYRAE       --------VPSAPAEGLVLLDIVYDVKFEVDFSALRKAYVYFLSKSRHLSAHAAALRAAG
                                                                             

TRUA_CAMJE       ----------
TRUA_WOLSU       ----------
TRUA_HELPJ       ----------
TRUA_HELHP       ----------
TRUA_UREPA       ----------
TRUA_MYCPE       ----------
TRUA_MYCPN       ----------
TRUA_BIFLO       ----------
TRUA_TROWT       ----------
TRUA_CORGL       ----------
TRUA_CHLTE       ----------
TRUA_BACTN       ----------
TRUA2_BACCR      ----------
TRUA1_CLOTE      ----------
TRUA2_CLOPE      ----------
TRUA_BUCAP       ----------
TRUA_ECOLI       ----------
TRUA_WIGBR       ----------
TRUA_BORBU       ----------
TRUA_TREPA       ----------
TRUA_DEIRA       ----------
TRUA_RHOPA       ----------
TRUA_CHLTR       ----------
TRUA_GEOSL       ----------
TRUA_RHOBA       ----------
TRUA_GLOVI       RPPHEMSPLH
TRUA_SYNPX       ASGSEL----
TRUA_LACPL       ----------
TRUA_STRA5       ----------
TRUA_STAES       ----------
TRUA_THEMA       ----------
TRUA_AQUAE       ----------
TRUA_METMA       ----------
TRUA_ARCFU       ----------
TRUA_METJA       ----------
TRUA_METMP       ----------
TRUA_THEVO       ----------
TRUA_THEAC       ----------
TRUA_PICTO       ----------
TRUA_PYRHO       ----------
TRUA_FUSNN       ----------
TRUA_METTH       ELD-------
TRUA_ONYPE       ----------
TRUA_METKA       ----------
TRUA_MYCMS       ----------
TRUA_HALSA       ASI-------
TRUA_PYRAE       EALAMWES--