CLUSTAL format seed alignment for MF_00172

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

METE_RHOPA      MSSHTVSTSLAVATLGTPRIGPRRELKSALESFWAGKST---EADLLKVAAALRAANWAR
METE_RHOPT      MSSHTVSTSLAVATLGTPRIGPRRELKSALESFWAGKST---EADLLKVAAALRAANWAR
METE_NITWN      -----------MATLGTPRIGPRRELKTALESYWSGKSD---ESALLEAAAGLRAANWAR
METE_BRADU      ----MSPLSLPVATLGTPRIGPRRELKLALESYWAGKIS---EQQLHEDAFGLRAANWAR
METE_RHILO      -----------MATLGVPRIGRRRELKFALESYWSGKSP---AADLLATAKALRAASWRE
METE_CAUVC      -------MTVTIATLGFPRIGPKRELKFALEAYWAGKTD---ADALLDTARDLRAKTWTR
METE_CHESB      ------MSQIPVATLGVPRIGRRRELKFALEAYWGGESS---EGELLAAAAKIRAENWSL
METE_ACICJ      --------MSIATSLGFPRIGRRRELKSALEAHWAGELS---EAGLQEAARLLRAESHSL
METE_XYLF2      --------MTIVTNLGFPRIGARRELKRALESHWRGETD---ATQLQHTARELRARHWRL
METE_XYLFT      --------MTIVTNLGFPRIGARRELKRALESHWRGETD---ATQLQHTARELRARHWRL
METE_XYLFM      --------MTIVTNLGFPRIGARRELKRALESHWRGETD---ATQLQHTARELRARHWRL
METE_XYLFA      --------MTIVTNLSFPRIGARRELKRALESHWRGETD---ATQLQHTARELRARHWQL
METE_CYTH3      ---------MIAHNLGYPRIGDNRELKKACEQYWSGAIT---QQKLQDVAKAIRTNNWLT
METE_FLAJ1      ---------MKTNNLGYPRIGSNRELKKASELYWAGKIS---ADELLDAGKEIRLKNWYL
METE_PARL1      --------MTLTSTLGYPRVGPHRELKAALETYWR-DGE---EAPLLDTAKSLRRASWRL
METE_SALRD      --------MATASNLGYPRIGAHRELKRAVEGYWKGDLT---KDELRDSAQALRESHWAT
METE_DESVH      ---------MRTHNLGFPRIGAGRELKKAVEGYWKGRVS---RHALEGEAARLRACHWAM
METE_DESVM      ---------MRTHTLGFPRIGGNRELKKAVEDYWKGAAT---RQQLEDAARAIRLRNWTL
METE_SYNC1      ---------MLTHTLGFPRMGAHRELKKNLESYWKGAIG---QEKLMASGRELRLRHWRL
METE_ECODH      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECOLI      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECO57      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECO5E      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_SHIDS      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_SHIB3      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_SHIBS      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECOL5      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ESCF3      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECOSE      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_SHISS      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_ECOLC      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_ECO24      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_SHIFL      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_SHIF8      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_ECO8A      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_ECOHS      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLTVGRELRARHWDQ
METE_ECOLU      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECOUT      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECO45      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECOK1      -------MTIINHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECOL6      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_ECOSM      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWEQ
METE_ECO7I      -------MTILNHTLGFPRVGLRRELKKAQESYWAGNST---REELLAVGRELRARHWDQ
METE_SALA4      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALNS      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALPA      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALPK      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALCH      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALPB      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALSV      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALEP      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALG2      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNST---REALLAVGRELRARHWEQ
METE_SALHS      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNTT---REALLAVGRELRARHWEQ
METE_SALTY      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNTT---REALLAVGRELRARHWEQ
METE_SALDC      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNTT---REALLTVGRELRARHWEQ
METE_SALTI      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNTT---REALLAVGRELRARHWEQ
METE_SALAR      -------MTILTHTLGFPRVGLRRELKKAQESYWAGNAT---REELLAVGRELRARHWQQ
METE_ENT38      -------MTVINHTLGFPRVGLRRELKKAQESYWAGQST---REDLLAVGRELRARHWDQ
METE_CITK8      -------MTIRNHTLGFPRVGLRRELKKAQESYWAGNAT---REDLLATGRELRARHWDQ
METE_KLEP3      -------MTIINHTLGFPRVGLRRELKKAQESYWAGNAT---REELLTVGRELRARHWEQ
METE_KLEP7      -------MTIINHTLGFPRVGLRRELKKAQESYWAGNAT---REELLAVGRELRARHWEQ
METE_CROS8      -------MTIHNHTLGFPRVGLRRELKKAQESYWAGKST---REELLAVGRELRARHWEQ
METE_PECAS      -------MAIVNHTLGFPRVGLRRELKKAQESYWAGNAT---QEELLTVGRELRARHWQQ
METE_ERWT9      -------MTILNHTLGFPRVGLQRELKKAQESYWAGNST---QEELLTVGRELRARHWQQ
METE_YERPA      -------MTILNHTLGFPRVGLKRELKKAQESYWAGNST---QEELLNVGRELRARHWQQ
METE_YERPN      -------MTILNHTLGFPRVGLKRELKKAQESYWAGNST---QEELLNVGRELRARHWQQ
METE_YERPE      -------MTILNHTLGFPRVGLKRELKKAQESYWAGNST---QEELLNVGRELRARHWQQ
METE_YERPP      -------MTILNHTLGFPRVGLKRELKKAQESYWAGNST---QEELLNVGRELRARHWQQ
METE_YERPS      -------MTILNHTLGFPRVGLKRELKKAQESYWAGNST---QEELLNVGRELRARHWQQ
METE_YERP3      -------MTILNHTLGFPRVGLKRELKKAQESYWAGNST---QEELLNVGRELRARHWQQ
METE_YERE8      -------MTILNHTLGFPRVGLKRELKKAQESYWAGNST---QEELLNVGRELRARHWQQ
METE_SERP5      -------MAILNHTLGFPRVGLRRELKKAQESYWAGNST---QEELLAVGRELRARHWQQ
METE_PHOLL      -------MTTINHTLGFPRIGLKRELKKAQENYWAGKIS---QQELLETGRELRARHWEQ
METE_PROMH      -------MTIRNHTLGFPRIGLNRELKKAQESYWAGNIS---QAELLAVGKELRARHWQQ
METE_SODGM      -------MAILSHTLGFPRVGLHRELKKAQESYWAGNIS---QQQLLETGRELRARHWQQ
METE_BAUCH      -------MTILSHILGFPRIGLHRELKRAQESYWDGHIT---QQQLLNTGRELRACHWQQ
METE_BLOFL      -------MPVLSHILGFPRIGLYRELKHALEQYWEKKIT---ENKLLDIGRMLRMRHWKQ
METE_BLOPB      -------MTIVGHILGFPRIGLHRELKYALEYYWDGKIK---EDKLLEIGRTLRIRHWKQ
METE_BUCAI      -------MTILNHTLGFPRIGLNRELKKAQEQYWSGELM---IKDLLLVGSELRKKNWQK
METE_BUCAP      -------MTIFNHTLGFPRIGLNRELKKAQEDYWSGNLL---YEDFLCVGSQLRRENWKK
METE_BUCBP      --------MINNHTLGFPRIGLFRELKVAQEKYWSRKIS---KEELFSVGKTLRVRHWQQ
METE_BUCCC      -------MAIKNHILGFPRIGLNRELKFALEKYWSKKNT---LEELLLIGKNIRKENWKN
METE_VIBHA      -------MTTTTHILGYPRIGEKRELKFAQEKYWRGEIE---QTELKQVGATLREKNWAT
METE_VIBC1      -------MATTTHILGYPRIGEKRELKFALEKYWRGEID---QAELKQLGAGLREKNWNT
METE_VIBPA      -------MATTTHILGYPRIGEKRELKFAQEKYWRGDID---QTELKKVGADLRAKNWQT
METE_VIBVU      -------MTTTTHILGYPRIGEKRELKFAQEKYWRGEID---QAELKKVGAELRHKNWQT
METE_VIBVY      -------MTTTTHILGYPRIGEKRELKFAQEKYWRGEID---QAELKKVGAELRYKNWQT
METE_VIBCH      --------MTTTHILGYPRIGEKRELKFALEKYWRGEID---QAALKQVGSQIRQKNWAL
METE_ALIF1      -MTTESKTKTVTHILGYPRVGAQRELKFAQEKYWRGEIE---QKELLAVGSELRQRHWKD
METE_ALIFM      -MTTESKTKTVTHILGYPRVGAQRELKFAQEKYWRGEIE---QKELLAVGSELRQRHWKD
METE_PHOPR      -MTITTENKTVTHILGYPRVGSQRELKFAQEKYWRGEIE---QNELKEVGSLLRHRHWGD
METE_AERS4      --------MTRAHTLGFPRIGAKRELKFALESYWRGETT---QAELIATGKSLRERHWQA
METE_SHEON      ---------MQLNSLGFPRIGRRRELKFALEKYWRGEST---QAELHEVARELRRTHWQW
METE_BORBR      --------MTIIHNLGFPRIGAQRELKRAVEAYWAGRQT---AEALHETGRALRAAHWQR
METE_BORPA      --------MTIIHNLGFPRIGAQRELKRAVEAYWAGRQT---AEALHETGRALRAAHWQR
METE_BORPE      --------MTIIHNLGFPRIGAQRELKRAVEAYWAGRQT---AEALHETGRALRAAHWQR
METE_BORPD      --------MTITHNLGFPRIGAQRELKRAVEAYWSGKKT---AADLEETGRELRAAHWQR
METE_BORA1      --------MTITHNLGFPRIGAQRELKRAVEAYWAGKQT---ADELLATGRALRAAHWRR
METE_ALCBS      --------MTTLHNLGFPRIGARRELKQAQEAYWAGDLQ---QSELEHVGKSLRERHWAL
METE_ALKEH      --------MSTTHVLGYPRIGARRELKRATEAYWKGEID---QAELERTGRELRARHWQA
METE_CHRSD      --------MALAHILGYPRIGANRELKKAVEAYWKGDID---QAELERRGQALRAEHWQA
METE_PSEAE      --------MALAHTLGFPRIGRDRELKKAQEAFWKGELD---EAGLRAVGRQLRAAHWQV
METE_PSEAB      --------MALAHTLGFPRIGRDRELKKAQEAFWKGELD---EAGLRAVGRQLRAAHWQV
METE_PSEA8      --------MALAHTLGFPRIGRDRELKKAQEAFWKGELD---EAGLRAVGRQLRAAHWQV
METE_PSEE4      --------MALAHNLGFPRIGRDRELKKAQEAYWKGELD---EAGLCAVGRGLRAAHWQA
METE_PSEPW      --------MALAHNLGFPRIGRDRELKKAQEAFWKGELD---EAGLRKVGRDLRAAHWQA
METE_PSEF5      --------MALAHSLGFPRIGRDRELKKAQEAFWKGELD---EAGLRAVGRDLRKTHWEL
METE_PSEMY      --------MALSHSLGFPRIGRDRELKKALEAHWKGELD---EAGLRAVGQRLRAEHWQL
METE_PSEA7      --------MALAHTLGFPRIGRDRELKKALEAYWKGELD---QPGLLQVGRELRRQHWQL
METE_STUS1      --------MAVAHNLGFPRIGADRELKKALEAYWKGELD---EQGLRQVGRQLRARHWQA
METE_PSESM      --------MALAHNLGFPRIGADRELKKALEAYWKGDLD---QTGLRAVGQQLRAAHWQV
METE_ACIF2      --------MTSVHSLGFPRIGHKRELKKALESFWSREID---EQELQSRAAQLRDRHWRI
METE_ACIF5      --------MTSVHSLGFPRIGHKRELKKALESFWSREID---EQELQSRAAQLRDRHWRI
METE_ACTPJ      --------MTTLHILGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWLH
METE_ACTP7      --------MTTLHILGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWLH
METE_ACTP2      --------MTTLHILGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWLH
METE_HAEIE      --------MTTSHILGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWKH
METE_HAEIG      --------MTTSHILGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWKH
METE_HAEIN      --------MTTSHILGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWKH
METE_HAES1      --------MTTFHVLGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWKH
METE_HISS2      --------MTTFHVLGFPRVGAKRELKFAQERYWRKELA---EQDLLDLAKALREKNWKH
METE_PASMU      --------MTTFHVAGFPRVGAKRELKFAQERYWRGEIA---EQDLLEIAQKLREINWKH
METE_NEIMA      --------MTTLHFSGFPRVGAFRELKFAQEKYWRKEIS---EQELLAVAKDLREKNWKH
METE_NEIMF      --------MTTLHFSGFPRVGAFRELKFAQEKYWRKEIS---EQELLAVAKDLREKNWKH
METE_NEIMB      --------MTTLHFSGFPRVGAFRELKFAQEKYWRKEIS---EQELLAVAKDLREKNWKH
METE_NEIM0      --------MTTLHFSGFPRVGAFRELKFAQEKYWRKEIS---EQELLAVAKDLREKNWKH
METE_NEIG1      --------MTTLHFSGFPRVGAFRELKFAQEKYWRKEIS---EQELLDVAKDLREKNWKH
METE_CHRVO      -------MSHATHLLGFPRIGAKRELKTLLERYWKQELD---EAALSQGAKELRQKHWLL
METE_BURMA      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURM9      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURM7      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURMS      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURP1      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURPS      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURP0      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURP6      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAEHWRI
METE_BURTA      --------MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRALRAAHWQT
METE_RALPJ      --------MTTIHTLGYPRIGAQRELKFALESFWKGASS---EDDLRATGSALRARHWAA
METE_RALSO      --------MTTIHTLGYPRIGAQRELKFALESFWKGAST---EADLRDTGRALRERHWNA
METE_PARPJ      --------MARTHIPGFPRIGAQRELKFAQESFWRGESD---EQYLLGVARELRARHWQL
METE_PARXL      --------MARTHIPGFPRIGAQRELKFAQESFWRGESG---EPHLRGVARELRARHWQL
METE_CUPNE      --------MARTHILGFPRIGERRELKFAQEAFWRGDRT---EAELRDVAAQLRRRHWQL
METE_CUPNH      --------MARTHILGFPRIGERRELKFAQEAFWRGDRT---EAELRDVAAQLRRRHWQL
METE_METCA      --------MAVTHSLGFPRIGAGRELKRAVEACWAGRTG---PAELAQTGRELRERHWMI
METE_NITEU      -------MRTLTHNLGFPRIGAQRELKKALETYWKGQND---VDQLLATARAIRTGNWLL
METE_BURCM      --------MVTTHNLGFPRIGAQRELKFGLERYWKGESS---RDALKALGAELRARHWNA
METE_BURA4      --------MVTTHNLGFPRIGAQRELKFGLERYWKGESS---RDELKALGAELRERHWND
METE_BURO1      --------MVTTHNLGFPRIGAKRELKFGLERYWKGESS---RDELKALGAELRRRHWHD
METE_BURCH      --------MVTTHNLGFPRIGAKRELKFGLERYWKGESS---RDELKALGAELRRRHWHD
METE_BURO0      --------MVTTHNLGFPRIGAKRELKFGLERYWKGESS---RDELKALGAELRRRHWHD
METE_BURCJ      --------MVTTHNLGFPRIGAKRELKFGLERYWKGESS---RDELKALGAELRRRHWHD
METE_BURL3      --------MVTTHNLGFPRIGAKRELKFGLERYWKGESS---RGALKALGAELRQRHWND
METE_BURVG      --------MVKTHNLGFPRIGAQRELKFGLERYWNGDAT---RDELTALGAALRRRHWSD
METE_PARP8      --------MVTTHNLGFPRIGAHRELKFALEKYWKGESS---RAELKAVGAQLRARHWQD
METE_THIDA      --------MALTHNLGFPRIGARRELKFALESYWKGESS---RDALEAVGADLRRRHWQD
METE_HAHCH      --------MITTHNLGFPRIGAKRELKFAQEDYWKGRIS---QEELLNVGAELRQRHWRN
METE_MARN8      --------MATTHNLGFPRIGGQRELKFALEDYWGGRQT---EQELAITAADLRLRHWQQ
METE_RUTMC      --------MVTIHNLGFPRIGRHRELKFALEKYWSNAIS---QDELLQTASTLCKQYWQN
METE_PSYIN      --------MAKLHHLGFPRIGNKRQLKFALEKFWGGELS---EQQLQTSAADLRQQNWLD
METE_SACD2      --------MTTVHNLGFPRIGAKRELKFACEAYWRGEID---QTQLDKTAHTLRANHWQT
METE_COXBU      --------MVYAHNLGFPRIGIKREMKKTVEAYWRGEIS---QQQLQQQAIELQLTNWKI
METE_COXBN      --------MVYAHNLGFPRIGIKREMKKTVEAYWRGEIS---QQQLQQQAIELQLTNWKI
METE_COXB1      --------MVYAHNLGFPRIGIKREMKKTVEAYWRGEIS---QQQLQQQAIELQLTNWKI
METE_COXBR      --------MVYAHNLGFPRIGIKREMKKTVEAYWRGEIS---QQQLQQQAIELQLTNWKI
METE_COXB2      --------MVYAHNLGFPRIGIKREMKKTVEAYWRGEIS---QQQLQQQAIELQLTNWKI
METE_NITOC      --------MIVAHNLGFPRIGGQRELKWALESYWKEQLG---QQELIQVTRELRALHWKQ
METE_BIFLO      -------MSTLTSVSGFPRIGQNRELKKIIEGYWKGAND---LAAVKATAAELRAKHWKL
METE_BIFLD      -------MSTLTSVSGFPRIGQNRELKKIIEGYWKGAND---LAAVKATAAELRAKHWKL
METE_BIFAA      -------MSALTSVSGFPRIGQNRELKKIIEAYWKGNTT---LDEVRATAKELRAKHWKL
METE_CAMJE      ---------MKNSIISYPRIGANRELKFAIEKYFKNQSS---KEELLKSAKDLRIRHWQE
METE_CAMJR      ---------MKNSIISYPRIGANRELKFAIEKYFKNQSS---KEELLKSAKDLRIRHWQE
METE_CAMJJ      ---------MKNSIISYPRIGANRELKFAIEKYFKNQSS---KEELLKSAKDLRIRHWQE
METE_CAMJ8      ---------MKNSIISYPRIGANRELKFAIEKYFKNQSS---KEELLKSAKDLRIRHWQE
METE_CAMJD      ---------MKNSIISYPRIGANRELKFAIEKYFKAQSS---KEELLETAKNLRARHWKD
METE_STRGC      ---------MSTTIIGFPRLGEFRELKFTTEKYFRKEIS---ADELLAAAKELRAKHWNI
METE_STRSV      ---------MSTTIIGFPRLGEFRELKFTTEKYFRHEIS---AEELLAAAKELRAKHWNI
METE_STRPN      ---------MSTTIIGFPRLGEFRELKFTTEKYFRKEIS---EEELLAAAKDLRAKHWNI
METE_STRP4      ---------MSTTIIGFPRLGEFRELKFTTEKYFRKEIS---EEELLAAAKDLRAKHWNI
METE_STRR6      ---------MSTTIIGFPRLGEFRELKFTTEKYFRKEIS---EEELLAAAKDLRAKHWNI
METE_STRP2      ---------MSTTIIGFPRLGEFRELKFTTEKYFRKEIS---EEELLAAAKDLRAKHWNI
METE_STRPI      ---------MSTTIVGFPRLGEFRELKFTTEKYFRKEIS---EEELLAAAKDLRAKHWNI
METE_STRTD      ---------MSTTIIGFPRLGEFRELKFTTEKYFRNEIT---ADELLAAAKDLRAKHWNI
METE_STRSY      ---------MTTTIIGFPRIGEHRELKFITEKYFRNEIP---QEELLEAAKDLRAKHWNI
METE_LACLM      ---------MKKSIIAFPRIGSNRELKFALEKYFRKEIS---EDELQIVAKELRLESWKS
METE_LACLS      ---------MKKSIIAFPRIGSNRELKFALEKYFRKEIS---EAELQIVAKELRLESWKS
METE_LACLA      -------MTMKKSIIAFPRIGSNRELKFALEKYFRKEIT---EEELQTVAKEIRLENWKS
METE_DESRM      -----MYTGATTYVVGFPRIGEQRELKKVLERYWDQKTS---FSEIDEIAKNLRRRHWLY
METE_CORGL      -----MTSNFSSTVAGLPRIGAKRELKFALEGYWNGSIE---GRELAQTARQLVNTASDS
METE_CORGB      -----MTSNFSSTVAGLPRIGAKRELKFALEGYWNGSIE---GRELAQTARQLVNTASDS
METE_COREF      -----MTSFFSSTIAGVPRIGAHRELKFALEGFWSGTVS---GRELGQTATTLTNDYCDQ
METE_MYCA1      ----MTPQAFTATVVGSPRIGPKRELKRATEGYWAGRTG---RAELEKVAATLRRDTWAG
METE_MYCPA      ----MTPQAFTATVVGSPRIGPKRELKRATEGYWAGRTG---RAELEKVAATLRRDTWAG
METE_MYCLE      MDELVTTQSFTATVTGSPRIGPRRELKRATEGYWAKRTS---RSELESVASTLRRDMWSD
METE_MYCBO      MTQPVRRQPFTATITGSPRIGPRRELKRATEGYWAGRTS---RSELEAVAATLRRDTWSA
METE_MYCBP      MTQPVRRQPFTATITGSPRIGPRRELKRATEGYWAGRTS---RSELEAVAATLRRDTWSA
METE_MYCTU      MTQPVRRQPFTATITGSPRIGPRRELKRATEGYWAGRTS---RSELEAVAATLRRDTWSA
METE_MYCTA      MTQPVRRQPFTATITGSPRIGPRRELKRATEGYWAGRTS---RSELEAVAATLRRDTWSA
METE_RHOJR      -----MTFSFTATVLGSPRIGPNRELKKAVESYWAGRLD---AEGLDALARDLRRRTWTS
METE_STRAW      MTAKSAAAAARATVYGYPRQGRGRELKKAIEGYWKGRLD---ADALRTTATGLRRDTWQQ
METE_STRCO      MTAKSAAAAARATVYGYPRQGPNRELKKAIEGYWKGRVS---APELRSLAADLRAANWRR
METE_STRGG      MTAKPAAAAARATVYGYPRQGPHRELKKAIEGYWKGRVD---ADALRETAAELRRGTWQQ
METE_HERA2      -------MNFQTTVVGYPRVGVGRPYKQALERFWSGKLD---ETGFRAAINELCHDRLAT
METE_SYNJB      -------MTAQTMTLGYARMGKRRELKKALEGFWSGALG---SEALLATFWDLETQAWQT
METE_THEVB      -------MTIQTATLGYPRIGKNRELKKALEAFWSNQLD---AEALLKTAQDIELQNWQK
METE_TRIEI      -------MSISTSTLGYPRIGKNREVKKALESFWQQKIS---ADELLKIVREIEEASWQT
METE_BACVZ      ------MTTIKTSNLGFPRIGLNREWKKTLEAYWKGNTD---KETFLKELDGLFLSAVKT
METE_BACSU      ------MTTIKTSNLGFPRIGLNREWKKALEAYWKGSTD---KDTFLKQIDELFLSAVKT
METE_BACLD      ------MTNVKTSSLGFPRIGLNREWKKSLEAYWKGNTD---RETFLKEMDEQFLAALQT
METE_BACP2      ------MTIVKTSNLGFPRIGLNREWKKALESYWKGQTD---RETLLSTLDEQFLTAIKT
METE_BACAN      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKIN---EEQFLTTMKEIRLQHVKV
METE_BACC0      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKIN---EEQFLTTMKEIRLQHVKV
METE_BACHK      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKIN---EEQFLTTMKEIRLQHVKV
METE_BACAH      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKIN---EEQFLTTMKEIRLQHVKV
METE_BACCZ      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKIN---EEQFLTTMKEIRLQHVKV
METE_BACC7      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKID---EEQFLTTMKEIRLKHVKA
METE_BACC1      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKID---EEQFLTTMKEIRLQHVKA
METE_BACC2      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKID---EEQFLTTMKEIRLQHVKV
METE_BACCR      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKID---EEQFLTTMKEIRLQHVKV
METE_BACC4      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKID---EEQFLTTMKEIRLQHVKV
METE_BACMK      -------MAIQTSNLGYPRIGLQREWKKTLEAFWSNKID---EEQFLTTMKEIRLQHVKV
METE_BACCN      -------MALHTSNLGYPRIGLQREWKKTLEAFWAQKID---EQQLITTMKEIHLEHLNV
METE_HALH5      ---------MLTSNLGYPRIGENREWKKALESFWANDTT---EEQLLATMKELRLNHLRV
METE_LISMO      ------MVKAISSNLGYPRLGEKREWKRALEKFWNGAIS---EEELLAETKALRLHALKK
METE_LISMF      ------MVKAISSNLGYPRLGEKREWKRALEKFWNGTIS---EKELLAETKILRLHALKK
METE_LISIN      ------MVKAISSNLGYPRLGEKREWKRALEKFWNGAIS---EEELLAETKALRLHALKK
METE_LISW6      ------MVKAISSNLGYPRLGEKREWKRALEKFWNGTIT---EEELLAETKALRLHALKK
METE_LACPL      -------MTIINSNLGYPRLGEHREWKHLLEHFWKGQLD---NVTFHATAKKLRLANLKK
METE_STAAC      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAA8      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAE      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAT      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAA3      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAR      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAW      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAS      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAA1      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAN      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAM      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAA2      ------MTTIKTSNLGFPRLGRTREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAA9      ------MTTIKTSNLGFPRLGRTREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAAB      ------MTTIKTSNLGFPRLGRKREWKKAIESYWAKKIS---KEELDQTLTDLHKENLLL
METE_STAES      ------MTTIKTSNLGFPRLGRKREWKKAIENYWAHKID---KAELDQTLTDLHKENLLL
METE_STAEQ      ------MTTIKTSNLGFPRLGRKREWKKAIENYWAHKID---KAELDQTLTDLHKENLLL
METE_STAHJ      ------MTTITTSNLGFPRLGRKREWKKAIESYWAKKID---KAELDQKISDLHRENLLL
METE_STRA3      --------MVKVSNLGYPRLGEQREWKQAIEAFWAGNLE---QKDLEKQLKQLRINHLKK
METE_STRA5      --------MVKVSNLGYPRLGEQREWKQAIEAFWAGNLE---QKDLEKQLKQLRINHLKK
METE_STRA1      --------MVKVSNLGYPRLGEQREWKQAIEAFWAGNLE---QKDLEKQLKQLRINHLKK
METE_STRMU      --------MTKVSSLGYPRLGENREWKKLIEAYWAGKVS---KNDLFAGAKELRLDFLKK
METE_THEMA      ---------MKAYAFGFPKIGEKREFKKALEDFWKGKIT---EEQFEEEMNKLRMYMVEN
METE_THESQ      ---------MKAYAFGFPKIGEKREFKKALEDFWKGKIT---EEQFEEEMNKLRMYMVEN
METE_THEP1      ---------MKVYAFGFPKIGEKREFKKALEDFWKGKIT---ENQFKEEMSELRMYMVEN
METE_AQUAE      --------MVKTYAFGFPKLGEKREFKRLLENYWKGKIS---QEELIKGMEELNLWRANL
METE_THEYD      -------MKIKTTVFGYPRIGPKRELKKALEDYWNWKIS---KVELLETANSLIIQNAKV
                               . .: *  *  *   *  :           .              

METE_RHOPA      QSARGVSVIPSNDFSLYDQVLDTSVMVGAIPEIYGWRGGPV-------SLATYFAMARGT
METE_RHOPT      QSARGVSVIPSNDFSLYDQVLDTSVMVGAIPEIYGWRGGPV-------SLATYFAMARGT
METE_NITWN      QKSLGVTVIPSNDFTFYDHVLDTSVMVGAIPDIYGWKSGPV-------PLATYFAMARGA
METE_BRADU      QKSLGVTIIPSNDFSLYDQVLDTSVMVGAIPEIYAANGESV-------SLQTYFAMARGS
METE_RHILO      QHDRGVSKIPSNDFSLYDHVLDTVAMVGAVPARYTWTDGEV-------PLDTYFAMARGN
METE_CAUVC      QAALGVAHVPSNDFSLYDHVLDTAVMVGAIPAAYGWSGGTV-------DLATYFAMARGD
METE_CHESB      QKAAGASIIPSNDFTLYDHVLDMAVTLGAIPEIYGWAGGAV-------PLDTYFAMARGS
METE_ACICJ      QQGLGIGHIPSNDFALYDHVLDTACMVGAIPPGYGWRGGEV-------TLPTYFALARGT
METE_XYLF2      QRDAGVDLPPSNDFSLYDHVLDTAFLFDAIPQRYRGLVDAD-------PLAGYFAMARGR
METE_XYLFT      QRDAGVDLPPSNDFSLYDHVLDTAFLFDAIPQRYRGLVDAD-------PLAGYFAMARGR
METE_XYLFM      QRDAGVDLPPSNDFSLYDHVLDTAFLFDAIPQRYHGLVDAD-------PLAGYFAMARGR
METE_XYLFA      QRDTGVDLPPSNDFSLYDHVLDTAFLFDAIPQRYRALADAD-------PLAGYFAMARGR
METE_CYTH3      QKDAGLDLIPCNDFSFYDQVLDMSFMLGLIPERFSSLLQKKD----LTELDIYFAMARGY
METE_FLAJ1      QSEAGVDLIPSNDFSFYDQVLDLTLAVGAIPQRYHELAKSN------SSLDLYFAMARGS
METE_PARL1      QKEHGIGHIPSNDFTLYDHVLDTICMTGAVPERFA-AGAEI-------DLATYFAMARGA
METE_SALRD      QQELGLDVVPSNDFSYYDQVLDACAMVGAVPERFPWDGTEV-------DLDTYFAMARGL
METE_DESVH      QRDAGIDVVPVGDFALYDHMLDLTLMLGAIPPRFSPSGAAASPAGTGQDIDLMFRMARGE
METE_DESVM      QREAGIDVVPVGDFALYDHILDAALLLGVIPPRFRND-------DAPRDIDLMFRMARGQ
METE_SYNC1      QQQAGIDLVPVGDFSYYDHMLDMVAMLGAVPPRFGWQ-------GESVDLDTYFYMARGS
METE_ECODH      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_ECOLI      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_ECO57      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_ECO5E      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_SHIDS      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_SHIB3      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_SHIBS      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_ECOL5      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_ESCF3      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRIGRGR
METE_ECOSE      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_SHISS      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_ECOLC      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_ECO24      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_SHIFL      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_SHIF8      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_ECO8A      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_ECOHS      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_ECOLU      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_ECOUT      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPQRHQNNDGS-------VDIDTLFRIGRGR
METE_ECO45      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPQRHQNNDGS-------VDIDTLFRIGRGR
METE_ECOK1      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPQRHQNNDGS-------VDIDTLFRIGRGR
METE_ECOL6      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPPRHQNKDGS-------VDIDTLFRIGRGR
METE_ECOSM      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_ECO7I      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALA4      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALNS      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVSARHQNNDGS-------VDIDTLFRIGRGR
METE_SALPA      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALPK      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALCH      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------MDIDTLFRIGRGR
METE_SALPB      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALSV      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALEP      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALG2      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALHS      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALTY      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALDC      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALTI      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_SALAR      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNNDGS-------VDIDTLFRIGRGR
METE_ENT38      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------VDIDTLFRLGRGR
METE_CITK8      QKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNSDGS-------VDIDTLFRIGRGR
METE_KLEP3      QKQAGVDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------IDIDTLFRIGRGR
METE_KLEP7      QKQAGVDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGS-------IDIDTLFRIGRGR
METE_CROS8      QKAAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNADGT-------VDIDTLFRIGRGR
METE_PECAS      QKDAGVDLLPVGDFAWYDHVLTTSLLLGNVPARHQNEDGS-------VDLDTLFRIGRGR
METE_ERWT9      QKDAGVNLLPVGDFAWYDHVLTTSLMLGNVPARHQNKDGS-------VDLDTLFRLGRGR
METE_YERPA      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGS-------IDIDTLFRIGRGR
METE_YERPN      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGS-------IDIDTLFRIGRGR
METE_YERPE      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGS-------IDIDTLFRIGRGR
METE_YERPP      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGS-------IDIDTLFRIGRGR
METE_YERPS      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGS-------IDIDTLFRIGRGR
METE_YERP3      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGS-------IDIDTLFRIGRGR
METE_YERE8      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGS-------IDLDTLFRIGRGR
METE_SERP5      QQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPARHQNADGT-------IDLDTLFRLGRGR
METE_PHOLL      QKQAGVDLVPVGDFAWYDHVLTTSLLLGNVPPRHQNPDGT-------IDLDTLFRIARGR
METE_PROMH      QANAGVELLPVGDFAWYDQVLGTSLLLGNIPPRHRNEDGR-------LDLDTLFRVARGR
METE_SODGM      QKDAGVDLLPVGDFAWYDHVLTTSLMLDNVPARHRSGANE-------SDIDTLFRIGRGR
METE_BAUCH      QKQAGLNMLPVGDFAWYDHVLTTSLMLDNVPVRHRNDDGS-------SNIDTLYRIGRGN
METE_BLOFL      QINSGINLIPIGDFSWYDHVLDMSIMLNNIPTRFHILSQKK------NTLNMLFSIARGD
METE_BLOPB      QKDSGIDWISVGDFAWYDHVLTTSLMLNNIPDRHRIG-QEN------INLNTLFRISRGY
METE_BUCAI      QKESGIDYIPVGDFAWYDHVLTTSMMLGNIPERHNNTVDS-------IDLDCLFRIARGC
METE_BUCAP      QKDAGIDYIPVGDFAWYDHVLSTSMMLGNIPERHLNVNDNK------IDLDCLFRIARGC
METE_BUCBP      QKELGINYIPVGDFSWYDHVLGTSMLLGNIPKRHKNGNDL-------VTLDTLFRVARGV
METE_BUCCC      QIDSGMDYVTVGDFAWYDHVLNISMMINNIPERHNPNNHI-------LNIDTLFKVARGS
METE_VIBHA      QAEAGLSFATAGDFAWYDHVLTTTLLLGHTPKRHANGFPD---------LDTLFKVGRGQ
METE_VIBC1      QTEAGLSFATAGDFAWYDHVLTTTLLLGHTPKRHANGFPD---------LDTLFKVGRGQ
METE_VIBPA      QTEAGLSFTTAGDFAWYDHVLTTTLLLGHVPKRHAGGFPN---------LDTLFKVGRGQ
METE_VIBVU      QASAGLSFAVAGDFAWYDHVLTTTLLLGHVPKRHRHGFPD---------LDTLFRVGRGQ
METE_VIBVY      QASAGLSFAVAGDFAWYDHVLTTTLLLGHVPKRHRHGFPD---------LDTLFRVGRGQ
METE_VIBCH      QKEAGLDFVTAGDFAWYDHVLTTTLLLGHVPKRHSHGFPD---------LDTLFRVGRGQ
METE_ALIF1      QSASGLDFVTAGDFAWYDHVLTTSLLLGHVPARHNNGFPD---------LDTLFKVGRGQ
METE_ALIFM      QSASGLDFVTAGDFAWYDHVLTTSLLLGHVPARHNNGFPD---------LDTLFKVGRGQ
METE_PHOPR      QVGAGLDYVSVGDFAWYDHVLNTSMLLGHIPKRHDNGFPD---------LDTLFRIARGK
METE_AERS4      QRTAGVNLLPVGDFAWYDQVLGTSLLVDAVPARHRHGDTD---------LDTLFRVARGR
METE_SHEON      QVAAGIEQVPVGDFAFYDQVLTLSATLNAIPDRHRGEGAI--------DLDTLFRVARGR
METE_BORBR      QADAGVAFVPVGDFAWYDHILEWTTLLGAVPARFGHPEGKP------VDLDTLFRMGRGR
METE_BORPA      QADAGVAFVPVGDFAWYDHILEWTTLLGAVPARFGHPEGKP------VDLDTLFRMGRGR
METE_BORPE      QADAGVAFVPVGDFAWYDHILEWTTLLGAVPARFGHPEGKP------VDLDTLFRMGRGR
METE_BORPD      QAASGLQWVPVGDFAWYDHILEWTTLLGAVPARFGQPEGQP------VSLDTLFRMGRGR
METE_BORA1      QADSGLRFVPVGDFAWYDHILEWTTLLGAVPARFAQPETQA------VSLDTLFRMGRGR
METE_ALCBS      QADAGVDLMPVGDFAWYDHILEFSSLLGVVPSRFEQDANAP------VNLDTLFRMARGR
METE_ALKEH      QRDAGLDWVTVGDFAFYDHVLNVSALLGAVPPRFG-DAGET------VDLDTTFRMARGR
METE_CHRSD      SRDAGLDFVTVGDFAFYDQVLNVSAMLGAVPPRFG-AIDGD------VDLDTTFRMARGR
METE_PSEAE      QKDAGIQLLPVGDFAWYDQVLTHSLTFGVIPERFRAHGEAG------PTLHTLFGMARGV
METE_PSEAB      QKDAGIQLLPVGDFAWYDQVLTHSLTFGVIPERFRAHGEAG------PTLHTLFGMARGV
METE_PSEA8      QKDAGIQLLPVGDFAWYDQVLTHSLTFGVIPERFRAHGEAG------PTLHTLFGMARGV
METE_PSEE4      QKAAGIELLPVGDFAWYDQVLTHSLTFGVIPERFRAKDGAK------PTLQTLFAMARGV
METE_PSEPW      QKDAGIELLPVGDFAWYDQVLTHSLTFGVIPERFRGHDGAK------PTLQTLFAMARGV
METE_PSEF5      QKNAGIDLLPVGDFAWYDQVLTHSLMFGVIPRRFRPQHGP-------ATLQTLFGMARGV
METE_PSEMY      QKDAGIDLLPVGDFAWYDQVLAHSLAFDVIPERFRPAAGK-------PTLDTLFAMARGA
METE_PSEA7      QKDAGIELLPVGDFAWYDQVLAHSLAFGVIPERFRPADGQ-------PTLDTLFAMARGV
METE_STUS1      QLDAGIELLPVGDFAWYDQVLSHSLMFGVIPQRFRPAEGQ-------ATLDTLFAMARGV
METE_PSESM      QKEAGIELLPVGDFAWYDQVLTHSLTLGVIPERFSPAQDAAGL----PTLDTLFAMARGA
METE_ACIF2      QQTCGMDLVPVGDFSLYDHMLDMSCTLGAIPPRYGFAGGQ-------VGLDTFFAMARGS
METE_ACIF5      QQTCGMDLVPVGDFSLYDHMLDMSCTLGAIPPRYGFAGGQ-------VGLDTFFAMARGS
METE_ACTPJ      QAQADADFVTVGDFTFYDHILDLQVATGAIPARFGFDSQT-------LSLDQYFQLARGN
METE_ACTP7      QAQADADFVTVGDFTFYDHILDLQVATGAIPARFGFDSQT-------LSLDQYFQLARGN
METE_ACTP2      QAQADADFVTVGDFTFYDHILDLQVATGAIPARFGFDSQT-------LSLDQYFQLARGN
METE_HAEIE      QAAANADFVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LTLDQYFQLARGN
METE_HAEIG      QAAANADFVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LTLDQYFQLARGN
METE_HAEIN      QAAANADFVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LTLDQYFQLARGN
METE_HAES1      QADANADFVAVGDFTFYDHILDLQVATGAIPARFGFDSKN-------LTLDQYFQLARGN
METE_HISS2      QADANADFMAVGDFTFYDHILDLQVATGAIPARFGFDSKN-------LTLDQYFQLARGN
METE_PASMU      QAAANADFVAVADFTFYDHILDLQVATGAIPARFGFDSQN-------LSLNEYFQLARGN
METE_NEIMA      QAAANADYVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LSLEQFFQLARGN
METE_NEIMF      QAAANADFVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LSLEQFFQLARGN
METE_NEIMB      QVAANADFVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LSLEQFFQLARGN
METE_NEIM0      QAAANADYVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LSLEQFFQLARGN
METE_NEIG1      QAAANADYVAVGDFTFYDHILDLQVATGAIPARFGFDSQN-------LPLEQFFQLARGN
METE_CHRVO      QKGAGVELSPVGDFSLYDHVLDAQLLVGAAPARFGFDAAA-------LTTGQYFELARGN
METE_BURMA      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_BURM9      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_BURM7      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_BURMS      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_BURP1      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_BURPS      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_BURP0      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_BURP6      ERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDAHA-------LTLADYFAAARGN
METE_BURTA      QRDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARA-------LTLADYFAAARGN
METE_RALPJ      QRDAGLDFVTVGDFAWYDQVQQTAALLGAVPTRYGFDPAQ-------LTLAQSFVLARGN
METE_RALSO      QRDAGLDFVTVGDFAWYDQVLQTAALLGALPTRYGFDPAQ-------LTLAQSFVLARGN
METE_PARPJ      QQDAKLDFVTVGDFAYYDQMLNLSALLGALPQRFGFDAKT-------LSLARYYELARGN
METE_PARXL      QQDAGLDFVTVGDFAYYDQMLNLSALLGALPQRFGFEPKT-------LSLAEYYELARGN
METE_CUPNE      QADRGLDTVATGDFAYYDQMLSLTALLGALPRRFGLDPAR-------LTLTQYFELARGN
METE_CUPNH      QADRGLDTVATGDFAYYDQMLSLTALLGALPRRFGLDPAR-------LTLTQYFELARGN
METE_METCA      QSGSGIDLVPVGDFAWYDQMLNMTALLGAVPRRFGFQADA-------LSLDQYFQLARGN
METE_NITEU      QQKAGIDLIPVGDFSLYDHILDMTTLLGAIPHRFGNTGDK-------ISPDLYFAMARGT
METE_BURCM      QR--DLDLAPIGDFSFYDQVLDMSFTLGNLPKRVQGF-HG-------DVLDNYFRVARGR
METE_BURA4      QR--DLDLAPIGDFSFYDQVLDMSFTLGNLPKRVQGF-HG-------DVLDNYFRVARGR
METE_BURO1      QR--DLDLAPLGDFAFYDQVLDMSFTLGNLPKRVQDF-HG-------DALDNYFRVARGR
METE_BURCH      QR--DLDLAPLGDFAFYDQVLDMSFTLGNLPKRVQDF-HG-------DALDNYFRVARGR
METE_BURO0      QR--DLDLAPIGDFAFYDQVLDMSFTLGNLPKRVQDF-HG-------DALDNYFRVARGR
METE_BURCJ      QR--DLDLAPIGDFAFYDQVLDMSFTLGNLPKRVQDF-HG-------DALDNAFRVARGR
METE_BURL3      QR--DLDLAPVGDFAFYDQVLDMSFTLGNLPKRVQGF-HG-------DALDNYFRVARGR
METE_BURVG      QR--DLDLAPLGDFAFYDHVLDMSFTLGNLPKRVQDF-HG-------DALDNYFRVARGR
METE_PARP8      QA--RLDFSPVGDFAFYDQVLDMSFTLGNLPERVRGF-HG-------DALDNAFRVARGR
METE_THIDA      QA--ALDLVPVGDFAFYDQVLDMSFTLGNLPERVQGF-DG-------HPLDNAFRVARGR
METE_HAHCH      QS--QLDLTPVGDFSFYDQVLDMSFTLGVIPERVSRL-QG-------GELDNYFRVARGR
METE_MARN8      QA--GLDYVPVGDFSLYDQVLDMSVTLGNLPIRAASK-EG-------SELDAYFRAARGR
METE_RUTMC      QN--KLDWVPVGDFSFYDHVLDMSFLLGNIPKRAENL-SD-------NELDNYFRVARGR
METE_PSYIN      QQDLALDLYTVGDFSLYDQVLDMSFLVGNIPSRAKQSEQD-------NSLDNYFRVARGR
METE_SACD2      QLDAGVEWLPVGDFSYYDHVLDTSFLVGNIPVRAQAD-GQ-------SKLDTYFKVARGT
METE_COXBU      QAEAGVDLIPVGDFSWYDHVLDMAVRVGAIPSRFKALNSN-------IT-DTMFCMARGQ
METE_COXBN      QAEAGVDLIPVGDFSWYDHVLDMAVRVGAIPSRFKALNSN-------IT-DTMFCMARGQ
METE_COXB1      QAEAGVDLIPVGDFSWYDHVLDMAVRVGAIPSRFKALNSN-------IT-DTMFCMARGQ
METE_COXBR      QAEAGVDLIPVGDFSWYDHVLDMAVRVGAIPSRFKALNSN-------IT-DTMFCMARGQ
METE_COXB2      QAEAGVDLIPVGDFSWYDHVLDMAVRVGAIPSRFKALNSN-------IT-DTMFCTARGQ
METE_NITOC      QQEAGLDLVPVGDFSWYDQVLDMSALLGVVPPRFGEIQDE-------VDLDTYFCMARGR
METE_BIFLO      QQAAGIDLIPSNDFSYYDQMLDTAILLNVIPQRYARLSFDNQED-------TLFAMARGY
METE_BIFLD      QQAAGIDLIPSNDFSYYDQMLDTAILLNVIPQRYARLSFDNQED-------TLFAMARGY
METE_BIFAA      QQAAGIDLIPSNDFSYYDQMLDTAILLNVIPQRYQRLAFENPEE-------TLFAMGRGY
METE_CAMJE      IQKAGIDFIPSNDFSLYDNVLDAAVLFNIVHTKYKNLNLDALD--------EYFAQSRGY
METE_CAMJR      IQKAGIDFIPSNDFSLYDNVLDAAVLFNIVHTKYKNLNLDALD--------EYFAQSRGY
METE_CAMJJ      IQKAGIDFIPSNDFSLYDNVLDAAVLFNIVHTKYKNLNLDALD--------EYFAQSRGY
METE_CAMJ8      IQKAGIDFIPSNDFSLYDNVLDAAVLFNIVHTKYKNLNLDALD--------EYFAQSRGY
METE_CAMJD      IQNAGIDFIPSNDFSLYDNVLDTAVLFNIVHTKYKNLNLDALD--------EYFAQSRGY
METE_STRGC      VKEKGISEIPSNDFSHYDNVLDAAFLFNVVPSSVRGLELTDLE--------RYFALARGY
METE_STRSV      VKEKGISEIPSNDFSHYDNVLDAAFLFNVVPSSVQGLELTDLE--------RYFALARGY
METE_STRPN      VKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLE--------RYFALGRGY
METE_STRP4      VKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLE--------RYFALGRGY
METE_STRR6      VKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLE--------RYFALGRGY
METE_STRP2      VKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLE--------RYFALGRGY
METE_STRPI      VKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLE--------RYFALGRGY
METE_STRTD      VKEKGITEIPSNDFSHYDNFLDAAFLFNVVPESVKNLDLTELE--------QYFALARGY
METE_STRSY      VKEAGITEIPSNDFSHYDNVLDAAVLFNIIPKAVQDLELTDLE--------KYFALARGY
METE_LACLM      QKEAGIDYPISNDFSFYDQTLDLSIALGVIPERYKKLKLNELD--------TLFALARGF
METE_LACLS      QKEAGIDYPISNDFSFYDQTLDLSIALGVIPERYKKLKLNELD--------TLFALARGF
METE_LACLA      QKEAGIDSPISNDFSFYDQTLDLSIALGAIPGSYKNLELSELD--------TLFALARGF
METE_DESRM      QKEAGISFISSNDFSLYDNMLDTAIMLNAVPERFSNIHD-KQE--------LYFAMARGT
METE_CORGL      LS--GLDSVPFAGRSYYDAMLDTAAILGVLPERFDDIADHE-NDGLPLWIDRYFGAARGT
METE_CORGB      LS--GLDSVPFAGRSYYDAMLDTAAILGVLPERFDDIADHE-NDGLPLWIDRYFGAARGT
METE_COREF      LAAAGLDSIPTAGRSYYDAMLDTTALLGVFPERFQNLDDHP-NDGLPAHIDRYFATARGT
METE_MYCA1      LAAAGLDSVPVNTFSYYDQMLDTAVMLDALPER---------ARQVSDDLDRYFAAARGN
METE_MYCPA      LAAAGLDSVPVNTFSYYDQMLDTAVMLDALPER---------ARQVSDDLDRYFAAARGN
METE_MYCLE      LAAAGLDSVPVNTFSYYDQMLDTAFMLGALPAR---------VAQVSDDLDQYFALARGN
METE_MYCBO      LAAAGLDSVPVNTFSYYDQMLDTAVLLGALPPR---------VSPVSDGLDRYFAAARGT
METE_MYCBP      LAAAGLDSVPVNTFSYYDQMLDTAVLLGALPPR---------VSPVSDGLDRYFAAARGT
METE_MYCTU      LAAAGLDSVPVNTFSYYDQMLDTAVLLGALPPR---------VSPVSDGLDRYFAAARGT
METE_MYCTA      LAAAGLDSVPVNTFSYYDQMLDTAVLLGALPPR---------VSPVSDGLDRYFAAARGT
METE_RHOJR      LRDAGLDSVPVNTFSYYDHVLDTAAMLGALPDR---------VAGIESDLDRYFAAARGN
METE_STRAW      LAEAGIHEVPTGDFSYYDHVLDTSVMVGAIPARHR-------AAVEADALDGYFAMARGT
METE_STRCO      LADAGIDEVPAGDFSYYDHVLDTTVMVGAIPERHR-------AAVAADALDGYFAMARGT
METE_STRGG      LAEAGVHEVPTGDFSYYDHVLDTSVMVGAVPERHR-------ASVEADALDGYFAMARGT
METE_HERA2      QAQ-RLDLVPVGDFSLYDHVLDTALMLGAVPARFGKVDAH--------NLQGYFALARGR
METE_SYNJB      QLQAGIDHIAVGDQTLYDHVLDWATWLGLIPSRFRGLSGL----------DRYFAMARGR
METE_THEVB      QLEVGIDRIGIGDLSLYDSVLDWSIRFGIIPERYRSFTGL----------EQYFAMARGK
METE_TRIEI      QTKAGIERIGIGDATLYDQILDWSFRFGIIPKRFQQFQNL----------ECYFAMARGK
METE_BACVZ      QLDQHIDIVPVSDFTHYDHVLDTAVSFNWIPKRFRSI---------TDPVDTYFAIARGV
METE_BACSU      QIDQQIDVVPVSDFTQYDHVLDTAVSFNWIPKRFRHL---------TDATDTYFAIARGI
METE_BACLD      QLDQQIDIIPVSDFTMYDHVLDTAVMFNWIPDRFKDI---------NDPLDTYFAMARGT
METE_BACP2      QIDQQIDVVPSGDFTFYDHVLDTAVMFNWIPERFRSL---------KDPLDTYFAIARGT
METE_BACAN      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACC0      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACHK      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACAH      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACCZ      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACC7      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACC1      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACC2      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACCR      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACC4      QQEKGIELIPIGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACMK      QQEKGIELIPVGDFTYYDHVLDTAYMLGFIPSRFSEF---------TSYLDVYFAMARGS
METE_BACCN      QKEKGIDFIPIGDFTYYDHVLDTAYMLGFIPSRFSNF---------TSYLDIYFAMARGS
METE_HALH5      QQEQEVDLIPVGDFTLYDHVLDMAVMFGIIPKRFLQQGD-------TPTLSTYFAMARGS
METE_LISMO      QQEKGIDLIPVGDFSFYDQVLDTSVTFGIIPKRFQHDGG-------KVSLNTYFDIARGK
METE_LISMF      QQDKGIDLIPVGDFSFYDQVLDTSVTFGIIPKRFQHDGG-------KVSLNTYFDIARGK
METE_LISIN      QQDKGIDLIPVGDFSFYDQVLDTSVTFGIIPKRFQHDGG-------KVSLNTYFDIARGK
METE_LISW6      QQEKGIDLIPVGDFSFYDQVLDTSVTFGIIPKRFQHEGG-------NVSLNTYFDIARGK
METE_LACPL      QRDLGVDYIPVADNSDYDHVLDTLVAFNAIPSRFGHFDH-------QLDLPDYYAIARGT
METE_STAAC      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAA8      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAE      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAT      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAA3      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAR      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAW      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAS      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAA1      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAN      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAM      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAA2      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAA9      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAAB      QKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------TIDDDLLFDIARGN
METE_STAES      QKNYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------EVNDDLLFDIARGN
METE_STAEQ      QKNYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGR---------EVNDDLLFDIARGN
METE_STAHJ      QKHYNLDSVPVGDFSLYDHILDTSLLFNIIPERFQGR---------EVNDDLLFDIARGN
METE_STRA3      QKEAGIDLIPVGDFSCYDHVLDLSFQFNVIPKRFDEY---------ERNLDLYFAIARGD
METE_STRA5      QKEAGIDLIPVGDFSCYDHVLDLSFQFNVIPKRFDEY---------ERNLDLYFAIARGD
METE_STRA1      QKEAGIDLIPVGDFSCYDHVLDLSFQFNIIPKRFDEY---------ERNLDLYFAIARGD
METE_STRMU      QLNAGLDLIPVGDFSLYDHILDLSVQFNIIPKRFAKE---------PIDIDLYFAIARGN
METE_THEMA      YRKN-VDVIPSNELSYYDFVLDTAVMVGAVPERFGEYRG----------LSTYFDMARGG
METE_THESQ      YRKN-VDVIPSNELSYYDFVLDTAVMVGAVPERFGEYRG----------LSTYFDMARGG
METE_THEP1      YRTN-VDVVPSNELSYYDFVLDTAIMVGAIPERFGKYEG----------LSTYFEMARGR
METE_AQUAE      YREN-VEIIPSNELSYYDFMLDTTVMVGAIPSRFGEYRG----------LDTYFEMARGK
METE_THEYD      IQSSGVDLIPSNEFSLYDFILDHSVMFNAVPKRFNRISDP---------LDRYFAMARGT
                              : **         .                         :  .** 

METE_RHOPA      QAEIAGHGCANGHHHGDSTPQGVPAQEMTKWFDTNYHYMVPEFSAGQ---SFQLASVKPL
METE_RHOPT      QAEIAGHGCANGHHHGDSTPQGVPAQEMTKWFDTNYHYMVPEFSAGQ---SFQLASLKPL
METE_NITWN      QGGNDDAACAHGHQ-GDGHAHGAPAQEMTKWFDTNYHYMVPEFTSGQ---RFQLSSLKAI
METE_BRADU      QCGEQDASCAQSPR-----GSGVPAQEMTKWFDTNYHYMVPEFYRGQ---AFRLCSRKPV
METE_RHILO      Q--DQAADCGHAGDEHAANGHGLAAMEMTKWFDTNYHYIVPELTDDQ---SFALSSAKPV
METE_CAUVC      QGRPAAEACGPGCG-HAPGADGVPALEMTKWFDTNYHYLAPELSPGQ---AFALTSSKPV
METE_CHESB      Q---EREACGHSHH----DGTGVPALEMTKWFDTNYHYMVPEFDADQ---TFRLASLKPV
METE_ACICJ      G----------GGD----AAAGLPALEMTKWFDTNYHYLVPRLAAGQ---HFAVTANRPL
METE_XYLF2      Q----------------ADNIDLHALEMTKWFDTNYHYLVPELHRDQ---HFALRGNKPI
METE_XYLFT      Q----------------ADNIDLHALEMTKWFDTNYHYLVPELHRDQ---HFALRGNKPI
METE_XYLFM      Q----------------ADNIDLHALEMTKWFDTNYHYLVPELHRDQ---HFALRGNKPI
METE_XYLFA      Q----------------ADGIDLHALEMTKWFDTNYHYLVPELHRDQ---HFALRGNKPI
METE_CYTH3      QKDGYD----------------ITAMEMTKWFDTNYHYIVPEFRKDQ---KFSPISEKAI
METE_FLAJ1      QKNGQD----------------VVAMEMTKWFDTNYHYIVPEFTKNQ---KFELFSEKIL
METE_PARL1      QDGTRD----------------VAAMEMTKWFDTNYHYIVPEFSPET---NFRLAFTKAI
METE_SALRD      QEKDLEG-----------EESGVQAMEMTKWFDTNYHYIVPEFSHDT---TFSLSSTKVI
METE_DESVH      A-----------------GLSPVAPLEMTKWFDTNYHYLVPELDADT---AFAPDASPLV
METE_DESVM      G-----------------GDRPVAPLEMTKWFDTNYHYLVPELDAAT---TFAPDAAPLL
METE_SYNC1      S-----------------GHRTTTAMEMTKWFDTNYHYIVPEFYPGQ---RFRLARNRLF
METE_ECODH      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOLI      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECO57      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECO5E      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_SHIDS      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_SHIB3      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_SHIBS      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOL5      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ESCF3      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOSE      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_SHISS      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOLC      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECO24      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_SHIFL      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_SHIF8      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECO8A      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOHS      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOLU      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOUT      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECO45      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOK1      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOL6      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECOSM      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_ECO7I      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_SALA4      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALNS      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALPA      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALPK      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALCH      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALPB      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALSV      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALEP      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALG2      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALHS      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALTY      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALDC      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALTI      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFSKGQ---QFRLTWTQLL
METE_SALAR      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFSKGQ---QFRLTWTQLL
METE_ENT38      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_CITK8      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_KLEP3      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLTWTQLL
METE_KLEP7      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVKGQ---QFKLSWTQLL
METE_CROS8      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFTKGQ---QFSLTWTQLL
METE_PECAS      APT-----GQPA-----------AAAEMTKWFNTNYHYMVPEFTKGQ---QFKLTWTQLL
METE_ERWT9      APS-----GEPA-----------AAAEMTKWFNTNYHYMVPEFVQGQ---QFKLTWTQLL
METE_YERPA      APT-----GKPA-----------AAAEMTKWFNTNYHYMVPEFQQGQ---QFKLGWTQLL
METE_YERPN      APT-----GKPA-----------AAAEMTKWFNTNYHYMVPEFQQGQ---QFKLGWTQLL
METE_YERPE      APT-----GKPA-----------AAAEMTKWFNTNYHYMVPEFQQGQ---QFKLGWTQLL
METE_YERPP      APT-----GKPA-----------AAAEMTKWFNTNYHYMVPEFQQGQ---QFKLGWTQLL
METE_YERPS      APT-----GKPA-----------AAAEMTKWFNTNYHYMVPEFQQGQ---QFKLGWTQLL
METE_YERP3      APT-----GKPA-----------AAAEMTKWFNTNYHYMVPEFQQGQ---QFKLGWTQLL
METE_YERE8      APT-----GTPA-----------AAAEMTKWFNTNYHYMVPEFQQGQ---QFKLGWTQLL
METE_SERP5      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFHKGQ---QFKLGWSQLL
METE_PHOLL      APT-----GEPA-----------AAAEMTKWFNTNYHYIVPEFQQGQ---EFKLSWTQLL
METE_PROMH      APT-----GKPA-----------AASEMTKWFNTNYHYIVPEFQQGQ---SFTLAWQQLL
METE_SODGM      APT-----GEPA-----------AAAEMTKWFNTNYHYMVPEFTLGQ---QFRLGWTQLL
METE_BAUCH      APT-----GQPV-----------VASEMTKWFNTNYHYIVPEFTVGQ---QFRLGWTQLI
METE_BLOFL      S-IN----NTTI-----------TPSEMKKWFNTNYHYIVPEFVQNQ---IFKLNCTQLL
METE_BLOPB      S-LD----KKLI-----------PPSEMKKWFNTNYHYIVPEFVPNQ---EFKLNWTQLF
METE_BUCAI      --------PPDI-----------SASEMTKWFNTNYHYIVPEFYKNK---VLKYSWKQIL
METE_BUCAP      --------SPDV-----------AASEMTKWFNTNYHYIVPEFNKNR---ILKFSWKQIL
METE_BUCBP      APTG----ASV------------SASEMTKWFNTNYHYIVPEFSIKS---EFCFSWRQIL
METE_BUCCC      KGVD----NNIC-----------SASEMTKWFNTNYHYIVPEFTSNQ---KFYFAWKQIL
METE_VIBHA      SQA-----GCGC-S-------GAAASDMTKWFNTNYHYIVPEFSKDD---SFEVSWPQLF
METE_VIBC1      SQS-----GCGS-A-------GAAASDMTKWFNTNYHYIVPEFSKDD---AFEVSWPQLF
METE_VIBPA      SQA-----GCGC-A-------GAAASDMTKWFNTNYHYIVPEFSKDD---TFEVSWPQLF
METE_VIBVU      SQS-----SCAC-H-------GAAASDMTKWFNTNYHYIVPEFSKED---TFEVSWPQLF
METE_VIBVY      SQS-----SCAC-H-------GAAASDMTKWFNTNYHYIVPEFSKED---TFEVSWPQLF
METE_VIBCH      SQN-----ACGCGT-------GSAASDMTKWFNTNYHYIVPEFSSND---TFNVSWPQLF
METE_ALIF1      SQN-----SCGC---------GEAASDMTKWFNTNYHYIVPEFSKND---KFNVSWSQLF
METE_ALIFM      SQN-----SCGC---------GEAASDMTKWFNTNYHYIVPEFSKND---KFNVSWSQLF
METE_PHOPR      APT-----GCSC-----------AASDMTKWFNTNYHYIVPEFTEDD---QFNVSWQQLF
METE_AERS4      APT-----GPSA-----------AAAEMTKWFNTNYHYLVPEFSRDQ---RFKLGWSQLF
METE_SHEON      APT-----GTDA-----------PASEMTKYFNTNYHYLVPELKQDQ---VFSIAYEQFF
METE_BORBR      AP-----SGKPAA-----------ACEMTKWFDTNYHYIVPELTPGQ---TFRVAREDLF
METE_BORPA      AP-----SGKPAA-----------ACEMTKWFDTNYHYIVPELTPGQ---TFRVAREDLF
METE_BORPE      AP-----SGKPAA-----------ACEMTKWFDTNYHYIVPELTPGQ---TFRVAREDLF
METE_BORPD      AP-----SGTPTA-----------ACEMTKWFDTNYHYIVPELVPGQ---TFRIAREYLF
METE_BORA1      AP-----SGKPAA-----------ACEMTKWFDTNYHYIVPELVPGQ---TYRIAREDLF
METE_ALCBS      AP-----TGTPAA-----------ACEMTKWFDTNYHYLVPELAADQ---TFRIARESLF
METE_ALKEH      AP-----TGEPAA-----------ACEMTKYFDTNYHYLVPELHADQ---RFGLASRRLF
METE_CHRSD      AP-----SGTPAA-----------ACEMTKYFDTNYHYLVPELHAGQ---RFRVASTRLF
METE_PSEAE      S----DDSCCGGAH----------AQEMTKWFDTNYHYLVPEFSADQ---QFQLSWEQLF
METE_PSEAB      S----DDSCCGGAH----------AQEMTKWFDTNYHYLVPEFSADQ---QFQLSWEQLF
METE_PSEA8      S----DDSCCGGAH----------AQEMTKWFDTNYHYLVPEFSADQ---QFQLSWEQLF
METE_PSEE4      -----SDSCCGGAH----------AQEMTKWFDTNYHYLVPEFTADQ---QFALSWEQLF
METE_PSEPW      ATGR-SANCCGGAH----------AQEMTKWFDTNYHYLVPEFTVDQ---QFALSWEQLF
METE_PSEF5      S-----DGCCGGAH----------AQEMTKWFDTNYHYLVPEFGADQ---QFQLGWEQLF
METE_PSEMY      VANKSGGSCCGGAH----------AQEMTKWFDTNYHYLVPEFSADQ---QFALSWEQLF
METE_PSEA7      A-----QGCCGGAH----------AQEMTKWFDTNYHYLVPEFTVDQ---AFSLSWTQLF
METE_STUS1      A-----RSCCGGAQ----------AQEMTKWFDTNYHYLVPEFSVDQ---QFQLSWTQLF
METE_PSESM      S------NCCGASHG-----KTQHAQELTKWFDTNYHYLVPEFTQDQ---RFQLSWEQLF
METE_ACIF2      ATQP--------------------AMEMTKWFDTNYHFIVPEFHEGM---DFRLSSERLF
METE_ACIF5      ATQP--------------------AMEMTKWFDTNYHFIVPEFHEGM---DFRLSSERLF
METE_ACTPJ      KEQF--------------------AIEMTKWFDTNYHYLVPEFQKNT---TFKANSTHYV
METE_ACTP7      KEQF--------------------AIEMTKWFDTNYHYLVPEFQKNT---TFKANPTHYV
METE_ACTP2      KEQF--------------------AIEMTKWFDTNYHYLVPEFQKNT---TFKANPTHYV
METE_HAEIE      KDQF--------------------AIEMTKWFDTNYHYLVPEFQKST---AFKANPAHYV
METE_HAEIG      KDQF--------------------AIEMTKWFDTNYHYLVPEFQKST---AFKANPAHYV
METE_HAEIN      KDQF--------------------AIEMTKWFDTNYHYLVPEFQKST---AFKANPAHYV
METE_HAES1      KDQF--------------------AIEMTKWFDTNYHYLVPEFHKDT---QFKANPTHYV
METE_HISS2      KDQF--------------------AIEMTKWFDTNYHYLVPEFHKDT---QFKANPTHYV
METE_PASMU      QTQF--------------------AIEMTKWFDTNYHYLVPEFTKNT---EFKANPAHYV
METE_NEIMA      KDQF--------------------AIEMTKWFDTNYHYLVPEFHADT---EFKANAKHYV
METE_NEIMF      KDQF--------------------AIEMTKWFDTNYHYLVPEFHADT---EFKANAKHYV
METE_NEIMB      KDQF--------------------AIEMTKWFDTNYHYLVPEFHADT---EFKANAKHYV
METE_NEIM0      KDQF--------------------AIEMTKWFDTNYHYLVPEFHADT---EFKANAKHYV
METE_NEIG1      KDQF--------------------AIEMTKWFDTNYHYLVPEFHADT---EFKANAKHYV
METE_CHRVO      AVQP--------------------AMEMTKWFDTNYHYLVPEWHADT---AFSAQPERLL
METE_BURMA      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURM9      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURM7      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURMS      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURP1      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURPS      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURP0      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURP6      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_BURTA      AAQP--------------------AMEMTKWFDTNYHYLVPEYSPAT---TFGPGVEWLF
METE_RALPJ      ADHA--------------------AMEMTKWFDTNYHYLVPELTPDLLDRQWGPGTEWLF
METE_RALSO      ADHA--------------------AMEMTKWFDTNYHYLVPELTPDL---RFGPGTGWLF
METE_PARPJ      AAQP--------------------AMEMTKWFDTNYHYLVPELGPQT---TFDGGVEWLF
METE_PARXL      AAQP--------------------AMEMTKWFDTNYHYLVPELGPQT---SFDGGVEWLF
METE_CUPNE      REQP--------------------AMEMTKWFDTNYHYLVPELDAET---TFDGGPAWFF
METE_CUPNH      REQP--------------------AMEMTKWFDTNYHYLVPELDAET---TFDGGPAWFF
METE_METCA      AEQP--------------------AMEMTKWFDTNYHYIVPEFDRET---GFGPGTEWLF
METE_NITEU      ADQP--------------------AMEMTKWFNTNYHYIVPEFDDTT---QFRLASDRLF
METE_BURCM      SAQVVDEH--GACC------GGVSAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSCLL
METE_BURA4      SAQAADEH--ATCC------GGVSAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSCLL
METE_BURO1      SAQSAEEH--AACC------GGVAAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSRLL
METE_BURCH      SAQSAEEH--AACC------GGVAAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSRLL
METE_BURO0      SAQSAEEH--AACC------GGVAAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSRLL
METE_BURCJ      SAQSAEAH--AACC------GGVAAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSRLL
METE_BURL3      SAQSAEEH--AACC------GGVSAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSRLL
METE_BURVG      SAHSAHEH--ASCC------GGVAAGEMTKWFDTNYHYIVPEFHADT---NFSLDPSRLL
METE_PARP8      SAHGADDH--SACC------GGVAAGEMTKWFDTNYHYIVPEFDTNT---QFSLDPSRLL
METE_THIDA      SADIAETHCCSAAC------SGVAAGEMTKWFDTNYHYIVPEFAAST---SFKLDASRLL
METE_HAHCH      SAQ-------DSDC------HCVHAGEMTKWFDTNYHYIVPEFTADT---AFSLNPSRLL
METE_MARN8      GAN-------DSPC------CATAAGEMTKWFDTNYHYIVPELTADT---HFELNPERLL
METE_RUTMC      AFIN------ESER------TCIQAGEMTKWFDTNYHYIVPEFSQET---NFALQAQRLI
METE_PSYIN      SQPQECCAASHGQS------GESQAGEMTKWFNTNYHYIVPEFDAQT---TFLLNAKQLL
METE_SACD2      AKEAAG----ASCC------GGSHAAEMTKWFDTNYHYLVPELNANT---HFKLNASKLL
METE_COXBU      APNG----------------IETSACEMTKWFDTNYHYIVPEFTTNQ---SFELHHDDLF
METE_COXBN      APNG----------------IETSACEMTKWFDTNYHYIVPEFTTNQ---SFELHHDDLF
METE_COXB1      APNG----------------IETSACEMTKWFDTNYHYIVPEFTTNQ---SFELHHDDLF
METE_COXBR      APNG----------------IETSACEMTKWFDTNYHYIVPEFTTNQ---SFELHHDDLF
METE_COXB2      APNG----------------IETSACEMTKWFDTNYHYIVPEFTTNQ---SFELHHDDLF
METE_NITOC      APGK----------------KEVAACEMTKWFNTNYHYIVPEFQPQQ---AFRLASSTLF
METE_BIFLO      QGDK----------------GDVTALPMKKWFTTNYHYLVPEVESAA---EIKLNSTKPF
METE_BIFLD      QGDK----------------GDVTALPMKKWFTTNYHYLVPEVESAA---EIKLNSTKPF
METE_BIFAA      QGEK----------------GDVTALPMKKWFTTNYHYLVPEIDSAT---DIKLNSTKPF
METE_CAMJE      QGEN----------------GDVTALAMKKWFNTNYHYLVPECDNAD---IIALTGDKIF
METE_CAMJR      QGEN----------------GDVTALAMKKWFNTNYHYLVPECDNAD---IIALTGDKIF
METE_CAMJJ      QGEN----------------GDVTALAMKKWFNTNYHYLVPECDNAD---IIALTGDKIF
METE_CAMJ8      QGEN----------------GDVTALAMKKWFNTNYHYLVPECDNAD---IIALTGDKIF
METE_CAMJD      QGEN----------------GDVTALAMKKWFNTNYHYLVPECDDAS---IIALTGDKIF
METE_STRGC      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKET---QVKLAGHKIF
METE_STRSV      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKET---QVKLAGHKIF
METE_STRPN      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKDT---QVKLAGHKIF
METE_STRP4      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKDT---QVKLAGHKIF
METE_STRR6      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKDT---QVKLAGHKIF
METE_STRP2      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKDT---QVKLAGHKIF
METE_STRPI      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKDT---QVKLAGHKIF
METE_STRTD      QGEK----------------GDVRALPMKKWFNTNYHYIVPKFEKTT---AVKLAGHKIF
METE_STRSY      QGEK----------------GDVRARPMKKWFNTNYHYIVPAIEKDT---EIKLAGHKIF
METE_LACLM      QDEE----------------NDVKARPMKKWFNTNYHYIVPEISKET---VIKANFSKLL
METE_LACLS      QDEE----------------NDVKARPMKKWFNTNYHYIVPEISKET---VIKANFSKLL
METE_LACLA      QDEQ----------------NDVKARPMKKWFNTNYHYLVPEINKDT---IIKANFSKLL
METE_DESRM      --------------------NNTVAMEMTKWFNTNYHYIVPELSDTM---NFSLCADKII
METE_CORGL      ETLP--------------------AQAMTKWFDTNYHYLVPELSADT---RFVLDASALI
METE_CORGB      ETLP--------------------AQAMTKWFDTNYHYLVPELSADT---RFVLDASALI
METE_COREF      AELP--------------------ASAMTKWFDTNYHYLVPELSADT---RFILDDTALL
METE_MYCA1      SDVA--------------------PLEMTKWFDTNYHYIVPEIAPTT---KFALNPDKVL
METE_MYCPA      SDVA--------------------PLEMTKWFDTNYHYIVPEIAPTT---KFALNPDKVL
METE_MYCLE      NDIK--------------------PLEMTKWFDTNYHYLVPEIEPAT---TFSLNPGKIL
METE_MYCBO      DQIA--------------------PLEMTKWFDTNYHYLVPEIGPST---TFTLHPGKVL
METE_MYCBP      DQIA--------------------PLEMTKWFDTNYHYLVPEIGPST---TFTLHPGKVL
METE_MYCTU      DQIA--------------------PLEMTKWFDTNYHYLVPEIGPST---TFTLHPGKVL
METE_MYCTA      DQIA--------------------PLEMTKWFDTNYHYLVPEIGPST---TFTLHPGKVL
METE_RHOJR      DTVA--------------------PLEMTRWFDTNYHYLVPEISPTT---TFALDPSKVL
METE_STRAW      QDVA--------------------PLEMTKWFDTNYHYLVPELGPDT---VFSTDSAKQV
METE_STRCO      QEVA--------------------PLEMTKWFDTNYHYLVPELGPDT---VFTADSTKQV
METE_STRGG      QDVA--------------------PLEMTKWFDTNYHYLVPELGPDT---VFSADSAKQV
METE_HERA2      DGLP--------------------ALEMTKWFDTNYHYLVPEIPERW-----ELQANLVL
METE_SYNJB      EGLP--------------------ALEMTKWFDTNYHYLVPEIEPEA---DPSPNFGDFL
METE_THEVB      DGIP--------------------ALEMTKWFDTNYHYLVPEISEAF---QPT-DFSDFL
METE_TRIEI      DGIL--------------------ALEMTKWFDTNYHYLVPEITPDI---TPKADFSDFL
METE_BACVZ      KDA--------------------VSSEMTKWFNTNYHYIVPEYDESIEF---RLTRNKQL
METE_BACSU      KDA--------------------VSSEMTKWFNTNYHYIVPEYDESIEF---RLTRNKQL
METE_BACLD      KDA--------------------VSSEMTKWFNTNYHYIVPEYEKGAQY---RVTRNKPL
METE_BACP2      KDA--------------------VSSEMTKWFNTNYHYIVPEYEKSTEF---KLTHNKPL
METE_BACAN      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACC0      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACHK      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACAH      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACCZ      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACC7      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACC1      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACC2      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACCR      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACC4      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACMK      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLQI---SLKDNRPL
METE_BACCN      KDH--------------------VASEMTKWFNTNYHYIVPEYEEGLNI---SLKDNRPL
METE_HALH5      KNA--------------------QACEMTKWYNTNYHYIVPELHDAAP----RLTKNAPL
METE_LISMO      SDA--------------------VASEMTKWFNTNYHYIVPELADADP----KVLDNRAL
METE_LISMF      NDA--------------------VASEMTKWFNTNYHYIVPELADAEP----KVLDNRAL
METE_LISIN      SDA--------------------VASEMTKWFNTNYHYIVPELAEADP----KVLDNRAL
METE_LISW6      NDA--------------------VASEMTKWFNTNYHYIVPELADANP----KLLNNRAL
METE_LACPL      DTA--------------------VAAEMTKWFNINYHYIVPEFDDVSF----KLLDNRWL
METE_STAAC      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAA8      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAE      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAT      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAA3      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAR      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAW      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAS      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAA1      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAN      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAM      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAA2      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAA9      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAAB      KDH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVSRNVLL
METE_STAES      KEH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVEKNTLL
METE_STAEQ      KEH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVEKNTLL
METE_STAHJ      KEH--------------------VASALIKWFNTNYHYIVPEWD-NVEP---KVNHNVLL
METE_STRA3      KDN--------------------VASSMKKWFNTNYHYIVPEWEVETKP---HLQNNYLL
METE_STRA5      KDN--------------------VASSMKKWFNTNYHYIVPEWEVETKP---HLQNNYLL
METE_STRA1      KDN--------------------VASSMKKWFNTNYHYIVPEWEVETKP---HLQNNYLL
METE_STRMU      KEN--------------------VASSMKKWFNTNYHYIVPEWS-KQRP---KLNNNRLL
METE_THEMA      K-----------------------ALEMTKFFNTNYHYLVPEIETEE----FYLLENKPL
METE_THESQ      K-----------------------ALEMTKFFNTNYHYLVPEIETEE----FYLLENKPL
METE_THEP1      K-----------------------ALEMTKYFNTNYHYLVPEIESGN----FELLENIPL
METE_AQUAE      N-----------------------ALELTKWFNTNYHYLVPELEGEN----FKLLINRPL
METE_THEYD      QELP--------------------ALEMTKWFNTNYHYIVPEIEDEE----FELMENKPL
                                        .  : :::  ***::.*                  .

METE_RHOPA      EEYREAKAL-GYDTRPVLLGPVTYLKLGKSADA---------------------------
METE_RHOPT      EEYREAKAL-GYDTRPVLLGPVTYLKLGKSADA---------------------------
METE_NITWN      DEYREAKAL-GYQTRPVLLGPVTYLKLGKSKDA---------------------------
METE_BRADU      EEYEEARAL-GFQTRPVLIGPVTFLKLGKSTDS---------------------------
METE_RHILO      DHFLEAKAL-GIHTRPVLLGPVTFLKLAKSPEE---------------------------
METE_CAUVC      DEFLEAKAL-GVHTRPVLLGPVTFLKLAKTKAE---------------------------
METE_CHESB      EEFDEAKRQ-GIHTRPVLLGPVSFLKLGKRRD----------------------------
METE_ACICJ      ALFREALAR-HRRTRPVLLGPVSFLLLAKTDD----------------------------
METE_XYLF2      AEFEEALAL-GITTRPVLLGPVSFLLLSKTVD----------------------------
METE_XYLFT      AEFEEALAL-GITTRPVLLGPVSFLLLSKTVD----------------------------
METE_XYLFM      AEFEEALAL-GITTRPVLLGPVSFLLLSKTVD----------------------------
METE_XYLFA      AEFEEALAL-GITTRPVLLGPVSFLLLSKTVD----------------------------
METE_CYTH3      REYTEAKVVIGKAAKPVLLGPVSYLLAGKEKEA---------------------------
METE_FLAJ1      NEFKEANAV-GIKTKPVLIGPVSYLLLGKEKEE---------------------------
METE_PARL1      DEFAEAKAL-GVHTRPVLVGPFSFLKLGKATVA---------------------------
METE_SALRD      DEYEEAKAQ-GVDTRPVVIGPVSFLLLGKTQAD---------------------------
METE_DESVH      AQLREAQDA-GFTPKAVLPGPLTWLWLARS-VD---------------------------
METE_DESVM      ALIDEALAA-GFTPKAVLPGPMTFLWLSKR-VD---------------------------
METE_SYNC1      EELAEACIE-GIQAKPVLPGPMTFIALGKEMVA---------------------------
METE_ECODH      DEVDEALAL-GHKVKPVLLGPVTWLWLGKVKG---------------------------E
METE_ECOLI      DEVDEALAL-GHKVKPVLLGPVTWLWLGKVKG---------------------------E
METE_ECO57      DEVDEALAL-GHKVKPVLLGPITWLWLGKVKG---------------------------E
METE_ECO5E      DEVDEALAL-GHKVKPVLLGPITWLWLGKVKG---------------------------E
METE_SHIDS      EEVDEALAL-GHNVKPVLLGPVTWLWLGKVKG---------------------------E
METE_SHIB3      EEVDEALAL-GHNVKPVLLGPVTWLWLGKVKG---------------------------E
METE_SHIBS      EEVDEALAL-GHNVKPVLLGPVTWLWLGKVKG---------------------------E
METE_ECOL5      EEVDEALAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ESCF3      EEVDEALAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECOSE      EEVDEALAL-GHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_SHISS      EEVDEALAL-GHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECOLC      EEVDEALAL-GHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECO24      EEVDEALAL-GHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_SHIFL      EEVDEALAL-SHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_SHIF8      EEVDEALAL-SHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECO8A      EEVDEALAL-GHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECOHS      EEVDEALAL-GHNVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECOLU      EEVDEAQAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECOUT      EEVDEALAL-GHKVKPVLLGPITYLWLGKVKG---------------------------E
METE_ECO45      EEVDEALAL-GHKVKPVLLGPITYLWLGKVKG---------------------------E
METE_ECOK1      EEVDEALAL-GHKVKPVLLGPITYLWLGKVKG---------------------------E
METE_ECOL6      EEVDEALAL-GHKVKPVLLGPITYLWLGKVKG---------------------------E
METE_ECOSM      EEVDEALAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ECO7I      EEVDEALAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALA4      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALNS      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALPA      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALPK      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALCH      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALPB      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALSV      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALEP      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALG2      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALHS      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALTY      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALDC      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALTI      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SALAR      EEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_ENT38      DEVDEALAL-GHNIKPVLLGPVTYLWLGKVKG---------------------------E
METE_CITK8      DEVDEALAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------E
METE_KLEP3      DEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_KLEP7      DEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_CROS8      DEVDEALAL-GHHVKPVLLGPVTYLWLGKVKG---------------------------E
METE_PECAS      DEVDEALAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------E
METE_ERWT9      DEVDEALAL-GHKVKPVLLGPVTYLWLGKVKG---------------------------D
METE_YERPA      DEVDEALAL-GHKIKPVLLGPITYLWLGKVKG---------------------------E
METE_YERPN      DEVDEALAL-GHKIKPVLLGPITYLWLGKVKG---------------------------E
METE_YERPE      DEVDEALAL-GHKIKPVLLGPITYLWLGKVKG---------------------------E
METE_YERPP      DEVDEALAL-GHKIKPVLLGPITYLWLGKVKG---------------------------E
METE_YERPS      DEVDEALAL-GHKIKPVLLGPITYLWLGKVKG---------------------------E
METE_YERP3      DEVDEALAL-GHKIKPVLLGPITYLWLGKVKG---------------------------E
METE_YERE8      DEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_SERP5      DEVDEALAL-GHKIKPVLLGPVTYLWLGKVKG---------------------------E
METE_PHOLL      EEVDEALSL-GHQVKPVLLGPITYLWLGKVKG---------------------------Q
METE_PROMH      DEVDEALAL-GHNVKPVLLGPITYLWLGKVKG---------------------------P
METE_SODGM      DEVDEALAL-GHRVKPVLLGPVSYLWLGKVKG---------------------------E
METE_BAUCH      EEVDEALAL-GYNIKPILLGPISYLWLGKAKE---------------------------K
METE_BLOFL      AEIDEALSL-NHPIKPVLLGPLTYLWIGKTKET--------------------------K
METE_BLOPB      DEIDEALSL-KYTVKPILLGPISYLWLGKIKG---------------------------K
METE_BUCAI      DEVDEALLL-GHKVKPILLGPITYLWLGKVKG---------------------------E
METE_BUCAP      EETDEALLL-GYKVKPIILGPITYLWLGKIKG---------------------------E
METE_BUCBP      DEIDEALLL-GHQVKPVILGPLTYLWLGKVKG---------------------------K
METE_BUCCC      EETDEALSL-GYKVKPVLLGPLTYLWLGKVKN---------------------------S
METE_VIBHA      EEVNDAIKL-GHNVKPVLLGPLSYLYLGKEI---------------------------EE
METE_VIBC1      EEVNEAIKA-GHKVKPVLLGPLSYLYLGKEV---------------------------EE
METE_VIBPA      EEINEAVQA-GHKVKPVLLGPVSYLYLGKEV---------------------------EE
METE_VIBVU      EEVNEAVQA-GHNVKPVLLGPLSYLYLGKEI---------------------------ED
METE_VIBVY      EEVNEAVQA-GHKVKPVLLGPLSYLYLGKEI---------------------------ED
METE_VIBCH      EEVNEALQA-GHDVKPVLLGPISYLYLGKEV---------------------------EE
METE_ALIF1      DEIAEAQKQ-GHNVKPVLLGPLSYLWLGKEVNDEEV----------------------EQ
METE_ALIFM      DEIAEAQKQ-GHNVKPVLLGPLSYLWLGKEVNDEEV----------------------EQ
METE_PHOPR      GEVAEAKKA-GHKVKPVLLGPVSYLWLGKEK---------------------------EE
METE_AERS4      DEVEEAKAL-GLPVKAVLLGPVSYLWLGKEK---------------------------ES
METE_SHEON      DEVAEAQAL-GYKAKPVLLGPVSYLYLAKTVG---------------------------Q
METE_BORBR      EQVKEAQAL-GHRVKPVIPGPLTWLWLGKGDAFAQG----------------------AG
METE_BORPA      EQVKEAQAL-GHRVKPVIPGPLTWLWLGKGDAFAQG----------------------AG
METE_BORPE      EQVKEAQAL-GHRVKPVIPGPLTWLWLGKGDAFAQG----------------------AG
METE_BORPD      EQVQEAQAL-GHQVKPVIPGPLTWLWQGKGDAYAGG----------------------AS
METE_BORA1      EQVREAQAL-GYAVKPVIPGPLTWLYLGKGDAFQQG----------------------AS
METE_ALCBS      EQVEEAKAQ-GHNPKPVIPGPLTYLYLSKGDRF-EG----------------------AE
METE_ALKEH      DEVAEARAA-GHPVKVVLTGPLTWLWLGK-----AK----------------------SP
METE_CHRSD      DEVAEAQAA-GHPVKVALLGPVSWLWLGK-----EK----------------------SA
METE_PSEAE      EEVDEARAL-GHQVKPVLIGPLTYLWLGKAKGAE--------------------------
METE_PSEAB      EEVDEARAL-GHQVKPVLIGPLTYLWLGKAKGAE--------------------------
METE_PSEA8      EEVDEARAL-GHQVKPVLIGPLTYLWLGKGKGAE--------------------------
METE_PSEE4      EEVEEAKAL-GHAVKPVVIGPLTYLWLGKTKGAD--------------------------
METE_PSEPW      EEVDEAKAL-GHAAKPVVIGPLTYLWLGKAKGGD--------------------------
METE_PSEF5      EEVEEARAL-GHAVKPVLIGPLTYLWLGKAKGAE--------------------------
METE_PSEMY      EEVAEAHAL-GHSVKPVLIGPLTYLWLGKEKGSD--------------------------
METE_PSEA7      EEVDEALAL-GHAVKPVLIGPLSYLWLGKAKGGE--------------------------
METE_STUS1      EEVEEAKAL-GHAIKPVLIGPLSYLWLGKLKGEADQ----------------------TQ
METE_PSESM      EEVDEAHAL-GHKVKPVLIGPLTYLWLGKAKGDS--------------------------
METE_ACIF2      DQVKEVQAL-GLKAKPVLVGPITYLWLGKEKDLNAEAHHDAQHHHDDSACHGHGAPIGAA
METE_ACIF5      DQVKEVQAL-GLKAKPVLVGPITYLWLGKEKDLNAEAHHDAQHHHDDSACHGHGAPIGAA
METE_ACTPJ      NQIREAKAA-GHQVKPVIVGPLTFLWLGKEKG---------------------------E
METE_ACTP7      NQIREAKAA-GHQVKPVIVGPLTFLWLGKEKG---------------------------E
METE_ACTP2      NQIREAKAA-GHQVKPVIVGPLTFLWLGKEKG---------------------------E
METE_HAEIE      NQIREAKAL-GLNFKPVIVGPLTFLWLGKEKG---------------------------E
METE_HAEIG      NQIREAKAL-GLNFKPVIVGPLTFLWLGKEKG---------------------------E
METE_HAEIN      NQIREAKAL-GLNFKPVIVGPLTFLWLGKEKG---------------------------E
METE_HAES1      NQIREAKVA-GHQVKPVIVGPLTFLWLGKEKG---------------------------E
METE_HISS2      NQIREAKVA-GHQVKPVIVGPLTFLWLGKEKG---------------------------E
METE_PASMU      QQIREAKAL-GFKFKPTIVGPLTFLWLGKEKG---------------------------E
METE_NEIMA      QQLQEAQAL-GLKAKPTVVGPLTFLWVGKEKGA--------------------------V
METE_NEIMF      QQLQEAQAL-GLKAKPTVVGPLTFLWVGKEKGT--------------------------V
METE_NEIMB      QQLQEAQAL-GLKAKPTVVGPLTFLWVGKEKGA--------------------------V
METE_NEIM0      QQLQEAQAL-GLKAKPTVVGPLTFLWVGKEKGA--------------------------V
METE_NEIG1      QQLQEAQTL-GLKAKPTVVGPLTFLWVGKEKGS--------------------------V
METE_CHRVO      SQLREARAL-GVAAKPVLLGPLSLLWLGKAKG---------------------------R
METE_BURMA      DEVREARAL-GYRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURM9      DEVREARAL-GYRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURM7      DEVREARAL-GYRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURMS      DEVREARAL-GYRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURP1      DEVREARAL-GYRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURPS      DEVREARAL-GYRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURP0      DEVREARAL-GHRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURP6      DEVREARAL-GHRAKAALVGPLTLLWLGKARD---------------------------G
METE_BURTA      DEVREARAL-GHRPKAALVGPLTLLWLGKARD---------------------------G
METE_RALPJ      DEVREAQAL-GHRVKVVLLGPITFLHLAKARH---------------------------G
METE_RALSO      DEVREAQAA-GHRVKVALLGPVTFLHLAKARG---------------------------G
METE_PARPJ      DEIDEALAL-NLPVKPVLIGPITYLWLSKSHV---------------------------A
METE_PARXL      EEIDEALAL-NLPVKPVLIGPITYLWLSKSHV---------------------------A
METE_CUPNE      EEADEALAL-GLRARPVLIGPVTYLWLSKSHV---------------------------A
METE_CUPNH      EEADEALAL-GLRARPVLIGPVTYLWLSKSHV---------------------------A
METE_METCA      DEVEEAKAL-RLNPKPVLIGPLTYLHLGKERQ---------------------------A
METE_NITEU      QEIEDAKAL-GITAKAVLIGPLTYLYLGKEVT---------------------------P
METE_BURCM      QQLAEARAL-GVAGKPVILGPVTYLWLGKEKD---------------------------D
METE_BURA4      QQLAEARAL-GVAGKPVILGPVTYLWLGKAKD---------------------------D
METE_BURO1      QQLAEANAQ-GVNAKPVILGPVTYLWLGKAKD---------------------------V
METE_BURCH      QQLAEANAQ-GVNAKPVILGPVTYLWLGKAKD---------------------------V
METE_BURO0      QQLAEANAQ-GVNAKPVILGPVTYLWLGKAKD---------------------------D
METE_BURCJ      QQLAEANAQ-GVNAKPVILGPVTYLWLGKAKD---------------------------D
METE_BURL3      QQLAEAQAQ-GVAAKPVIVGPVTYLWLGKAKD---------------------------D
METE_BURVG      QQLAEANAQ-RVNAKPVILGPVTYLWLGKAKD---------------------------D
METE_PARP8      EQIKEAHAQ-GVKAKPVIIGPVTYLWLGKAKD---------------------------G
METE_THIDA      AQLAEAQAA-GVRAKPVIIGPVTYLALGKAKD---------------------------G
METE_HAHCH      AEIAEAKQT-GATIKPVIIGPVTYLWLGKSKD---------------------------S
METE_MARN8      TQLSEARKQ-GLNAKPVIIGPVTYLWLGKTSD---------------------------A
METE_RUTMC      AQIRQAQAQ-GVKVKPVVIGPVTYLWLGKSKD---------------------------K
METE_PSYIN      LQIEALQKI-NKNVKPVIIGPVTYLWLGKEKD---------------------------N
METE_SACD2      TELEQARAL-TSKVKPVILGPLSYLWLAKITD---------------------------G
METE_COXBU      KSTKLALEN-NYRAKPVILGPLSFLWLGKCKG---------------------------E
METE_COXBN      KSTKLALEN-NYRAKPVILGPLSFLWLGKCKG---------------------------E
METE_COXB1      KSTKLALEN-NYRAKPVILGPLSFLWLGKCKG---------------------------E
METE_COXBR      KSTKLALEN-NYRAKPVILGPLSFLWLGKCKG---------------------------E
METE_COXB2      KSTKLALEN-NYRAKPVILGPLSFLWLGKCKG---------------------------E
METE_NITOC      NQVAEAQAL-DFPIKPVLLGPLSFLWLGKSKG---------------------------S
METE_BIFLO      DEFNEAKAL-GIDTKPVFIGPYTFLKLARTPEAT-------------------------E
METE_BIFLD      DEFNEAKAL-GIDTKPVFIGPYTFLKLARTPEAT-------------------------E
METE_BIFAA      DEFNEAKAL-GITTKPVLIGPYTFLKLARNPQAE-------------------------E
METE_CAMJE      KEYLEAKEL-GIESKPVLIGIFTLFKLIAFK----------------------------D
METE_CAMJR      KEYLEAKEL-GIESKPVLIGIFTLFKLIAFK----------------------------D
METE_CAMJJ      KEYLEAKEL-GIESKPVLIGIFTLFKLIAFK----------------------------D
METE_CAMJ8      KEYLEAKEL-GIESKPVLIGIFTLFKLIAFK----------------------------D
METE_CAMJD      KEYLEAKEL-GIESKPVLIGIFTLFKLIAFK----------------------------D
METE_STRGC      EEFAEAKEL-GLVTRPVVVGPFTLLQVSDFE----------------------------D
METE_STRSV      DEFAEAKEL-GLVTRPVVVGPFTLLQVSDFE----------------------------D
METE_STRPN      DEFQEAKEL-GLNTRPVLVGPFTFLQLSDFE----------------------------E
METE_STRP4      DEFQEAKEL-GLNTRPVLVGPFTFLQLSDFE----------------------------E
METE_STRR6      DEFQEAKEL-GLNTRPVLVGPFTFLQLSDFE----------------------------E
METE_STRP2      DEFQEAKEL-GLNTRPVLVGPFTFLQLSDFE----------------------------E
METE_STRPI      DEFQEAKEL-GLNTRPVLVGPFTFLQLSDFE----------------------------E
METE_STRTD      DEYQEAKDL-GLDTRPVVVGPFTFLQLSDFE----------------------------D
METE_STRSY      DEFQEAKNL-GITTRPVLIGPFTLLQLTDFE----------------------------E
METE_LACLM      NEYQEAKTA-GFETRPTIIGPYTFLILADYL----------------------------S
METE_LACLS      NEYQEAKTA-GFETRPTIIGPYTFLILADYL----------------------------S
METE_LACLA      NEYKEAKSA-GFETRPTIIGPYTFLVLADYK----------------------------S
METE_DESRM      NEYREAKEY-GLRTKINLIGPITFLSLSKPVD---------------------------G
METE_CORGL      EDLRCQQVR-GVNARPVLVGPLTFLSLARTTDGSN-------------------------
METE_CORGB      EDLRCQQVR-GVNARPVLVGPLTFLSLARTTDGSN-------------------------
METE_COREF      TDIHDQLTR-GHDVRPVLIGPLTYLSLSRTTDGSD-------------------------
METE_MYCA1      SELKEALAQ-GIPARPVVIGPITFLLLSKGVDGAG-------------------------
METE_MYCPA      SELKEALAQ-GIPARPVVIGPITFLLLSKGVDGAG-------------------------
METE_MYCLE      GELKEALEQ-RIPSRPVIIGPVTFLLLSKGINGGG-------------------------
METE_MYCBO      AELKEALGQ-GIPARPVIIGPITFLLLSKAVDGAG-------------------------
METE_MYCBP      AELKEALGQ-GIPARPVIIGPITFLLLSKAVDGAG-------------------------
METE_MYCTU      AELKEALGQ-GIPARPVIIGPITFLLLSKAVDGAG-------------------------
METE_MYCTA      AELKEALGQ-GIPARPVIIGPITFLLLSKAVDGAG-------------------------
METE_RHOJR      RELEEARAL-DIPARPVVVGPVTFLLLSKAVGSDA-------------------------
METE_STRAW      AELGEALAL-GLTARPVLVGPVTYLLLAKPAPGVAA------------------------
METE_STRCO      TELAEAVAL-GLTARPVLVGPVTYLLLAKPAPGAPA------------------------
METE_STRGG      AEFREALAL-GWTPRPVLVGPLTYLLLAKAAPGVAA------------------------
METE_HERA2      EQVRFAQNVVGAKARPVLLGPWTFLRLARLAG----------------------------
METE_SYNJB      ERVRRAQGILGERTSPVVLSPVTLLCLSQRSG----------------------------
METE_THEVB      ETVRRAQTLLGDRAVPIVLGPLTLLRLSRLET----------------------------
METE_TRIEI      ETVKRAKKIIGKSAVPIIISPITFIRLSRLESV---------------------------
METE_BACVZ      DDYRRIKEEFGAETKPVIVGPYTFVTLAKGY----------------------------E
METE_BACSU      EDYRRIKQEYGVETKPVIVGPYTFVTLAKGY----------------------------E
METE_BACLD      QDYQRAKAALGTETKPVILGLYTFVALAKGY----------------------------E
METE_BACP2      EAYEKVKKAFGVETKPVVLGLYTFVSLSKGY----------------------------E
METE_BACAN      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACC0      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACHK      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACAH      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACCZ      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACC7      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACC1      RLYEEAKQELGIDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACC2      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACCR      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACC4      RLYEEAKQELGVDGKPVILGPYTFLKLAKGY----------------------------T
METE_BACMK      RLYEEAKKELGVDGKPVILGPYTFLKLAKGY----------------------------N
METE_BACCN      RLYEEAKRELGIDGKPVILGPYTFLKLAKGY----------------------------T
METE_HALH5      EAYLEAKNELGIDGKPVILGPYSFVKLAKGY----------------------------E
METE_LISMO      YYYEEAKKELGIEGKPVLVGPVTYLKLGKGN----------------------------D
METE_LISMF      YYYEEAKKELGIEGKPVLVGPITYLKLGKGS----------------------------D
METE_LISIN      YYYEEAKNELGIEGKPVLVGPVTYLKLGKGS----------------------------D
METE_LISW6      YYYEEAKKELGIEGKPVLVGPITYLKLGKGS----------------------------N
METE_LACPL      RYYQEAKQELGIDGKPVILGPISFLKLGKRHGQYL------------------------D
METE_STAAC      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAA8      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAE      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAT      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAA3      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAR      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAW      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAS      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAA1      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAN      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAM      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAA2      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAA9      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAAB      DRFKYAQSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAES      ERFKYAQSI-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAEQ      ERFKYAQSI-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STAHJ      DRFNYAKSL-NVNAHPVIVGPITFVKLSKGG-----------------------------
METE_STRA3      DLYLEAREVVGDKAKPVITGPITYVSLSSG------------------------------
METE_STRA5      DLYLEAREVVGDKAKPVITGPITYVSLSSG------------------------------
METE_STRA1      DLYLEAREVVGDKAKPVITGPITYVSLSSG------------------------------
METE_STRMU      DLYLEAREVVGDKAKPVITGPITYVALSTG------------------------------
METE_THEMA      EDYLFFK-SKGIETAPWVIGPFTFLYLSKRNGEWIRR-----------------------
METE_THESQ      EDYLFFK-SKGIETAPWVIGPFTFLYLSKRNGEWIRR-----------------------
METE_THEP1      EDFLFFR-SMGIETAPRILGPFTFLYLSKKDGMWIRE-----------------------
METE_AQUAE      EDYKFFK-EKGINTVPHVIGLFTFLKLSKAPKRVEEEGLPVIILEKL-----------DT
METE_THEYD      REFALLRDSLSVKTKPVIVGPFTYLKSAKLN-----------------------------
                                 . .  : .                                   

METE_RHOPA      GLDVLSLLPKLVPVYIEILGRLAAAGAK-----------WVQLDEPALVLDLDDRERLAF
METE_RHOPT      RLDVLSLLPKLVPVYIEILGRLAAAGAK-----------WVQLDEPALVLDLDDRERLAF
METE_NITWN      NLDPLSLLPDLLPVYIDVLKRLAAEGAE-----------WVQIDEPCLVLDLDDATRKVL
METE_BRADU      AFQPLSLLDDLIPVYIDLLHELAKRGAS-----------WVQFDEPCLVLDLDEAARNSL
METE_RHILO      GFNPIALLPRLLPVYEELLRRLKLAGAD-----------WVQIDEPALVVDLVPNERDAL
METE_CAUVC      GFSPLSLLSALLPVYGQVLRGLAAAGAD-----------WVQIDEPCLALDLTDFERAEL
METE_CHESB      GGDPLELLPRLVPVYAELLGKLLRAGAD-----------WVQIDEPCLVLDLTERERRAF
METE_ACICJ      GSDPLDLLDRLLPCYAQVLAELAAEGCA-----------WVQMDEPVLALDLAPKARAAL
METE_XYLF2      GSNRLDLLERLLPVYTQLLRQLQESGAE-----------WVQIDEPTLVLDLDAQTQQAF
METE_XYLFT      GSNRLDLLERLLPVYTQLLRQLQESGAE-----------WVQIDEPTLVLDLDAQTQQAF
METE_XYLFM      GSNRLDLLERLLPVYTQLLRQLQESGAE-----------WVQIDEPTLVLDLDAQTQQAF
METE_XYLFA      GSNRLDLLERLLPVYTQLLRQLQASGAE-----------WVQIDEPTLVLDLDAQTQQAF
METE_CYTH3      GFNRIELIENLLPVYTKLLATLQQNGAE-----------WIQLDEPFLVMDLTVQERKTY
METE_FLAJ1      GFNRIDLIDALLPVYFEILEKLQIENAE-----------YIQLDEPFLALNLTDKERNVF
METE_PARL1      GFDPLDLMGRLLPVYENVLKRLAEAGAD-----------WVQIDEPCLVLELGSGDLAKC
METE_SALRD      DLDALDLLDDLLPVYAEVLQELADAGCE-----------AVQLDEPNLVLDLSDAERAAL
METE_DESVH      GSDRFALLPALCDAYATLLRELTSACPPACPRGYSSGGLMVQLDEPVLALDLPQTVRDLF
METE_DESVM      GGTRWSLLPALLDAYGALLRDVAARCP------------LIQLDEPILSLDLADDIRSRF
METE_SYNC1      GFDRWSHLDAVVEVYEEIVSRVAAKCS------------WIQLDEPILATDVPGPIRLRV
METE_ECODH      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOLI      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECO57      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECO5E      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_SHIDS      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_SHIB3      QFDRLSLLNDILPVYQQVLAELEKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_SHIBS      QFDRLSLLNDILPVYQQVLAELEKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOL5      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ESCF3      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOSE      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_SHISS      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOLC      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECO24      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_SHIFL      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_SHIF8      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECO8A      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOHS      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOLU      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOUT      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLNAY
METE_ECO45      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLNAY
METE_ECOK1      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLNAY
METE_ECOL6      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECOSM      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_ECO7I      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAY
METE_SALA4      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALNS      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALPA      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDELALVLELPQAWLDAF
METE_SALPK      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDELALVLELPQAWLDAF
METE_SALCH      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALPB      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALSV      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALEP      PFDRLTLLKDILPVYQHVLAELAKRGVE-----------WVQIDEPALVLELPQAWLDAF
METE_SALG2      PFDRLTLLTDILPVYQHVLAELAKRGVE-----------WVQIDEPALVLELPQAWLDAF
METE_SALHS      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALTY      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALDC      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_SALTI      PFDRLTLLKDILPVYQHVLAELAKRGVE-----------WVQIDEPALVLELPQAWLDAF
METE_SALAR      PFDRLTLLKDILPVYQHVLAELAKRGIE-----------WVQIDEPALVLELPQAWLDAF
METE_ENT38      QFDRLSLLNDILPVYQQVLAELAKRGVE-----------WVQIDEPALVLELPQEWLDAF
METE_CITK8      SFDRLSLLNDILPVYKQVLTELAKRGVE-----------WVQIDEPALVLELPQEWLDAY
METE_KLEP3      PFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPPAWLEAF
METE_KLEP7      PFDRLTLLNTILPVYQQVLAELAKRGID-----------WVQIDEPALVLELPPAWLEAF
METE_CROS8      QFDRLSLLNDILPVYQQVIAELAKRGIQ-----------WVQIDEPALVLELPQAWLDAF
METE_PECAS      QFDRLSLLQDILPVYQQVLAELTKRGIE-----------WVQIDEPALALELSQEWLAAF
METE_ERWT9      PFDRLNLLQDILPVYRQVLAELAKRDIE-----------WVQIDEPALALELPAEWLAAF
METE_YERPA      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQEWLDAY
METE_YERPN      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQEWLDAY
METE_YERPE      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQEWLDAY
METE_YERPP      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQEWLDAY
METE_YERPS      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQEWLDAY
METE_YERP3      QFDRLSLLNDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPQEWLDAY
METE_YERE8      QFDRLSLLKDILPVYQQVLGELAKRGIE-----------WVQIDEPALVLELPPEWLDAY
METE_SERP5      PFDRLSLLNDILPVYQQVLAELAKRGVE-----------WVQIDEPALVLELPQAWLNAF
METE_PHOLL      VFDRLSLLQDILPVYQQVLAELAKRGIE-----------WVQIDEPALVLELPAEWLTAY
METE_PROMH      EFDRLSLLDAILPVYQQVLSQLQQKGIE-----------WVQIDEPALVLDLPIEWQNAY
METE_SODGM      AFDRLSLLPALLPVYKQVLGELAKRGVD-----------WVQIDEQALVLELPQAWREAY
METE_BAUCH      HFDRLSLLSALLPVYQQILALLAQRGIE-----------WVQIDEPALVLELPTAWCNAY
METE_BLOFL      EFDRLSLLPSLLLVYKEIFNILSKKNIQ-----------WIQIDEPALVLELPQTWLKAY
METE_BLOPB      KFDRLSLLPNLLSVYQEILDILLSKNID-----------WIQIDEPILVLELPLQWLNAY
METE_BUCAI      YFDRLDILKDIILIYKHVLKELSNRSID-----------FVQIDEPVLVLELPKKWKDAY
METE_BUCAP      YFDRLDLLKNILPIYKQVLRELSQRNID-----------FVQIDEPALVLDLPEKWKKAY
METE_BUCBP      KFDRLNLLKEILPVYKYLLSEINDRNIS-----------WVQIDEPILTLELPEKWKNAF
METE_BUCCC      KINKLDLLKKILPIYIQVFKELSSRNIN-----------WIQIDEPILVLDIPKNWKKEF
METE_VIBHA      DFDRLTLLPRLLTAYQAILSKLANQGVE-----------WVQIDEPILSLELEEKWGDAF
METE_VIBC1      GFDRLTLLPRLLTAYQTILSKLASQGVE-----------WVQIDEPILSLELQDKWADAF
METE_VIBPA      GFDRLTLLPRLLTAYQAILAKLASQGVE-----------WVQIDEPILSLELEKQWADAF
METE_VIBVU      GFDRLTLLPRLLTAYQAILAKLAKQGVE-----------WVQIDEPILALELEKPWLDAF
METE_VIBVY      GFDRLTLLPRLLTAYQAILAKLAKQGVE-----------WVQIDEPILALELEKPWLDAF
METE_VIBCH      GFDRLTLLPRLLTAYQAILSKLAKQGVQ-----------WVQIDEPILALELEPRWQEAF
METE_ALIF1      GFDRLSLLPRLLTAYQAIFSKLSALGVE-----------WVQIDEPILALELPKAWADSF
METE_ALIFM      GFDRLSLLPRLLTAYQAIFSKLSALGVE-----------WVQIDEPILALELPKAWADSF
METE_PHOPR      GFDRLSLLPRLLAAYQKILSKLEALGVE-----------WVQIDEPVLALELPKPWAESF
METE_AERS4      GFSRLELLDRLLIVYQEILAKLAAQGVE-----------WVQIDEPALALDLPDEWRLAY
METE_SHEON      DFDKLSLLPNLLKAYAEILARFAAQGVT-----------WVQLEEPILALELTHEWQAAI
METE_BORBR      DIGKLQLLDALLPVYGEVLERLAGLGVE-----------WVQIDEPALVLDLPQAWRDAY
METE_BORPA      DIGKLQLLDALLPVYGEVLERLAGLGVE-----------WVQIDEPALVLDLPQAWRDAY
METE_BORPE      DIGKLQLLDALLPVYGEVLERLAGLGVE-----------WVQIDEPALVLDLPQAWRDAY
METE_BORPD      DAAKLQLLDTLLPVYAEVLARLARLGVE-----------WVQIDEPILVLDLPQAWRDAF
METE_BORA1      DEDKLKLLANLLPVYQQVLKRLADQGVE-----------WVQIDEPILALDLPAAWRDAF
METE_ALCBS      DSAKLALLDNLIPVYREILQRFANQGVQ-----------WVQIDEPILVLDLPDSWQRAY
METE_ALKEH      GLDRLDLLDGVVDVYGEILQQLGEQGVE-----------WVQLDEPALVQDLPADWQQAY
METE_CHRSD      GLDRLTLLDDVLSVYGEILERLAAQGVE-----------WVQLDEPALVQDLPRDWRQAF
METE_PSEAE      -FDRLDLLDRLLPLYGQIFRRLAGQGVE-----------WVQIDEPILVLDLPQAWKNAF
METE_PSEAB      -FDRLDLLDRLLPLYGQILRRLAGQGVE-----------WVQIDEPILVLDLPQAWKNAF
METE_PSEA8      -FDRLDLLDRLLPLYGQILRRLAGQGVE-----------WVQIDEPILVLDLPQAWKNAF
METE_PSEE4      -FDKLELLDRLLPLYDQILNRLAVQGVE-----------WVQIDEPILALDLPQDWKNAY
METE_PSEPW      -FDKLELLDRLLPVYDEILNRLAGQGVE-----------WVQIDEPILVLDLPQEWKNAY
METE_PSEF5      -FDKLELLDRLLPLYGQIFQRLAAQGVE-----------WVQIDEPILVLDLPQDWKNAF
METE_PSEMY      -FDRLDLLERLLPVYGEIFQRLAAQGVE-----------WVQIDEPILVLDLPQAWKNAF
METE_PSEA7      -FDRLELLERLLPVYGEIFQGLAARGVE-----------WVQIDEPILVLDLPQAWKNAF
METE_STUS1      TFDKLELLDRLLPVYGEVLDRLAAQGVE-----------WVQIDEPILALDLPQDWKNAF
METE_PSESM      -FDRLELLDRLLPVYGEILGRLAAQGVE-----------WVQFDEPVLTLDLPQDWKTAF
METE_ACIF2      CFDRLTLLPKVLPVYAEILARLAEMGVE-----------WVQIDEPALALDLPQEWVEAL
METE_ACIF5      CFDRLTLLPKVLPVYAEILARLAEMGVE-----------WVQIDEPALALDLPQEWVEAL
METE_ACTPJ      AFNRFDLLKQLVPIYFEILTALAAEGVE-----------WIQIDEPALALDLPQEWLAAY
METE_ACTP7      AFNRFDLLKQLVPIYFEILTSLAAEGVE-----------WIQIDEPALALDLPQEWLAAY
METE_ACTP2      AFNRFDLLKQLVPIYFEILTALAAEGVE-----------WIQIDEPALALDLPQEWLAAY
METE_HAEIE      AFNRFDLLNQLVPVYVEILNALVAEGAE-----------WIQIDEPALALDLPAEWVEAY
METE_HAEIG      AFNRFDLLNQLVPVYVEILNALVAEGAE-----------WIQIDEPALALDLPAEWVEAY
METE_HAEIN      AFNRFDLLNQLVPVYVEILNALVAEGAE-----------WIQIDEPALALDLPAEWVEAY
METE_HAES1      SFNRFELLAQLVPVYVEILNALVAEGAE-----------WIQIDEPALAVDLPKEWGNAY
METE_HISS2      SFNRFELLAQLVPVYVEILNALVAEGTE-----------WIQIDEPALAVDLPKEWVNAY
METE_PASMU      AFNRFELLAKLVPVYVEILNALVAEGAE-----------WIQIDEPALAVDLPTEWIEAY
METE_NEIMA      EFDRLSLLPKLLPVYVEILTALVEAGAE-----------WIQIDEPALTVDLPKEWVEAY
METE_NEIMF      EFNRLSLLQKLLPVYVEILNALVEAGAE-----------WIQIDEPALTVDLPKEWVEAY
METE_NEIMB      EFDRLSLLPKLLPVYVEILTALVEAGAE-----------WIQIDEPALAVDLPKEWVEAY
METE_NEIM0      EFDRLSLLPKLLPVYVEILTALVEAGAE-----------WIQIDEPALTVDLPKEWVEAY
METE_NEIG1      EFDRLSLLPKLLPVYVEILTALVEAGAE-----------WIQIDEPALAVDLPKEWVEAY
METE_CHRVO      PFDRLALLPGLVAAYRELLSSLRAAGAE-----------WAQIDEPILALDLEPSWLDAF
METE_BURMA      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFSLDLPDAWRDAA
METE_BURM9      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFSLDLPDAWRDAA
METE_BURM7      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFSLDLPDAWRDAA
METE_BURMS      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFSLDLPDAWRDAA
METE_BURP1      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFSLDLPDAWRDAA
METE_BURPS      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIEEPIFSLDLPDAWRDAA
METE_BURP0      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFSLDLPDAWRDAA
METE_BURP6      LVERLALLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFSLDLPDAWRDAA
METE_BURTA      LADRLELLPRLVPAYRALLARLREAGVD-----------WVQIDEPIFALDLPAAWRDAA
METE_RALPJ      LADKLALLPQVLQAYTAVLQRLAALKVE-----------WVQIDEPALVLDLPQAWVDAF
METE_RALSO      LADKLSLLPQLLPAYAAVLKRLAAEGVE-----------WVQIDEPALVLDLPQAWSDAY
METE_PARPJ      GFDRLSLLPKLVIRYSRLLEKLKQRGIE-----------WVQLDEPALCVDLPVEWLDAF
METE_PARXL      GFDRLSLLPKLVIRYARLLDKLRQSGIE-----------WVQLDEPALCVDLPAEWLDAF
METE_CUPNE      GFDRLALLPQLLQGYRRILDQLKARGIE-----------WVQIDEPALCLDLEPAWLDAF
METE_CUPNH      GFDRLALLPQLLQGYRRILDQLKARGIE-----------WVQIDEPALCLDLEPAWLDAF
METE_METCA      GFSRLELLPRLLPAYAAILRRLHASGVP-----------WVQMDEPILGMDLPPEWLEAF
METE_NITEU      GFQRLDLLPRLLPVYREILQKIASLGVE-----------WVQIDEPILSLDLEQPWRDSF
METE_BURCM      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDAEWRQAL
METE_BURA4      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDAEWRQAL
METE_BURO1      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDAEWRQAF
METE_BURCH      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDAEWRQAF
METE_BURO0      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDAEWRQAF
METE_BURCJ      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDAEWRQAF
METE_BURL3      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDAAWQQAF
METE_BURVG      S-DRLALLPKLLPVYGALLDTLTAQGVE-----------WVQIDEPILVTELDADWRRAL
METE_PARP8      S-DKLTLLPRLLPVYAALLDYFTAQGID-----------WVQIDEPVLVTELDARWRDAF
METE_THIDA      S-DKLGLLDRLLPVYVELLEALAGAGAE-----------WVQIDEPLLVTELNAEWQHAF
METE_HAHCH      S-NKLDLLERLLPVYAALLDVLANQGVE-----------WVQIDEPILVTELDAEWKYAL
METE_MARN8      S-NRLDLLERLLPVYSQLLEALADAGAE-----------WVQLDEPALVTDLDANWRYAF
METE_RUTMC      I-NKLDLLDSLVKVYTQLFDELVKLGIE-----------WIQVDEPILVTELETDWQVAF
METE_PSYIN      S-QKLTLLPELLEVYAELLALFAEKNIT-----------WVQIDEPILVLEIPKQWQEAL
METE_SACD2      STHKLGFLDDLITVYRELLGTLAKEAVE-----------WVQFDEPILALDLPEQWQHAF
METE_COXBU      SFNKLLLLEKLLPVYAEIFEQLSSLGVE-----------WVQVDEPILVLDLPPEWQQAF
METE_COXBN      SFNKLLLLEKLLPVYAEIFEQLSSLGVE-----------WVQVDEPILVLDLPPEWQQAF
METE_COXB1      SFNKLLLLEKLLPVYAEIFEQLSSLGVE-----------WVQVDEPILVLDLPPEWQQAF
METE_COXBR      SFNKLLLLEKLLPVYAEIFEQLSSLGVE-----------WVQVDEPILVLDLPPEWQQAF
METE_COXB2      SFNKLLLLEKLLPVYAEIFEQLSSLGVE-----------WVQVDEPILVLDLPPEWQQAF
METE_NITOC      TFDKLSLLDALLPVYGQVLHRLKTQGVE-----------WVQIDEPILVLDLPPDWKAAF
METE_BIFLO      LELDKGLVNAVAAVYVEVLAKFNELGAA-----------WVQLDEPYLVLDKEPGDVELF
METE_BIFLD      LELDKGLVNAVAAVYVEVLAKFNELGAA-----------WVQLDEPYLVLDKEPGDVELF
METE_BIFAA      LDYDKGLVNAVAAVYAEVVAKFAELGVQ-----------WIQIDEPYLVLDKEPGDVELF
METE_CAMJE      EKTQKLAKEKLLNAYIELFDKLNELKVT-----------WLELDEPYLVYDLSKEDIALF
METE_CAMJR      EKTQKLAKEKLLNAYIELFDKLNELKVT-----------WLELDEPYLVYDLSKEDIALF
METE_CAMJJ      EKTQKLAKEKLLNAYIELFDKLNELKVT-----------WLELDEPYLVYDLSKEDIALF
METE_CAMJ8      EKTQKLAKEKLLNAYIELFDKLNELKVT-----------WLELDEPYLVYDLSKEDIALF
METE_CAMJD      KKTQKLAKEKLLNAYIELFDKLNELKVT-----------WLELDEPYLVYDLSKEDIALF
METE_STRGC      GVAPADFVDALATAYQEVFAKLAELGAK-----------RIQLDEPSLVKDLSAEEKALF
METE_STRSV      GVAPADFVDALVVAYQEVFAKLAELGAE-----------RIQLDEPSLVKDLSAEEKALF
METE_STRPN      GVKADDFVDSLVAAYQEVFAKLAELGAT-----------RIQLDEAALVKDLTAEEKALF
METE_STRP4      GVKADDFVDSLVAAYQEVFAKLAELGAT-----------RIQLDEAALVKDLTAEEKALF
METE_STRR6      GVKADDFVDSFVAAYQEVFAKLADLGAT-----------RIQLDEAALVKDLTAEEKALF
METE_STRP2      GVKADDFVDSFVAAYQEVFAKLADLGAT-----------RIQLDEAALVKDLTAEEKALF
METE_STRPI      GVKADDFVDSLVAAYQEVFAKLAELGAT-----------CIQLDEAALVKDLTAEEKALF
METE_STRTD      GVKAEDFVDSFIAAYQDVFAKLAELGAT-----------RIQLDEPALVKDLTADEKALF
METE_STRSY      GLTATNFADSLVAAYGQVFEKLAELGAE-----------KIQLDEPSLVKDLTAEEKALF
METE_LACLM      GVTEDAILSDLIGAYTILFDQLNNLGGE-----------WLQIEEPALVLDQTEEEQQLF
METE_LACLS      GVTEDAILSDLIGAYTVLFDQLNNLGGE-----------WLQIEEPALVLDQTEEEQQLF
METE_LACLA      GATKDTVLSDVIVAFQTLLKELNQLGVE-----------WLQIEEPALVLDQTEEEKKLF
METE_DESRM      NQDTLELLPKILPCYVSLLKKIADLDDEV----------YIQFDEPIVVKDIDRRTLNLF
METE_CORGL      ---PLDHLPALFEVYERLIKSFD---TE-----------WVQIDEPALVTDVAPEVLEQV
METE_CORGB      ---PLDHLPALFEVYERLIKSFD---TE-----------WVQIDEPALVTDVAPEVLEQV
METE_COREF      ---PLDHLETLFEVFERLLAKLP---TP-----------WVQLDEPSLVTDVAPEVLERV
METE_MYCA1      --GPIERLEELVPIYAELLSLLADNGAQ-----------WVQLDEPALVTDMCADAPALA
METE_MYCPA      --APIERLEELVPIYAELLSLLADNGAQ-----------WVQLDEPALVTDMCADAPALA
METE_MYCLE      --APIQRLEELVGIYCTLLSLLAENGAR-----------WVQFDEPALVTDLSPDAPALA
METE_MYCBO      --APIERLEELVPVYSELLSLLADGGAQ-----------WVQFDEPALVTDLSPDAPALA
METE_MYCBP      --APIERLEELVPVYSELLSLLADGGAQ-----------WVQFDEPALVTDLSPDAPALA
METE_MYCTU      --APIERLEELVPVYSELLSLLADGGAQ-----------WVQFDEPALVTDLSPDAPALA
METE_MYCTA      --APIERLEELVPVYSELLSLLADGGAQ-----------WVQFDEPALVTDLSPDAPALA
METE_RHOJR      --PLLDRLDELVPLYADLLGRLAGAGAD-----------WVQIDEPALVADRNPKEIAAA
METE_STRAW      DFDPLTLLDRLLPVYAEVLADLRAAGAE-----------WVQLDEPALVQDRTPAELNAA
METE_STRCO      DFEPLTLLDRLLPVYAEVLTDLRAAGAE-----------WVQLDEPAFVQDRTPAELNAL
METE_STRGG      DFEPLTLLDRLLPVYAEILADLRAAGAT-----------WVQLDEPALVQDRTPAELNAA
METE_HERA2      -AELAQHLQQLTAMYAQIVRELNDCNVA-----------FIQCDEPALVGDVTEEEWQAF
METE_SYNJB      --DLRADLEKLLPLYRDLLQELKQLGIP-----------EVQIHDPILVTSQGSGLREAV
METE_THEVB      --NLEQAVSYLRDRYLILLRELKNLGVV-----------EVQIHEPALVLEEADSFKSFY
METE_TRIEI      --EFDNILAQLLPLYSDLLTKLKKLGIS-----------EIQLHEPALVFGDSSNLKKQF
METE_BACVZ      ESEAKAIQKRLVPLYVQLLKELEAEGVK-----------WVQIDEPALVTASSE-DVRAA
METE_BACSU      PSEAKAIQKRLVPLYVQLLKELEEEGVK-----------WVQIDEPALVTASSE-DVRGA
METE_BACLD      QQDIKDIYNQMTPLYIQVLKELEQEGVK-----------WVQIDEPALVTASPE-EAAAV
METE_BACP2      PNEVKEIQQRLIPLYTQLLKELEEAGVK-----------WVQIDEPALVTASYE-DVKAV
METE_BACAN      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------IIQVDEPIFASLTKE-EVQQA
METE_BACC0      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------IIQVDEPIFASLTKE-EVQQA
METE_BACHK      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------IIQVDEPIFASLTKE-EVQQA
METE_BACAH      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------IIQVDEPIFASLTKE-EVQQA
METE_BACCZ      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------IIQVDEPIFASLTKE-EVQQA
METE_BACC7      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------IIQVDEPIFASLTKE-EVQQA
METE_BACC1      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------IIQVDEPIFASLTKE-EVQQA
METE_BACC2      QEQFATILKQLVAPYVQLLSELHAAGAQ-----------VIQVDEPIFASLTKE-EVQQA
METE_BACCR      QEQFPTILKQLVAPYVQLLSELHAAGAP-----------AIQVDEPIFASLTKK-EVQQA
METE_BACC4      QEQFPTILKQLVAPYVQLLSELHTAGAP-----------AIQVDEPIFASLTKK-EVQQA
METE_BACMK      EEQFATILKELVAPYVQLFSELHAAGAQ-----------IIQVDEPIFASLTKD-EINQA
METE_BACCN      QDQFPTILHKLIAPYVQLLTELHKAGAR-----------LIQIDEPIFVSLTKE-EMIEA
METE_HALH5      EDKLQETIQSLLPLYIQVIQELVDAGAR-----------SIQVDEPSLVTSISAREMALV
METE_LISMO      AENFEALLDKFIPAYVEILKELERAGAK-----------WVQIDEPYLATSFDKSEIKLF
METE_LISMF      AKSFEVLLDKFIPAYVEILKELEAAGAK-----------WVQIDEPYLATSFDKKEIALF
METE_LISIN      AESFEILLDKFIPAYIEILKELETAGAT-----------WVQIDEPYLATSFDKKEIALF
METE_LISW6      AESFEVLLDKFIPAYIEILEELETAGVE-----------WVQIDEPYLATSFEKKEIALF
METE_LACPL      DAAVNELLPQLLPLYQQVFEELATAGAK-----------WIQLDEPTLVKTTTVAELAPY
METE_STAAC      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAA8      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAE      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAT      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAA3      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAR      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAW      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAS      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAA1      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAN      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAM      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAA2      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAA9      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAAB      HQTFEEKVKTLLPLYKEVFESLIDAGAE-----------YIQVDEPILVTDDSESYENIT
METE_STAES      HQSFEEKVETLLPLYKEVLQSLVDAGAE-----------YIQIDEPILVTDDSESYEDIT
METE_STAEQ      HQSFEEKVETLLPLYKEVLQSLVDAGAE-----------YIQIDEPILVTDDSESYEDIT
METE_STAHJ      HQSFEEKVQTLLPLYKEVLQALVDAGAE-----------YIQVDEPVLVTDESEAYEAIT
METE_STRA3      IVDFEATVQRLLPLYKQVFQDLIDAGAT-----------YIQIDEPIFVTDEGELLVDIA
METE_STRA5      IVDFEATVQRLLPLYKQVFQDLIDAGAT-----------YIQIDEPIFVTDEGELLVDIA
METE_STRA1      IVDFEATVQRLLPLYKQVFQDLIDAGAT-----------YIQIDEPIFVTDEGELLVDIA
METE_STRMU      VEDFTAAVKSLLPLYKQVFTELVKAGAS-----------YIQVDEPIFVTDEGKDYLQAA
METE_THEMA      PNQMEKLLESLVSVYKEVFEKLVENGCK-----------EILVNEPAFVCDLEKAHWDLI
METE_THESQ      PNQMEKLLESLVSVYKEVFEKLVENGCK-----------EILVNEPAFVCDLEKAHWDLI
METE_THEP1      PGEMEKLFTRLVPVYRKVFEELVENGCG-----------EILVDEPAFVCDLQKDHWNLI
METE_AQUAE      KERLEKFTKALLPVYKELLESLKNEGVN-----------RVHFEEPALVTDLEDYDWEIL
METE_THEYD      MDRVERLSEKILPAYKKLLIKLDAAGVE-----------EIQIDEPAMVMDMEEREIELL
                          .   :  :.  .                     .:  .            

METE_RHOPA      RDAYGQIAREL-PHLDIMLTTYFGGL-GDNLDTALALPIAGLHLDLVRAPKQ----INAV
METE_RHOPT      RDAYGQIAREL-PHLDIMLTTYFGGL-GDNLDTALALPIAGLHLDLVRAPKQ----INAV
METE_NITWN      RAAYEQLADAL-PKLKVMLTTYFGGL-GDNLDAALSLPVTGLHIDLARAPDQ----LEAV
METE_BRADU      LHAYNRFAKEG-PAIKIMLASYFGAL-GDNLDTALSLPISGLHVDLVRAPEL----LDQI
METE_RHILO      QFAYCRLSKAA-PELKIMVAIYFGSL-GDNLETAISLPVAGLHVDLVRAPEQ----LETV
METE_CAUVC      RRAYGALTHAA-PGVRLMLTSYFGGY-GENLATAVNLPVEGLHLDLVRAPDE----LEAA
METE_CHESB      TIAYDALAATG--GPKLMLATYFGGL-GDNLPTAAALPVAGLHLDLVRAPDQ----LQDV
METE_ACICJ      RHAYETLARGA--TPRLLLASYFAPI-ADNLPTALALPVAGLHLDLVRGRDD----LAPV
METE_XYLF2      RKAYAILNQGP--RPKLLLTSYFGPL-GDNLELALQLPADGLHIDLVRGTEQ----LDAV
METE_XYLFT      RKAYAILNQGP--RPKLLLTSYFGPL-GDNLELALQLPADGLHIDLVRGTEQ----LDAV
METE_XYLFM      RKAYATLNQGP--RPKLLLTSYFGPL-GDNLELALQLPADGLHIDLVRGTEQ----LDAV
METE_XYLFA      RKAYAALNQGP--RPKLLLTSYFGPL-GDNLELALQLPADGLHIDLVRGTEQ----LDAV
METE_CYTH3      ETTYTALRNLF-PSLKFIVATYFECT-GTNIDIAAKLPVDALHLDLVRCPSQ----LSDI
METE_FLAJ1      TKVYNEINVRF-PKLKIVLANYFDCF-GENLETALALPVDTFHLDLVRCQLQ----LDDI
METE_PARL1      RAAYSALSAAA-PSLKLMVATYFGALPEASLETAMALPVAGIHLDMVRGRSQ----YEAA
METE_SALRD      DQAYEALADAA--DIELHVATYFGGL-EDNLPTALDLPIDVLHLDLTRGEEQ----LDEA
METE_DESVH      PAVYTRLRAAV-PDATLMVASYFAPC-ADNLPVALNLPVDVLHLDLVRGRDD----LDAA
METE_DESVM      VPAYARLRVAV-PDATLLLASYFAPV-GDNLPVALSLPVDVVHLDLVRGPED----LTPA
METE_SYNC1      RDVYRRLAAVA-GPCRLMVATYFGAL-QENLDLALSLPVDGLHVDLVRAPGQ----LEKV
METE_ECODH      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOLI      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECO57      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VVEL
METE_ECO5E      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VVEL
METE_SHIDS      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VVEL
METE_SHIB3      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDG----VAEL
METE_SHIBS      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDG----VAEL
METE_ECOL5      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ESCF3      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOSE      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_SHISS      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOLC      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VVEL
METE_ECO24      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_SHIFL      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDN----VVEL
METE_SHIF8      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VVEL
METE_ECO8A      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VVEL
METE_ECOHS      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOLU      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOUT      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECO45      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOK1      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOL6      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECOSM      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_ECO7I      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDD----VAEL
METE_SALA4      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALNS      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALPA      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPAQGLHVDLIHGKDD----VAEL
METE_SALPK      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPAQGLHVDLIHGKDD----VAEL
METE_SALCH      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALPB      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALSV      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALEP      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALG2      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALHS      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALTY      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALDC      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIALPVQGLHVDLIHGKDD----VAEL
METE_SALTI      KPAY---DALA-GQVKLLLTTYFEGV-TPNLDTIIVLPVQGLHVDLIHGKDD----VVEL
METE_SALAR      KLAY---DALA-GQVKLLLTTYFEGV-TPNLNTIIALPVQGLHVDLIHGKDD----VSEL
METE_ENT38      KPAY---DALT-GQTKLLLTTYFEGV-TPNLDTITALPVQGLHVDLVHGKDE----VAEL
METE_CITK8      KPAY---DALQ-GQVKLLLTTYFEGV-TPNLDTIAALPVQGLHVDLVHGKDD----VAEL
METE_KLEP3      KPAY---DALQ-GQVKLLLTTYFEGI-SDNLATIAALPVQGLHVDLVHGKDD----VAEL
METE_KLEP7      QPAY---DALQ-GQVKLLLTTYFEGV-SDNLATIAALPVQGLHVDLVHGKDD----VAEL
METE_CROS8      KPAY---EALK-GQTKLLLTTYFEGV-SDNLDTITALPVQGLHVDLVHGHDD----VNEL
METE_PECAS      KPAY---DALQ-GQVKLLLTTYFDSV-SQNLETIKALPVQGLHIDLVHGKDD----AATL
METE_ERWT9      KPAY---DALQ-GQTKLLLTTYFDSI-GQNLDTISALPVQGLHVDLVHGKDA----ITLL
METE_YERPA      QPAY---QALQ-GQVKLLLTTYFDSI-GHNIDTIRALPVQGLHVDVVTGHDD----LAVL
METE_YERPN      QPAY---QALQ-GQVKLLLTTYFDSI-GHNIDTIRALPVQGLHVDVVTGHDD----LAVL
METE_YERPE      QPAY---QALQ-GQVKLLLTTYFDSI-GHNIDTIRALPVQGLHVDVVTGHDD----LAVL
METE_YERPP      QPAY---QALQ-GQVKLLLTTYFDSI-GHNIDTIRALPVQGLHVDVVAGHDD----LAVL
METE_YERPS      QPAY---QALQ-GQVKLLLTTYFDSI-GHNIDTIRALPVQGLHVDVVAGHDD----LAVL
METE_YERP3      QPAY---QALQ-GQVKLLLTTYFDSI-GHNIDTIRALPVQGLHVDVVAGHDD----LAVL
METE_YERE8      QPAY---QALQ-GQVKLLLTTYFDSI-GHNLDTIRALPVQGLHVDVVAGQDD----IAKL
METE_SERP5      KPAY---DALQ-GQVKLLLTTYFDSV-GHNLDTLRELPVQGLHVDLVGGHDD----IAVL
METE_PHOLL      PIAY---QALQ-GQVKLLLTTYFDSI-GHNLETIKSLPVQGLHVDLVAGQDD----IAQL
METE_PROMH      QVAY---QALT-GQVKLLLTTYFDGI-THHLDIIKNLPVNGLHIDLCAGQDA----LQVI
METE_SODGM      REAY---QALQ-GQTKLLLTTYFDSI-RHQLDIITALPVQGLHVDLVAGDDD----LTEL
METE_BAUCH      YDAY--TDALQ-GYSKLLLTTYFDSI-GHHLNIITNLSVHGLHVDLIAGNDD----VEVL
METE_BLOFL      LHAY--DQLYQ-TKIKLLLTTYFGKI-YHQLPIIKQLKVNGLHIDLTNCSDND---ISLL
METE_BLOPB      LSAY--EQLHG--KVKLLLTTYFDSI-YHQLDIITRLKIDGLHVDLVSNPDN----IPLL
METE_BUCAI      HYAY--KELSG--ITKLLLTTYFDSI-EHNIEFIRDLPVQGIHIDLVHGKYN----LKNF
METE_BUCAP      SYAY--EYLNG--TTKILLTTYFDSI-EHNIEYIRDLPIYGIHIDLVFGKYN----LFDF
METE_BUCBP      RFAY--QSLYG--YNSLLLTTYFGSV-QHNFSLICELPIQGVHLDLVHGKYD----LVFL
METE_BUCCC      QSTY--KFLDG--KIKILLATYFGDI-THNLDIINKLSIQGLHIDLVSSKYD----LLKL
METE_VIBHA      KLAY---QVIR-SDVKVLLTTYFDSV-SDTLDKIVELPVDGLHIDLSASPEQ----LDEV
METE_VIBC1      KLAY---QVIR-SDVKVLLTTYFDSV-SDTLDKIVELNVDGLHIDLSASPEQ----LDEV
METE_VIBPA      KLAY---QLIR-SDVKVLLTTYFDSV-TDTLDKIVELPVDGLHVDLSAAPQQ----LDDV
METE_VIBVU      KLAY---QVIR-SDVKVLLTTYFDSV-VDSLDRIVELSVDGLHVDLSAAPEQ----LDAV
METE_VIBVY      KLAY---QVIR-SDVKVLLTTYFDSV-VDSLDRIVELSVDGLHVDLSAAPEQ----LDAV
METE_VIBCH      KLAY---QVIR-GDVKLLLTTYFDSV-LDTLDKIVELPVDGLHVDISAAPAQ----LETI
METE_ALIF1      KLAY---QVIQ-SDVKLLLTTYFDGV-EHHLDKITKLAVNGLHIDVSAAPDQ----LDAI
METE_ALIFM      KLAY---QVIQ-SDVKLLLTTYFDGV-EHHLDKITKLAVNGLHIDVSAAPDQ----LDAI
METE_PHOPR      KLAY---QVLN-GNTKLLLTTYFDNI-THHLDKIVELNIDGLHVDLSAAPEQ----LNAV
METE_AERS4      LNAY---ERLS-GPCKLLLTTYFGSV-AHQRDIITSLKVDGLHLDLVAAPEQ----LETL
METE_SHEON      SESY--QALKT-AQVKILLTSYYGSI-SHHQALVSALPVAGLHLDLVTAPEQ----LALF
METE_BORBR      QAVYAK-LA-A-SPVKLLLATYFDGL-KDNLATALALPVAGLHVDLVRAPDQ----LSDV
METE_BORPA      QAVYAK-LA-A-SPVKLLLATYFDGL-KDNLATALALPVAGLHVDLVRAPDQ----LSDV
METE_BORPE      QAVYAK-LA-A-SPVKLLLATYFDGL-KDNLATALALPVAGLHVDLVRAPDQ----LSDV
METE_BORPD      RTAYAR-LA-D-APVKLLVATYFGGL-NDNLATALALPVAGLHVDLIRAPGQ----LQDV
METE_BORA1      GLAYAQ-LA-G-SPVKVLLATYFDGL-KDNLSTVTKLPVAGLHVDLVRAPEQ----LDDV
METE_ALCBS      LRVYDQ-LASA-SQTKLLLATYFGGL-GNNLFTALELPVHGLHLDRVRGNDD----LGQV
METE_ALKEH      ERAYHR-LQ-A-GPVKLLLATYFGGL-GENLSTALNLPVDGIHIDCVRDPDQ----LTAV
METE_CHRSD      ESAYNK-LQ-S-APVKLLLATYFGAL-GDNLGLAAGLPVAGLHIDTVRAPEQ----LDAV
METE_PSEAE      ERAYNL-LQ-S-EPLKKLVATYFGGL-EDNLGLAANLPVDGLHIDLVRAPEQ----YPSI
METE_PSEAB      ERAYNL-LQ-S-EPLKKLVATYFGGL-EDNLGLAANLPVDGLHIDLVRAPEQ----YPSI
METE_PSEA8      ERAYNL-LQ-S-EPLKKLVATYFGGL-EDNLGLAANLPVDGLHIDLVRAPEQ----YPSI
METE_PSEE4      ERVYNI-LQ-R-APLKKLIATYFGGL-EDNLGLAANLPVDGLHIDLVRAPDQ----YPTI
METE_PSEPW      ERVYNI-LQ-R-APLKKLVATYFGGL-EENLGLAANLPVDGLHIDLVRAPEQ----YPTI
METE_PSEF5      ERAYNQ-IQ-R-EPLKKLLATYFGGL-EENLGLAANLPVDGLHIDLVRAPEQ----YPTI
METE_PSEMY      ERAYNL-IQ-R-EPCKKLIATYFGGL-EDNLGLAANLPVDGLHIDLVRAPEQ----YPTI
METE_PSEA7      ERAYNL-IQ-R-EPLKKLVATYFGGL-EDNLGLAAGLPVDGLHIDLVRAPGQ----YPTI
METE_STUS1      ERAYNL-LQ-R-APLKKLVATYFGGL-EDNLGLAATLPVDGLHIDLVRAPEQ----YPVI
METE_PSESM      ERAYHS-LQ-Y-SPLKKLVATYFGGL-EDNLGLAATLPVDGLHIDLVRAPEQ----LPAV
METE_ACIF2      ESAYQ-TLRRD-KTPKVLLATYFDSV-ADHAKALKALPVAGVHLDLRRAPQQ----LNSF
METE_ACIF5      ESAYQ-TLRRD-KTPKVLLATYFDSV-ADHAKALKALPVAGVHLDLRRAPQQ----LNSF
METE_ACTPJ      QDVYA-QLA-K-VNAKLLLATYFGSV-AEHAALLKALPVDGLHLDLVRAPEQ----LSAF
METE_ACTP7      QDVYA-QLA-K-VNAKLLLATYFGSV-AEHADLLKALPVDGLHLDLVRAPEQ----LSAF
METE_ACTP2      QDVYA-QLA-K-VNAKLLLATYFGSV-AEHADLLKALPVDGLHLDLVRAPEQ----LSAF
METE_HAEIE      KSVYA-ELS-K-VNAKLLLATYFGSV-AEHAELLKALPVAGLHLDLVRAPEQ----LAAF
METE_HAEIG      KSVYA-ELS-K-VNAKLLLATYFGSV-AEHAELLKALPVAGLHLDLVRAPEQ----LAAF
METE_HAEIN      KSVYT-ELS-K-VNAKLLLATYFGSV-AEHAELLKALPVAGLHLDLVRAPEQ----LAAF
METE_HAES1      KDVYA-TLSEK-VNAKLLLATYFGSV-TEHATLLKELSVDGLHLDLVRAPEQ----LVAF
METE_HISS2      KDVYA-TLSEK-VNAKLLLATYFGSV-TEHATLLKELPVDGLHLDLVRAPEQ----LVAF
METE_PASMU      KAVYT-TLKEK-VKAKLLLATYFGSV-AEHAPLLKGLPVDGLHIDLVRAPAQ----LAAF
METE_NEIMA      KDVYA-TLS-K-VSAKILLSTYFGSV-AEHAALLKSLPVDGLHIDLVRAPEQ----LDAF
METE_NEIMF      KDVYA-TLS-K-VSAKILLSTYFGSV-AEHAALLKSLPVDGLHIDLVRAPEQ----LDAF
METE_NEIMB      KDVYA-TLS-K-VSAKILLSTYFGSV-AEHAALLKALPVDGLHIDLVRAPEQ----LDAF
METE_NEIM0      KDVYA-TLS-K-VSAKILLGTYFGSV-AEHAALLKALPVDGLHIDLVRAPEQ----PDAF
METE_NEIG1      KDVYA-TLN-K-VSAKILLGTYFGSV-AEHAALLKSLPVDGLHIDLVRAPEQ----LDAF
METE_CHRVO      APAYA-QLS-R-HAPKLLLATYFGDV-SEHAARLKSLPVAGLHLDLVRAPEQ----ISAF
METE_BURMA      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHVDLVRADAQ----LDAF
METE_BURM9      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHVDLVRADAQ----LDAF
METE_BURM7      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHVDLVRADAQ----LDAF
METE_BURMS      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHVDLVRADAQ----LDAF
METE_BURP1      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHVDLVRADAQ----LDAF
METE_BURPS      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHIDLVRADAQ----LDAF
METE_BURP0      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHVDLVRADAQ----LDAF
METE_BURP6      RPTYE-ALAPG--APKLLVATYFDDA-SEHAALLKALPVAGLHIDLVRADAQ----LDAF
METE_BURTA      RPAYE-ALVPG--APKLLVATYFDDV-SEHAALLKALPVAGLHVDLVRGDAQ----LDAF
METE_RALPJ      GPAHQ-ALAAA-KGPKRLLATYFEAA-SHHAALIQSLPVDGVHLDLVRAPDQ----VAAF
METE_RALSO      GPAYA-TLAAA-GGPRLLLATYFEAA-SHHAALIRSLPVAGVHLDLVRAPQQ----LEAF
METE_PARPJ      SAAYD-VLGTS--GVKVLLATYFESA-AEHAPRVAVLPVAGVHLDLVRAPQQ----LDAW
METE_PARXL      SAAYE-VLGTS--GVKVLLATYFESA-AEHAPRVAALPVAGVHLDLVRAPQQ----LDAW
METE_CUPNE      DTAYA-ALREA--GPKLLLATYFDTA-ADHAQRAAALPVDGFHIDLVRAPEQ----LAAW
METE_CUPNH      DTAYA-ALREA--GPKLLLATYFDTA-ADHAQRAAALPVDGFHIDLVRAPEQ----LAAW
METE_METCA      APAYA-ALAEA--GPKLLLATYFASV-AEHAVWLKSSAVAGLHIDAVRAPEQ----VADF
METE_NITEU      AEAYH-TLHDG--SCRLLLTTYFGTV-DHHLTLLKNLPVDGLHIDVSSAPEQ----LESF
METE_BURCM      RTAYA-ALETR--RIKLLLATYFGTL-GDNLTLAASLPVDGLHVDAINARDE----VDAL
METE_BURA4      RTAYA-ALETR--RIKVLLATYFGAL-GDNLTLAASLPVDGLHVDAINARDE----VDAL
METE_BURO1      RTAYA-ALETR--RIKLLLATYFGQL-QDNLTLAASLPVDGLHIDAINARDE----VDAL
METE_BURCH      RTAYA-ALETR--RIKLLLATYFGQL-QDNLTLAASLPVDGLHIDAINARDE----VDAL
METE_BURO0      RIAYA-ALETR--RIKLLLATYFGQL-QDNLTLAASLPVDGLHIDAINARDE----VDAL
METE_BURCJ      RTAYA-ALETR--RINLLLATYFGQL-QDNLTLAASLPVDGLHIDAINARDE----VDAL
METE_BURL3      RTAYA-ALETR--RIKVLLATYFGQL-QGNLALATSLPVDGLHVDAINARDE----VDAL
METE_BURVG      RTAYE-ALETR--RIKLLLATYFGQL-QDNLELAVSLPVDGLHIDAVNARDE----VDAL
METE_PARP8      VPAYD-ALAAR--RVRVLLATYFGQL-KENLELACQLPVDGLHIDAIHARDE----VAQV
METE_THIDA      NRAYH-ALKAS--RVKLLLATYFGQL-LENRYLAATLPVAGLHVDAISGRDD----VEPL
METE_HAHCH      NLAYH-TLKSS--KAKLLLATYFGQL-QDNLQLACELPVGGLHVDAINGRAE----IGKL
METE_MARN8      NLAYH-QLKAN--RPKLLLATYFGEL-RDNLQLACELPVAGLHIDAISAPAE----VSRV
METE_RUTMC      RKAYD-ILANS--PIKLLLVSYFGTL-QDNLSFACGLPIDGLHIDAINAKDE----VQLL
METE_PSYIN      QSSYQ-KLGQS--KVKLLLTTYFGEL-KNNLKLACELPIAGLHLDAVNAPHE----IDSA
METE_SACD2      ERVYH-QLQLP--NLSVLLATYFGPL-DTNLRLAARLPTAALHLDITRGGDD----LPRV
METE_COXBU      LTTYQ-QLNFF--NLKCLLATYFGSL-DDNLSLTCQLPVDGLHIDYCRAPDQ----LDSV
METE_COXBN      LTTYQ-QLNFF--NLKCLLATYFGSL-DDNLSLTCQLPVDGLHIDYCRAPDQ----LDSV
METE_COXB1      LTTYQ-QLNFF--NLKCLLATYFGSL-DDNLSLTCQLPVDGLHIDYCRAPDQ----LDSV
METE_COXBR      LTTYQ-QLNFF--NLKCLLATYFGSL-DDNLSLTCQLPVDGLHIDYCRAPDQ----LDSV
METE_COXB2      LTTYQ-QLNFF--NLKCLLATYFGSL-DDNLSLTCQLPVDGLHIDYCRAPDQ----LDSV
METE_NITOC      ERAYS-SLVNG--GPKRLLATYFGAL-GDNTRLACQLPVEGLHIDLVSAPEQ----LAKV
METE_BIFLO      KTLYTKILSAK-GNVKVLLNTYFGHI-ADVYETVNLLGFDGIGLDLNEGREEN---LEAV
METE_BIFLD      KTLYTKILSAK-GNVKVLLNTYFGHI-ADVYETVNLLGFDGIGLDLNEGREEN---LEAV
METE_BIFAA      KSLYAKILPAREGKVKVLLNTYFGHI-ADVYETVNLLGFDGIGLDLNEGKDEN---LAAV
METE_CAMJE      EEFYQELLNHK-KDLKILLQSYFGDL-RDIYPKLLESKFDALGLDFIEGK-QS---LALV
METE_CAMJR      EEFYQELLNHK-KDLKILLQSYFGDL-RDIYPKLLESKFDALGLDFIEGK-QS---LALV
METE_CAMJJ      EEFYQELLNHK-KDLKILLQSYFGDL-RDIYPKLLESKFDALGLDFIEGK-QS---LALI
METE_CAMJ8      EEFYQELLNHK-KDLKILLQSYFGDL-RDIYPKLLESKFDALGLDFIEGK-QS---LALI
METE_CAMJD      EEFYQELLNHK-KDLKILLQSYFGDL-RDIYPKLLESKFDALGLDFIEGK-QS---LALV
METE_STRGC      LDLYKKLLADK-KGLEVLIQTYFGDV-RDIYSDLVQLPVDAIGLDFVEGK-KT---LELV
METE_STRSV      LDLYKKLLADK-KGLEVLVQTYFGDV-RDIYADLVQLPVDAIGLDFVEGK-KT---LELV
METE_STRPN      LNLYNKLLADK-KGLEVLLQTYFGDV-RDVYADLVNLPVDAIGLDFVEGK-KT---LELV
METE_STRP4      LNLYNKLLADK-KGLEVLLQTYFGDV-RDVYADLVNLPVDAIGLDFVEGK-KT---LELV
METE_STRR6      LNLYNKLLADK-KGLEVLFQTYFGDV-RDVYADLVNLPVDAIGLDFVEGK-KT---LELV
METE_STRP2      LNLYNKLLADK-KGLEVLFQTYFGDV-RDVYADLVNLPVDAIGLDFVEGK-KT---LELV
METE_STRPI      LNLYNKLLADK-KGLEVLLQTYFGDV-RDVYADLVNLPVDAIGFDFVEGK-KT---LELV
METE_STRTD      LNLYNKILADK-KGLEVLIQTYFGDV-RDVYNDLVNLPVDAIGLDFVEGK-KT---LELV
METE_STRSY      LRIYQTLLADK-KGLQVLIQTYFGDV-RDIYTELTSLPVDAIGLDFVEGK-ET---AALV
METE_LACLM      IKIYQELLKNK-NKLRVLLQTYFGDL-RNSYQEIIKLDFDGIGLDFVEGR-ES---VKLV
METE_LACLS      IKIYQELLKNK-NKLKVLLQTYFGDL-RDSYQEIIKLDFDGIGLDFVEGR-ES---VKLV
METE_LACLA      VSIYEELLKSK-NNLNILLQTYFGDV-RDSYKEIIKLDFDGIGLDFIEGR-DS---LALI
METE_DESRM      YLCYKELSNVS-NRLRLIVMTYFDHA-VEAVKILSDIPIYGIGLDFVYGQ-EN---LKVL
METE_CORGL      RAGYTTLAK----RDGVFVNTYFGSG-DQALNTLAGIGLGAIGVDLVTHGVTE---LAAW
METE_CORGB      RAGYTTLAK----RGGVFVNTYFGSG-DQALNTLAGIGLGAIGVDLVTHGVTE---LAAW
METE_COREF      RAGYARLAT----RGGVFVNTYFGAG-DQALDTLAGLGLGAIGVDLVSDGVTA---LEAW
METE_MYCA1      EAVYNKLGSAA-NRPAIYVATYFGDP-GASLAGLARTPVEAIGVDLVYGPDTA---VAAV
METE_MYCPA      EAVYNKLGSAS-NRPAIYVATYFGDP-GASLAGLARTPVEAIGVDLVYGPDTA---VAAV
METE_MYCLE      EAVYTALGSVS-KRPAIYVATYFGNP-GASLAGLARTPIEAIGVDFVCGADTS---VAAV
METE_MYCBO      EAVYTALCSVS-NRPAIYVATYFGDP-GAALPALARTPVEAIGVDLVAGADTS---VAGV
METE_MYCBP      EAVYTALCSVS-NRPAIYVATYFGDP-GAALPALARTPVEAIGVDLVAGADTS---VAGV
METE_MYCTU      EAVYTALCSVS-NRPAIYVATYFGDP-GAALPALARTPVEAIGVDLVAGADTS---VAGV
METE_MYCTA      EAVYTALCSVS-NRPAIYVATYFGDP-GAALPALARTPVEAIGVDLVAGADTS---VAGV
METE_RHOJR      KRAYDRLSGLE-LRPAILVASYFGSL-GDALPAIASTGVEGIAIDLVAGSDT----LATV
METE_STRAW      ERAYRVLGGLT-DRPKLLVASYFDRL-GDALPVLAEAPVEGLALDFAEGAAANLDALAAV
METE_STRCO      ERAYRELGALT-DRPKLLVASYFDRL-GDALPVLAKAPIEGLALDFTDAAATNLDALAAV
METE_STRGG      ARAYRELGGRA-DRPQLLVASYFGRL-GEALAVLAKAPVDGLALDFTESGAGNLDDLAAA
METE_HERA2      AACYRELSKHG----KIVVQTYYGDV-TPWYRELCRLPIHGLGLDLVQGHAN----WAAI
METE_SYNJB      EMSYRQLATAG---IPVHLVTYFDDL-GETYPWVVQLPVAGISLDFTRGHTLD---LVRT
METE_THEVB      QSTFDTLRQAN---LPLHLVTYFDDL-GAAWPWVMELPVTCISLDFTRGHNLA---LLKE
METE_TRIEI      EMAYAELAKVG---LNIHLVTYFDDL-GETYPWVMKLPVTSISLDLTRGQNLE---LIKS
METE_BACVZ      KELYESITKEL-SGLNVLLQTYFDSVDA-YEELV-SYPVQGIGLDFVHDKGRN---LDQL
METE_BACSU      KELFESITSEL-SSLNVLLQTYFDSVDA-YEELI-SYPVQGIGLDFVHDKGRN---LEQL
METE_BACLD      KEIYQTITEEV-SELNILLQTYFDSVDA-YEELI-SFPVAGIGLDFVHDKGKN---FEHL
METE_BACP2      KEIYQTITEAV-PALNILLQTYFDSVDA-YEELV-TYPVEAIGLDFVHDQGRN---LDQV
METE_BACAN      KEIYEAIRKEV-PNATLLLQTYFDSVEENYEEII-TFPVSSIGLDFVHGKEGN---LNAI
METE_BACC0      KEIYEAIRKEV-PNATLLLQTYFDSVEENYEEII-TFPVSSIGLDFVHGKEGN---LNAI
METE_BACHK      KEIYEAIRKEV-PNATLLLQTYFDSVEENYEEFI-TFPVSSIGLDFVHGKEGN---LNAI
METE_BACAH      KEIYEAIRKEV-PNATLLLQTYFDSVEENYEEII-TFPVSSIGLDFVHGKEGN---LNAI
METE_BACCZ      KEIYEAIRKEV-PNATLLLQTYFDSVEENYENII-TFPVSSIGLDFVHGKEGN---LNAI
METE_BACC7      KEIYEAIRKEV-PNANLLLQTYFDSVEENYEEII-TFPVSSIGLDFIHGKEGN---LHAI
METE_BACC1      KEIYEAIRKEV-PNANLLLQTYFDSVEENYEEII-TFPVSSIGLDFVHGKEGN---LHAI
METE_BACC2      KEIYEAIRKEV-PNANLLLQTYFDSVEENYEEII-TFPVSGIGLDFVHGKEGN---LHAI
METE_BACCR      KEIYEAIRKEV-PNATLLLQTYFDSVEENYEEII-TFPVSGIGLDFIHGKEGN---LNAI
METE_BACC4      KEIYEAIRKEV-PNATLLLQTYFDSVEENYEEII-TFPVSGIGLDFIHGKEGN---LNAI
METE_BACMK      KELYEAIHKEV-PNANLLLQTYFDSVEENYEEII-AFPVSGIGLDFVHGKEGN---VNAI
METE_BACCN      KKLYEAIQKEV-PSANLILQTYFDSVEENYTELI-TFPVSGIGLDFVHGKEGN---IKSI
METE_HALH5      TRIYEQINEAI-ADAPLFLQTYFDAVTF-YEEVV-SLPVKGIGLDFVHGGAKN---LEAL
METE_LISMO      EKVYQAFQTAV-PNLKIELQTYFESLDY-YEEVV-NLPVAAIGIDFVHDHGDS---LEAL
METE_LISMF      EKVYQAFQTAV-PNLKIELQTYFESLDY-YEEVV-NLPVAAIGIDFVHDHGDS---IKAL
METE_LISIN      EKVYKAFHDAV-PNLKIELQTYFESLDY-YEEVV-NLPVAAVGIDFVHDHGDS---IKAL
METE_LISW6      EKVYQSFQEAV-PNLKIELQTYFESLDY-YEEVV-NLPVAAIGIDFVHDHGDS---LQAL
METE_LACPL      QTALEHLHAAV-PSLKIELQTYFDSLDQ-YDKIV-TWPIQALGLDLVHDHGEN---LAHL
METE_STAAC      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGIGLDFVHDNGYN---LKQI
METE_STAA8      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGIGLDFVHDNGYN---LKQI
METE_STAAE      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGIGLDFVHDNGYN---LKQI
METE_STAAT      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGIGLDFVHDNGYN---LKQI
METE_STAA3      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGIGLDFVHDNGYN---LKQI
METE_STAAR      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAAW      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAAS      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAA1      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAAN      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAAM      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAA2      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAA9      REAYDYFEKAG-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAAB      REAYDYFEKAS-VAKKLVIQTYF-ERA-HLKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STAES      RKAYDYFANEG-LGKYLVIQTYF-ERV-HLKFLS-SLPVGGLGLDLVHDNGYN---LKQI
METE_STAEQ      RKAYDYFANEG-LGKYLVIQTYF-ERV-HLKFLS-SLPVGGLGLDLVHDNGYN---LKQI
METE_STAHJ      REAYDYFDKAG-LADKLVIQTYF-ERA-NVKFLS-SLPVGGLGLDFVHDNGYN---LKQI
METE_STRA3      KSVYDFFAREV-PQAHFIFQTYF-ESAVCLDKLS-KLPVTGFGLDFIHGRAEN---LAAV
METE_STRA5      KSVYDFFAREV-PQAHFIFQTYF-ESAVCLDKLS-KLPVTGFGLDFIHGRAEN---LAAV
METE_STRA1      KSVYDFFAREV-PQAHFIFQTYF-ESAVCLDKLS-KLPVTGFGLDFIHGRAEN---LAAV
METE_STRMU      KAVYAYFAKEV-PDAKFIFQTYF-EGLIDSQVLS-QLPVDAFGLDFVYGLEEN---LEAI
METE_THEMA      LNVYRELS-----EFPLTVFTYYDSV-SDYEACV-SLPVKRLHFDFVSNEEN----LKNL
METE_THESQ      LNVYRELS-----EFPLTVFTYYDSV-SDYEACV-SLPVKRLHFDFVSNEEN----LKNL
METE_THEP1      KDVYSEFS-----GFPLTIFTYYDSV-SDYESYV-SLPVKGLHLDFVSNTEN----LRNF
METE_AQUAE      NEIYSELSK-V--GVDLGILTYYDSV-SDYDKFV-NLPVKALHFDLVSNEEN----LKNI
METE_THEYD      TGLYRELTKGL--TLKVYIQTYYEAV-SAYEKLVFSLSVHGFGFDLVDGKEN----LENI
                                  .  *:                  . .*               

METE_RHOPA      IAK------------------GPKDLVLSLGVVDGRNIWRADLPDLLDRVEPIVQQR-GA
METE_RHOPT      IAK------------------GPKDLVLSLGVVDGRNIWRADLPDLLDRVEPIVQQR-GA
METE_NITWN      AAK------------------APHDLILSLGVIDGRNIWRANLPALLDRLEPVVSER-GA
METE_BRADU      VAD------------------GRSDLVMSLGVIDGRNVWRSNLPSLRQRLKPSIAKL-GR
METE_RHILO      GRL------------------AQKDLVLSLGLIDGRNVWRANLPAILDRIKPIVAGW-PL
METE_CAUVC      LAA------------------SRESLVLSLGVIDGRNVWRADLPALLDRLEPVVARR-GS
METE_CHESB      LSA------------------APEERVISLGVVDGRNIWRTDIAALLDRLGPIVKG--NP
METE_ACICJ      LAA------------------IGPATWLSLGLVDGRNVWRADLRAALATAREAARALGGS
METE_XYLF2      LNT------------------LPAGRVLSAGLVNGRNIWRTDLDNALTMARYAQGHV-GA
METE_XYLFT      LNT------------------LPAGRVLSAGLVNGRNIWRTDLDNALTMARYAQGHV-GA
METE_XYLFM      LNT------------------LPAGRVLSAGLVNGRNIWRTALDNALTLARYAQGRV-DK
METE_XYLFA      LNT------------------LPAGRVLSAGLVNGRNIWRTALDNALTLARYAQGRI-GK
METE_CYTH3      LTPAF----------------ISSNTMLSLGVVDGRNVWKNDFSTSSTFITKAIAAL-GK
METE_FLAJ1      LESGK----------------LASNVNLSLGVVDGRNIWKNDFKKSLELIKKAADAL-GE
METE_PARL1      LS--A----------------LPRDKLLSLGLVDGRNIWRTDMEAALTLAERAVLTL-GP
METE_SALRD      LDH-G----------------VPDDLALSLGVIDGRNVWRADLDALLGTVETAIDAL-GT
METE_DESVH      LQVLG-------AGEGTP------GLALSLGVVDGRNVWCADIDAAVNLVRRAADSL-GE
METE_DESVM      LDILTRAAARQPADSGLPQSGSQSGIALSLGVINGRNVWRVDADKAAAPVRAAVAAL-GP
METE_SYNC1      LPCLP------------------ENMVLSLGLIDGRNVWRSNLRQAISTAQDAVVAR-GS
METE_ECODH      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOLI      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECO57      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYVQIKDIVGKRD--
METE_ECO5E      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYVQIKDIVGKRD--
METE_SHIDS      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_SHIB3      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_SHIBS      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOL5      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ESCF3      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOSE      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_SHISS      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOLC      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECO24      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_SHIFL      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_SHIF8      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECO8A      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOHS      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOLU      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOUT      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECO45      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOK1      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOL6      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECOSM      HKR------------------LPSDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_ECO7I      HKR------------------LPSEWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRD--
METE_SALA4      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINALVGKRA--
METE_SALNS      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINALVGKRA--
METE_SALPA      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINALVGKRA--
METE_SALPK      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINALVGKRA--
METE_SALCH      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINALVGKRA--
METE_SALPB      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALSV      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALEP      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALG2      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALHS      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALTY      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALDC      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALTI      HQR------------------LPVDWLLSAGLINGRNVWRADLTEKYAQINAIVGKRA--
METE_SALAR      HQR------------------LPADWLLSAGLINGRNVWRADLPEKYAQINDIVGKRA--
METE_ENT38      NKR------------------LPSDWLLSAGLVNGRNVWRADLTEKYAQIKDIVGKRD--
METE_CITK8      HKR------------------LPSDWLLSAGLVNGRNVWRADLTEKYAQIKDIVGKRD--
METE_KLEP3      HNR------------------LPADWLLSAGLINGRNVWRADLTEKYAQIKDLVGKRD--
METE_KLEP7      HNR------------------LPADWLLSAGLINGRNVWRADLTEKYAQIKDLVGKRE--
METE_CROS8      HRR------------------LPQEWLLSAGVINGRNVWRADLTEKYAQLKAIAGQRE--
METE_PECAS      SAQ------------------LPANWVLSLGVINGRNVWRADLSNWFERLQPLVGTRD--
METE_ERWT9      NSK------------------VPADWLLSVGVINGRNVWRADLSSWFERLQPLVARRKR-
METE_YERPA      NKN------------------LPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRP--
METE_YERPN      NKN------------------LPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRP--
METE_YERPE      NKN------------------LPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRP--
METE_YERPP      NKN------------------LPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRP--
METE_YERPS      NKN------------------LPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRP--
METE_YERP3      HKN------------------LPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRP--
METE_YERE8      NAK------------------LPQEWLLSLGVINGRNVWRADLSHWFERLQPLVNSRP--
METE_SERP5      NKA------------------LPKEWLLSLGVINGRNVWRADLSNWFERLQPLVGSRP--
METE_PHOLL      HES------------------LPKEWVLSLGVINGRNVWRADLTAKHQLIKPLVGSRT--
METE_PROMH      HQA------------------LPKDWVLSLGVINGRNVWKADLTTRYQQVVALKGKRP--
METE_SODGM      HRQ------------------LPAEWVLSAGVINGRNVWRADLQSWFEQLRPLLGKRE--
METE_BAUCH      HRT------------------LPSNWVLSAGVINGRNVWRADLPSKFKQLRSLVGQRE--
METE_BLOFL      HEQ------------------LPKKWILSAGIINGKNIWKTNLYDWFLKLNTITH-QRS-
METE_BLOPB      HAR------------------LPKHWTLSAGVVNGRNVWKTNLHDWFKKLYPLVG-ERS-
METE_BUCAI      SSK------------------IPSEWMLSLGVINGRNIWRSDLLKWFKSIKSISNHHRK-
METE_BUCAP      NSK------------------LPKEWILSLGVINGRNVWRADLIKLFKSISTILKFRKK-
METE_BUCBP      NSF------------------IPEKWLISLGIINGKNIWKADLVMWFKRLQLFSKLRHS-
METE_BUCCC      SKS------------------INNNFLLSLGIINGRNIWKTNLLEWFYKLKDFMKINNN-
METE_VIBHA      VEK------------------LPQGWVLSAGVVNGRNVWRSDLSAQRERLQPVKDKLGDN
METE_VIBC1      IAK------------------LPEHWVLSAGVVNGRNVWRTDLSTQFARLQPVKERLGDR
METE_VIBPA      VAK------------------LPEGWVLSAGVVNGRNVWRSDLSAQLERLQPVKEKLGDK
METE_VIBVU      LAK------------------LPQNWVLSLGVVNGRNVWRSDVKAQLERLQPVKAALGER
METE_VIBVY      LAK------------------LPQNWVLSLGVVNGRNVWRSDVKAQLERLQPVKAALGER
METE_VIBCH      VNR------------------LPSDWVLSAGVINGRNVWRADLSAILARLQPVKTLLGER
METE_ALIF1      VSA------------------LPKEWVLSVGAVNGRNVWRADLERLHERLQPVKEALGDK
METE_ALIFM      VSA------------------LPKEWVLSVGAVNGRNVWRADLERLHERLQPVKEALGDK
METE_PHOPR      VDA------------------LPENWVLSAGVVNGRNVWRADLSHVLDVLQPVKAKLGQR
METE_AERS4      VPH------------------LPAQWVLSAGVINGRNVWRANLAKLAPTLKALKEKLGER
METE_SHEON      ANA------------------LRPDQILSVGVVNGRNVWAAEVDLIVERIGSVARDLCSQ
METE_BORBR      ASG------------------LRPGQVLSAGVINGRNIWRTDLDAALAMLAPVREQLQER
METE_BORPA      ASG------------------LRPGQVLSAGVINGRNIWRTDLDAALAMLAPVREQLQER
METE_BORPE      ASG------------------LRPGQVLSAGVINGRNIWRTDLDAALAMLVPVREQLQER
METE_BORPD      AAG------------------LRPGQVLSAGIIDGRNIWRTDLDAALAALAPARQLLGER
METE_BORA1      VEA------------------LHADQVLSAGVINGRNVWRTDLDQALRKLEPVARQLGDR
METE_ALCBS      IPR------------------L-GDKVLSLGVINGRNIWRTDLDAALDNITALHNELGDR
METE_ALKEH      LDR------------------LLPHKVLSLGVIDGRNVWRSDLAALARTLAPVRERLGER
METE_CHRSD      LDR------------------LPTYKVLSLGAIDGRNIWRADLAALRERLQVARARLGER
METE_PSEAE      LDR------------------LPAYKVVSLGLVNGRNVWRCDLEKALEVVRHARERLGER
METE_PSEAB      LDR------------------LPAYKVVSLGLVNGRNVWRCDLEKALEVVRHARERLGER
METE_PSEA8      LDR------------------LPAYKVVSLGLVNGRNVWRCDLEKALEVVRHARERLGER
METE_PSEE4      LDR------------------LPAYKVLSLGVVNGRNVWRCDLEKALEVLRHAHERLGDR
METE_PSEPW      LDR------------------LPAYKILSLGLVNGRNVWACDLEKAVDVLRHAAERLGDR
METE_PSEF5      LDR------------------LPAYKVLSLGLVNGRNVWRCDLEKALATLQHAHERLGER
METE_PSEMY      LDR------------------LPAYKVLSLGMVNGRNVWRCDLEKVLELLRHAHERLGER
METE_PSEA7      LDR------------------LPAYKVLSLGLVNGRNVWRCDLEKALEVLAHAHERLGER
METE_STUS1      LDR------------------LPAYKVLSLGLVNGRNVWRCDLDKALEVARHAAERLGER
METE_PSESM      LDR------------------LPSYKVLSLGVVNGRNVWRCDLDNALAALQQAHARFGDN
METE_ACIF2      LSD------------------YPADKVLSLGVVDGRNVWRADLDAALELLQPAHKQLGDR
METE_ACIF5      LSD------------------YPADKVLSLGVVDGRNVWRADLDAALELLQPAHKQLGDR
METE_ACTPJ      ED---------------------YPKVLSAGVIDGRNIWRANLNRVLDVLEPLKAKFNQR
METE_ACTP7      ED---------------------YPKVLSAGVIDGRNIWRANLNRVLDVLEPLKAKFNQR
METE_ACTP2      ED---------------------YPKVLSAGVIDGRNIWRANLNRVLDVLEPLKAKFNQR
METE_HAEIE      ED---------------------YSKVLSAGVIEGRNIWRANLNKVLDVLEPLKAKLGER
METE_HAEIG      ED---------------------YSKVLSAGVIEGRNIWRANLNKVLDVLEPLKAKLGER
METE_HAEIN      ED---------------------YSKVLSAGVIEGRNIWRANLNKVLDVLEPLKAKLGER
METE_HAES1      ED---------------------YNKVLSAGVIDGRNIWRANLNTVLDVLEPLKEKLGER
METE_HISS2      ED---------------------YNKVLSAGVIDGRNIWRANLNTVLDVLEPLKEKLGER
METE_PASMU      ED---------------------YNKVLSVGVIDGRNIWRANLNQVLDVVEPLKAKFGEN
METE_NEIMA      AD---------------------YDKVLSAGVIDGRNIWRANLNKVLETVELLQAKLGDR
METE_NEIMF      AD---------------------YDKVLSAGIIDGRNIWRANLNKVLETVEPLQAKLGDR
METE_NEIMB      AD---------------------YDKVLSAGVIDGRNIWRANLNKVLETVEPLQAKLGDR
METE_NEIM0      AD---------------------YDKVLSVGVIDGRNIWRANLNKVLETVEPLQAKLGER
METE_NEIG1      AG---------------------YDKVLSAGVIDGRNIWRANLNKVLETVGPLQAKLGER
METE_CHRVO      LPD------------------YPADKVLSAGIVDGRNIWRADLSALLDRLAPLAQQLGDR
METE_BURMA      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURM9      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURM7      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURMS      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURP1      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURPS      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURP0      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURP6      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGER
METE_BURTA      VAD------------------YPADKVLSCGIVDGRNVWRNDLDRSLARLAPVHETLGER
METE_RALPJ      -AP------------------WSADKVLSVGVVDGRNIWRTDLTRVLAHLTPLAQALGDR
METE_RALSO      -AP------------------WPADKVLSAGVVDGRNIWRTDLEQALARVAPLAQTLGER
METE_PARPJ      RAA------------------LPKHAVLSAGVIDGRNIWRADLGEIFESLQALHAEFGER
METE_PARXL      RAA------------------LPAHAVLSAGVIDGRNIWRADLGEIVESLQSLQAEFGER
METE_CUPNE      QAA------------------LPAHAVLSLGVIDGRNIWRTDLRRVLDTLRPVQAALGER
METE_CUPNH      QAA------------------LPAHAVLSLGVIDGRNIWRTDLRRVLDTLRPVQAALGER
METE_METCA      LKD------------------FPADKVLSLGLIDGRNVWRTDLRRALEQAESAGAVLGER
METE_NITEU      LTE------------------DFSGKTLSLGCIDGRNIWRADLSQKLETLSQAASRFAGE
METE_BURCM      VRE------------------LPADRVLSVGAINGRNIWKTDLNATLDWLEPLAKQLGDR
METE_BURA4      VRE------------------LPADRVLSVGAINGRNIWKTDLNATLDWLEPLAKQLGER
METE_BURO1      VRE------------------LPAERVLSVGAINGRNIWKTDLNAALDWLEPLAKQLGDR
METE_BURCH      VRE------------------LPAERVLSVGAINGRNIWKTDLNAALDWLEPLAKQLGDR
METE_BURO0      VRE------------------LPAERVLSVGAINGRNIWKTDLNAALDWLEPLAKQLGDR
METE_BURCJ      VRE------------------LPPERVLSIGAINGRNIWKTDLNATLDWLEPLAKQLGDR
METE_BURL3      ARE------------------LPAERVLSVGAINGRNIWKTDLNATLDWLEPLAKRLGDR
METE_BURVG      ARA------------------LPPTRVLSVGAIDGRNIWRTDLNAALDWLEPLARQLGER
METE_PARP8      AAQ------------------VPETAVLSVGVINGRNVWKTDLNAALAWLEPLHATLGDR
METE_THIDA      LGL------------------LPAHKVLSLGVVNGRNIWKTDLGATLDWLEPVAERLGER
METE_HAHCH      IDW------------------LPSHKVLSLGVVNGRNIWKTDLNQTLDWLQPVYDKLQSR
METE_MARN8      ADW------------------LPSHKVLSLGVVNGRNIWKSDLNSTLGWLEPLNEKLGQR
METE_RUTMC      IDS------------------LSDDKILSLGVVNGRNIWKTDLSTTLLWLEPIHQQLQNR
METE_PSYIN      IDY------------------LGTDKILSLGIINACNIWKTDLNQTLNQLLPIHQKLQDR
METE_SACD2      LDI------------------LSPHKILSVGVIDGRNIWKADLNKLLAQLKPVKERLGNG
METE_COXBU      LSQ------------------LPAEKILSVGIIDGRNIWCNDLNRSLTLLENIQSSLGDR
METE_COXBN      LSQ------------------LPAEKILSVGIIDGRNIWCNDLNRSLTLLENIQSSLGDR
METE_COXB1      LSQ------------------LPAEKILSVGIIDGRNIWCNDLNRSLTLLENIQSSLGDR
METE_COXBR      LSQ------------------LPAEKILSVGIIDGRNIWCNDLNRSLTLLENIQSSLGDR
METE_COXB2      LSQ------------------LPAEKILSVGIVDGRNIWCNDLNRSLTLLENIQSSLGDR
METE_NITOC      LDE------------------FPSYKILSAGLVDGRNIWRNDLEASLAQLEALRERLDDR
METE_BIFLO      AKY-----------------GVASNTTIFAGVINGRNIWRNNYATSLGLVDALKQV----
METE_BIFLD      AKY-----------------GVASNTTIFAGVINGRNIWRNNYATSLGLVDALKQV----
METE_BIFAA      EKY-----------------GVAEKTTIFAGVINGRNIWRNNYAVSLGLVDALKQV----
METE_CAMJE      QQY-----------------GFAKDKILFGGLINGKNIYANDYAKSLKLIKELQKY----
METE_CAMJR      QKY-----------------GFAKDKILFAGLINGKNIYTNDYAKSLKLIKELQKY----
METE_CAMJJ      QKY-----------------GFAKDKILFAGLINGKNIYANDYAKSLKLIKELQKY----
METE_CAMJ8      QKY-----------------GFAKDKILFAGLINGKNIYANDYAKSLKLIKELQKY----
METE_CAMJD      QQY-----------------GFAKDKILFAGLINGKNIYANDYAKSLKLIKELQKY----
METE_STRGC      KG------------------GFPADKTLYAGIVNGKNIWRNNYEKSLAVLEQIP------
METE_STRSV      KG------------------GFPADKTLYAGIVNGKNIWRNNYEKSLAVLEQIP------
METE_STRPN      KG------------------GFPADKTLYVGIVNGKNIWRNNYEKSLAVLEQIP------
METE_STRP4      KG------------------GFPADKTLYVGIVNGKNIWRNNYEKSLAVLEQIP------
METE_STRR6      KG------------------GFPADKTLYVGIVNGKNIWRNNYEKSLTVLEQIP------
METE_STRP2      KG------------------GFPADKTLYVGIVNGKNIWRNNYEKSLTVLEQIP------
METE_STRPI      KG------------------GFPADKTLYAGIVNGKNIWRNNYEKSLAVLEQIP------
METE_STRTD      KG------------------GFPADKTLYAGIVNGKNIWRNNYEKSLAVLEQIP------
METE_STRSY      AT------------------GFPADKTLYAGIVNGKNIWRNNYEKSLAVLDAIP------
METE_LACLM      QKY-----------------GFPKNKLLFAGVVNGKNIWRNHYQKTLSLLKDLGN-----
METE_LACLS      QKY-----------------GFPQDKLLFAGVVNGKNIWRNHYQKTLSLLKDLGN-----
METE_LACLA      QKY-----------------GFPKKKILFAGLVNGKNIWRNNYQKTLELLTALDE-----
METE_DESRM      DS--------------------LNGKKLIAGVIDGRNIWKNNYHNTLTLLKDIEKNVK--
METE_CORGL      KGE----------------------ELLVAGIVDGRNIWRTDLCAALASLKRL-AARGP-
METE_CORGB      KGE----------------------ELLVAGIVDGRNIWRTDLCAALASLKRL-AARGP-
METE_COREF      KGE----------------------ELLVAGIVDGRNVWRTDLCAALGTLRRL-QARGP-
METE_MYCA1      PELA--------------------GKTVVAGVVDGRNVWRTDLAAALDKLTTLLGSAAR-
METE_MYCPA      PELA--------------------GKTVVAGVVDGRNVWRTDLAAALDKLTTLLGSAAR-
METE_MYCLE      PELA--------------------GKTLVAGIVDGRNIWRTDLESALSKLATLLGSAAT-
METE_MYCBO      PELA--------------------GKTLVAGVVDGRNVWRTDLEAALGTLATLLGSAAT-
METE_MYCBP      PELA--------------------GKTLVAGVVDGRNVWRTDLEAALGTLATLLGSAAT-
METE_MYCTU      PELA--------------------GKTLVAGVVDGRNVWRTDLEAALGTLATLLGSAAT-
METE_MYCTA      PELA--------------------GKTLVAGVVDGRNVWRTDLEAALGTLATLLGSAAT-
METE_RHOJR      PDLT--------------------RKHVVAGVVDGRNIWRTDLDAALASLGTLLGSTGS-
METE_STRAW      GGLP--------------------GKRLVAGVVDGRNIWVNDLEKSLALLGTLLGLADR-
METE_STRCO      GGLP--------------------GKRLVAGVVNGRNIWINDLQKSLSTLGTLLGLADR-
METE_STRGG      GGLP--------------------GKRLVAGVVNGRNIWINDYAKSLATLGTLLGLADR-
METE_HERA2      QYHG-----------------FPQDKILVAGVVNGRNVWRSDLADLYTKITGLSEFVAPE
METE_SYNJB      YG-------------------FPADQILGAGVVDARNVWKVQPETVLASLRELQGVAPN-
METE_THEVB      YG-------------------FPADKQLGVGIIDGRNIWKIRPESVLSTLETIQSITAN-
METE_TRIEI      YG-------------------FPADKTLGAGVVDARNIWRIRTQEVTSLLEELKGIIPN-
METE_BACVZ      KKHG-----------------FPKDKVLAAGVIDGRNIWKIDVEERLDAALDILSHADV-
METE_BACSU      KTHG-----------------FPTDKVLAAGVIDGRNIWKADLEERLDAVLDILSIAKV-
METE_BACLD      KAHG-----------------FPKDKVLAAGILDGRNIWKANLEERLDLTLELIQRAGV-
METE_BACP2      KKHG-----------------FPKDKILAAGVIDGRNIWRSDLGERLTFVSEVIAGAQP-
METE_BACAN      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTTLQKQVQT-
METE_BACC0      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTTLQKQVQT-
METE_BACHK      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTTLQKQVQT-
METE_BACAH      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTTLQKQVQT-
METE_BACCZ      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTKLQTQVQT-
METE_BACC7      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTTLQKQVQT-
METE_BACC1      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTTLQKQVQT-
METE_BACC2      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLTLFTTLQKQVQT-
METE_BACCR      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLELFTTLQKQVQT-
METE_BACC4      SKYG-----------------FPADKTLAVGCIDGRNIWRADLDEVLELFTTLQKQVQT-
METE_BACMK      SKYG-----------------FPADKILAIGCIDGRNIWRADLDDVLSLFTTLQNQITA-
METE_BACCN      VEHG-----------------FPAEKTLAIGCIDGRNIWRANLDEVFALFETLKAHIEP-
METE_HALH5      RTFG-----------------FPEDKVLAAGIIDGRNIWISNLRERHELVHQLEQHVAK-
METE_LISMO      KAHG-----------------FPEDKYLAAGVIDGRNVWRSDLDAKLSLLTEIADYVTD-
METE_LISMF      KAHG-----------------FPEDKYLAAGVVDGRNVWRSDLDAKLELLTEIANYVAD-
METE_LISIN      KAHG-----------------FPQNKYLAAGVIDGRNVWRSDLDAKLALLTDIAHYVAE-
METE_LISW6      KTYG-----------------FPQDKYLAAGVIDGRNVWRSNLDAKLALLTDIAHYVAK-
METE_LACPL      VDHG-----------------FPTDKILAAGIIDGHNVWASDLQAKLALVQQLRQIVTD-
METE_STAAC      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAA8      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAE      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAT      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAA3      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAR      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAW      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAS      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAA1      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAN      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAM      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAA2      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAA9      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAAB      EAGD-----------------FDKSKTLYAGIIDGRNVWASDIEAKKVLIDKLLAHT---
METE_STAES      EDGD-----------------FDQSKALYAGIIDGRNVWAADIEAKKQLIETLQQHT---
METE_STAEQ      EDGD-----------------FDQSKALYAGIIDGRNVWAADIEAKKQLIETLQQHT---
METE_STAHJ      ESGD-----------------FDSSKTLYAGIIDGRNVWAADIEAKKKLIETLQGHA---
METE_STRA3      KQGL-----------------FRE-KELFAGIVNGRNIWAVNLEETLALLEEIGPFV---
METE_STRA5      KQGL-----------------FRE-KELFAGIVNGRNIWAVNLEETLALLEEIGPFV---
METE_STRA1      KQGL-----------------FRE-KELFAGIVNGRNIWAVNLEETLALLEEIGPFV---
METE_STRMU      KTGA-----------------FKG-KEIFAGVIDGRNIWSSDFVKTSALLETIEEQS---
METE_THEMA      EKHG-----------------FPEDKKLVAGVINGRQPWKVDLRKVASLVEKL-------
METE_THESQ      EKHG-----------------FPEDKKLVAGVINGRQPWKVDLRKVASLVEKL-------
METE_THEP1      EKHG-----------------FPSDKTLIAGVINGRQPWRANLKKVAELVDKL-------
METE_AQUAE      KEKG-----------------FPEDKELIAGIINGRQPWRANLREKVKLLEELLKVS---
METE_THEYD      LTLG-----------------FPSDKVLIAGVVSGRDPWRTDFTVVMSMLERLFRVT---
                                           :  * :.. : :                     

METE_RHOPA      ER--VQLAPSCSLLHVPVDLELETG---LDPDLKSWLSFSLQKMGELSTLSRALSGDR--
METE_RHOPT      ER--VQLAPSCSLLHVPVDLELETG---LDPDLKSWLSFSLQKMGELSTLSGALSGDR--
METE_NITWN      DR--VQIAPSCSLLHVPIDVSLETD---LDAELKSWLAFSVQKMGELATLGEALAKGR--
METE_BRADU      HR--VQLAPSCSLLHVPVDVELETG---LASDVKSWLAFSVQKMRELAILARVLAGD---
METE_RHILO      DR--VEIAPSCSMLHVPIDLDMETA---LDADVKSWLAFAAQKTDELVVLARALAEGR--
METE_CAUVC      DR--VVLAPSCSLLHTPIDLDLETA---LDPEIRQWLAFAVQKVEALAVLAQALNGGR--
METE_CHESB      GR--FQLAPSCSLLHVPLDLSIETG---VDPELRSWLAFAVQKVEELSILSHALSADR--
METE_ACICJ      ER--LMIAPSCSLLHVPVDLAQEDR---LDPAIRPWLAFATQKLAEVATIARGLDEGE--
METE_XYLF2      DR--LWLAPSCSLLHVPVDLEQEKN---LDADVRNWLAFAKQKLSELRVLADALDNK---
METE_XYLFT      DR--LWLAPSCSLLHVPVDLEQEKN---LDADVRNWLAFAKQKLSELRVLADALDNK---
METE_XYLFM      DH--LWLAPSCSLLHVPVDLEQEKN---LDADVRNWLAFAKQKLSELRVLADALDNK---
METE_XYLFA      DH--VWLAPSCSLLHVPVDLEQEKN---LDADVRNWLAFAKQKLSELRVLADALDNK---
METE_CYTH3      ER--VMIAPSCSLLHVPCDLDNEKNGNVLTPEIKNWMAFAKQKLHEVAALKKLNRAPMQ-
METE_FLAJ1      NR--ILLAPSCSLIHSPCDLDLETNDQTLTPEIKQWLAFAKQKINEVVLLKQFASGEVN-
METE_PARL1      KR--VMISAACSLLHVPFSLAGEKS---LDPELKSWLAFAEEKLGELAVLARGVKEGR--
METE_SALRD      DR--VLVGPSCSLLHVPVDLDTEPG---LSDEMKTWFAFATQKIEEIVALAERADGHE--
METE_DESVH      DR--VWVAPSCSLLHCPVDLGSERE---LDPEVARWLAFARQKCAEVRLVAEVV---RGV
METE_DESVM      DR--VWVAPSCSLLHCPVDLDAETG---LDPEVAQWLAFARQKCAEVRLVADMCDLNGRA
METE_SYNC1      DR--VMIAPSCSLLHVPVDLAGEAV---LDPRIRSWLAFARQKCQEVNVVRLALD-----
METE_ECODH      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOLI      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECO57      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLCDALNS----
METE_ECO5E      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_SHIDS      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDVLNS----
METE_SHIB3      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALKS----
METE_SHIBS      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOL5      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDVLNS----
METE_ESCF3      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOSE      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_SHISS      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOLC      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECO24      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_SHIFL      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_SHIF8      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECO8A      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOHS      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOLU      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELSLLRDALNS----
METE_ECOUT      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECO45      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOK1      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOL6      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECOSM      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_ECO7I      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCHELALLRDALNS----
METE_SALA4      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALNS      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALPA      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALPK      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALCH      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALPB      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALSV      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALEP      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALG2      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALHS      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALTY      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALDC      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALTI      ----LWVASSCSLLHSPIDLSVETRL---DTEVKSWFAFALQKCGELALLRDALNS----
METE_SALAR      ----LWVSSSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCGELALLRDALNS----
METE_ENT38      ----VWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCEELALLRDALNS----
METE_CITK8      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCGELALLRDALNS----
METE_KLEP3      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCGELALLRDALNS----
METE_KLEP7      ----LWVASSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCGELALLRDALNS----
METE_CROS8      ----LWVGSSCSLLHSPIDLSVETRL---DAEVKSWFAFALQKCEELALLRDALNS----
METE_PECAS      ----LWLGSSCSLLHSPIDLSVEVRL---DDEVKSWFAFAIQKCAELSLLSQALNS----
METE_ERWT9      ----LWIGSSCSLLHSPIDLSVETRL---DEEVKSWFAFALQKCSELALLSSALNN----
METE_YERPA      ----LWLGSSCSLLHSPIDLNEETRL---DAEVKSWFAFALQKCAELALLTQALNAPND-
METE_YERPN      ----LWLGSSCSLLHSPIDLNEETRL---DAEVKSWFAFALQKCAELALLTQALNAPND-
METE_YERPE      ----LWLGSSCSLLHSPIDLNEETRL---DAEVKSWFAFALQKCAELALLTQALNAPND-
METE_YERPP      ----LWLGSSCSLLHSPIDLNEETRL---DAEVKSWFAFALQKCAELALLTQALNAPND-
METE_YERPS      ----LWLGSSCSLLHSPIDLNEETRL---DAEVKSWFAFALQKCAELALLTQALNAPND-
METE_YERP3      ----LWLGSSCSLLHSPIDLNEETRL---DAEVKSWFAFALQKCAELALLTQALNAPND-
METE_YERE8      ----LWLGSSCSLLHSPIDLSEETRL---DAEVKSWFAFALQKCAELALLTQALNAPSE-
METE_SERP5      ----LWIGTSCSLLHSPIDLSVETRL---DEEVKSWFAFALQKCGELALLSAALNAPGA-
METE_PHOLL      ----LWIGSSCSLLHSPIDLSDETAL---DAEVKSWFAFALQKCEELALLTAALNQPDG-
METE_PROMH      ----LWIGTSCSLLHSPIDLSAETKL---DDEVKSWFAFAVQKCAEVALLAKALNAPEG-
METE_SODGM      ----LWLGSSCSLLHSPIDLSTETQL---DEEVKSWFAFALQKCAELGLLRAALNAPDE-
METE_BAUCH      ----LWVGSSCSLLHSPIDLSIETRM---DPEVKSWFAFTIQKCNELKLLCNALNRLDDT
METE_BLOFL      ----LWIGSSCSLLHSPIDLNIESKL---NNNIKNWFAFAIQKCSEIKLLCDALNSNHND
METE_BLOPB      ----LWIGSSCSLLHSPIDLNTEIKL---DKHIKEWFAFALQKCYEIKMLCAALNAENTS
METE_BUCAI      ----ILIGSSCSLLHTPIDLVAEKHL---DKEVKRWFSFAVQKCEELRLLSSALND----
METE_BUCAP      ----LLIGSSCSLLHSPIDLQKEKNL---DKESKKWFSFAVQKCTELSLLSKALNK----
METE_BUCBP      ----LWIGTSCSLLHVPIDLKLENKI---SSEVRSWFSFALQKCQELTLLRDALNNSN--
METE_BUCCC      ----FWISSSCSLLHVPLDITIEENL---TDFVKSWFSFGIQKCLEISLLSQVLQN-N--
METE_VIBHA      ----LWVASSCSLLHSPVDLDLEPAL---SDEVKSWFAFAKQKVTEVALLGRALDGDHN-
METE_VIBC1      ----LWVASSCSLLHSPVDLDLEPAL---SDEVKSWFAFAKQKVTEVALLGRALDGDRN-
METE_VIBPA      ----LWVASSCSLLHSPVDLELETEL---SEEVKSWFAFAKQKVTEVALLGRALDGDQN-
METE_VIBVU      ----LWVASSCSLLHSPVDLELEAGL---SAEVRSWFAFAKQKVSEVVLLGKALDGDAA-
METE_VIBVY      ----LWVASSCSLLHSPVDLELEAGL---SAEVRSWFAFAKQKVSEVVLLGKALDGDAA-
METE_VIBCH      ----LWVASSCSLLHSPVDLDLEGDL---SAETRSWFAFAKQKVTEVALLGRALEGDAA-
METE_ALIF1      ----LWIASSCSLLHSPVDLDQETEL---SKETLQWFAFAKQKLREVTLLADALDGNQN-
METE_ALIFM      ----LWIASSCSLLHSPVDLEQETEL---SKETLQWFAFAKQKLREVTLLADALDGNQN-
METE_PHOPR      ----LWVGSSCSLLHSPIDLDLETDL---SPEVRQWLSFAKQKCREF-LVAQALDGNAI-
METE_AERS4      ----LWVASSCSLLHSPVDLTLEHEL---DPQTRSWFAFALQKCYELGLLSDYLDGGD--
METE_SHEON      DGSRLWIGTSCSLLHSPVDLEVETTL---APTLRQQLAFAKQKLLELANVRQLLQAP---
METE_BORBR      ----LWLAPSCSLLHVPVDLAGETEL---DAELLGWLSFAVQKLDELCLLGKALGGDADP
METE_BORPA      ----LWLAPSCSLLHVPVDLAGETEL---DAELLGWLSFAVQKLDELCLLGKALGGDADP
METE_BORPE      ----LWLAPSCSLLHVPVDLAGETEL---DAELLGWLSFAVQKLDELCLLGKALGGDADP
METE_BORPD      ----LWLAPSCSLLHVPVDLANETDL---DAELRSWLSFAAQKLDELGLLGRALADARAP
METE_BORA1      ----LWLAPSCSLLHVPVDLLAETEL---DAELKSWLSFASQKLDELSLLGRALDGDSSQ
METE_ALCBS      ----LWLAPSCSLLHCPVDLEQEDTL---DNELKSWLSFAKQKLEELALLGGALRGNSN-
METE_ALKEH      ----LWLAPSCSLLHVPVDLDLETEL---QPQLRRWLAFARQKLDELVVLGRLLGDRAGA
METE_CHRSD      ----LWISASCSLLHVPVDLDAETDL---DAELKSWLAFARQKLDEIVTLAHLLDGRATP
METE_PSEAE      ----LWVAPSCSLLHSPVDLEREDGL---DAELKSWLAFAVQKCREVAVLARAATEPEAA
METE_PSEAB      ----LWVAPSCSLLHSPVDLEREDGL---DAELKSWLAFAVQKCREVAVLARAATEPEAA
METE_PSEA8      ----LWVAPSCSLLHSPVDLEREDGL---DAELKSWLAFAVQKCREVAVLARAATEPEAA
METE_PSEE4      ----LWVAPSCSLLHSPVDLAREDKL---DDELKSWLAFAVQKCQEVALLAKAINQPEAA
METE_PSEPW      ----LWVAPSCSLLHSPVDLGREDQL---DTELKSWLAFAVQKCQEVAVLAKAVNQPDAA
METE_PSEF5      ----LWVAPSCSLLHSPVDLDREDQL---DAELKSWLAFAVQKCQEVAVLAQAVNQPQAR
METE_PSEMY      ----LWVAPSCSLLHSPVDLEREDQL---DAELKSWLAFAVQKCQEVALLGRALEAPDDA
METE_PSEA7      ----LWVAPSCSLLHSPVDLCREDQL---DEELQSWLAFAVQKCEEVAILARALVEPEAP
METE_STUS1      ----LWLAPSCSLLHSPVDLEREDRL---DEEVKSWLAFAVQKCSEVATLARAIDDPQDA
METE_PSESM      ----LWVAGSCSLLHSPVDLNREDRL---DPELKGWLAFAVQKSREIAILSHALNDPEAT
METE_ACIF2      ----LWVAPSCSLLHTPVDLEQETEL---DAELKSWLSFSVQKLDEVAIIGRALKEGVES
METE_ACIF5      ----LWVAPSCSLLHTPVDLEQETEL---DAELKSWLSFSVQKLDEVAIIGRALKEGVES
METE_ACTPJ      ----LWIAPSCSLLHTPYDLAVETQLQQNNPELYRWLAFTLQKVAELQVLKQALNAGRSA
METE_ACTP7      ----LWIAPSCSLLHTPYDLAVETQLQQNNPELYRWLAFTLQKVAELQVLKQALNAGRSA
METE_ACTP2      ----LWIAPSCSLLHTPYDLAVETQLQQNNPELYRWLAFTLQKVAELQVLKQALNAGRDA
METE_HAEIE      ----LWIAPSCSLLHTPFDLEVEVQLKEKNTALYSWLSFTLQKVEELNVLKQALNNGRAS
METE_HAEIG      ----LWIAPSCSLLHTPFDLEVEVQLKEKNTALYSWLSFTLQKVEELNVLKQALNNGRAS
METE_HAEIN      ----LWIAPSCSLLHTPFDLEVEVQLKEKNTALYSWLSFTLQKVEELNVLKQALNNGRAS
METE_HAES1      ----LWIAPSCSLLHTPFDLNVETQLQENNPALYSWLAFTLQKVQELSVLKTALEKGRTA
METE_HISS2      ----LWIAPSCSLLHTPFDLNVETQLQENNPALYSWLAFTLQKVQELSVLKTALEKGRNA
METE_PASMU      ----LWIAPSCSLLHTPYDLEVETQLKANKPELYSWLAFTLQKVQELRVIKTALEQGRGA
METE_NEIMA      ----LWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQKTQELRVLKAALNEGRDS
METE_NEIMF      ----LWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQKTQELRVLKAALNEGRDS
METE_NEIMB      ----LWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQKTQELRVLKAALNEGRDS
METE_NEIM0      ----LWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQKTQELRVLKAALNEGRDS
METE_NEIG1      ----LWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQKTQELRVLKAALNEGRDS
METE_CHRVO      ----LWLAPSCSLLHSPFDAAAETGL---DPELKNWLAFAVQKLNELKTLKRGLEHGRSA
METE_BURMA      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURM9      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURM7      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURMS      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURP1      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURPS      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURP0      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURP6      ----LWVATSCSLLHVPVDLAHEPRL---DEELKTWLAFAAQKTREVAALRDALVKGRAA
METE_BURTA      ----LWIATSCSLLHAPVDLAHEPKL---DDELKAWLAFAVQKTREVAALRDALAKGRAA
METE_RALPJ      ----LWIAPSCSLLHVPVDLSAETKL---DDELKGWLAFARQKLDELAVIKRALVEGPAA
METE_RALSO      ----LWLAPSCSLLHVPVDLAAETRL---DDELKGWLAFARQKLDELAVLKRAVIDGRDA
METE_PARPJ      ----LWVSSSCSLLHVPVSLDAEQKL---DADLKSWLAFATEKLGEVATLALAL-RDPAA
METE_PARXL      ----LWIAPSCSLLHVPVSLDAEKKL---DADLKSWLAFATEKLAEVATLALAL-RDPAA
METE_CUPNE      ----LWLAPSCSLLHVPVSLAHEVRL---DVELKSWLAFATEKLDELSVLGRALNQSDAV
METE_CUPNH      ----LWLAPSCSLLHVPVSLAHEVRL---DVELKSWLAFATEKLDELSVLGRALNQGDAV
METE_METCA      ----LWLAPSCSLLHVPQDLSLETSL---NPEIKDWLAFAVQKLEELAVIDKGLRLGRQA
METE_NITEU      ----LWIAPSCSLLHCPVDLALETKL---EPEIKNWLAFSAQKLEEMTTLGRGLNQGRES
METE_BURCM      ----LWIAPSCSLLHVPVDLASEEKL---DAEIRSWLAFALQKLDELKVLATALNQGRDK
METE_BURA4      ----LWIAPSCSLLHVPVDLASEQKL---DPEIRSWLAFALQKLDELNVLATALNEGRDK
METE_BURO1      ----LWLAPSCSLLHVPVDLASEEKL---DAEIRSWLAFALQKLDELKVLATALNEGRDK
METE_BURCH      ----LWLAPSCSLLHVPVDLASEEKL---DAEIRSWLAFALQKLDELKVLATALNEGRDK
METE_BURO0      ----LWLAPSCSLLHVPVDLASEEKL---DAEIRSWLAFALQKLDELKVLATALNEGRDK
METE_BURCJ      ----LWLAPSCSLLHVPVDLANEAKL---DAEIRSWLAFALQKLDELKVLATALNEGRDT
METE_BURL3      ----LWLAPSCSLLHVPVDLASEEKL---DAEIRSWLAFALQKLDELKVLATALNEGRDK
METE_BURVG      ----LWLAPSCSLLHVPVDLASEQKL---DAEIRSWLAFALQKLAELKLLATALNQGRDT
METE_PARP8      ----LWIAPSCSLLHSPVDLNSERKL---DADIRSWLAFALQKLDELTLLASALNNGRAC
METE_THIDA      ----LWIAPSCSLLHVPVDLDSEDAL---DGEIKSWLAFAKQKLDELRVLVAALNHGRDT
METE_HAHCH      ----LWLAPSCSLLHSPVDLDSEEKM---DAEIKSWLAFALQKLDEVKILATALSEGRNT
METE_MARN8      ----LWLAPSCSLLHAPVDLSREQEL---DSDIRNWLAFAVQKLDELQILARALNEGRSS
METE_RUTMC      ----LWLAPSCSLLHVPVDLDSEQEL---NDDIKSWLGFAVQKLEELSLLAQALNQGQAS
METE_PSYIN      ----LWLAPSSSLLHVPIDLNNEDKL---DYEVKSWLAFAVQKLQELSLIGRALNDGLSS
METE_SACD2      ----LWLAPSCSLLHTPVDLDSEEAL---DADIKNWLAFAKQKLQELNILQRALDNGETS
METE_COXBU      ----LWVAPSCSLLHVPIDLDQENKL---DVELKSWFAFAKQKVAEAAFLTRGLREGRES
METE_COXBN      ----LWVAPSCSLLHVPIDLDQENKL---DVELKSWFAFAKQKVAEAAFLTRGLREGRES
METE_COXB1      ----LWVAPSCSLLHVPIDLDQENKL---DVELKSWFAFAKQKVAEAAFLTRGLREGRES
METE_COXBR      ----LWVAPSCSLLHVPIDLDQENKL---DVELKSWFAFAKQKVAEAAFLTRGLREGRES
METE_COXB2      ----LWVAPSCSLLHVPIDLDQENKL---DVELKSWFAFAKQKVAEAAFLTRGLREGRES
METE_NITOC      ----LWIAPSCSLLHSPMDLALESAL---DEELKSWLAFAVQKIEEVATLKRALVEGRDV
METE_BIFLO      -TANVAVSTASSLLHVPFSTEGETGI---PAEDLKHFAFAVQKLDELKEVAALADATEDE
METE_BIFLD      -TANVAVSTASSLLHVPFSTEGETGI---PAEDLKHFAFAVQKLDELKEVAALADATEDE
METE_BIFAA      -TANVAVSTASSLLHVPFSTEGEDGL---ADDVRKHFAFAVQKLDELHEVAVLADASDDE
METE_CAMJE      -TQNIILNTSCSLLHVPYSTEFESKL---DSSYLKLFAFAKEKLQELKDLKEILNS----
METE_CAMJR      -TQNIILNTSCSLLHVPYSTEFESKL---DSNYLKLFSFAKEKLQELKDLKEILNS----
METE_CAMJJ      -TQNIVLNTSCSLLHVPYSTEFESKL---DSSYLKLFAFAKEKLQELKDLKEILNS----
METE_CAMJ8      -TQNIVLNTSCSLLHVPYSTEFESKL---DSSYLKLFAFAKEKLQELKDLKEILNS----
METE_CAMJD      -TQNIILNTSCSLLHVPYSTEFESKL---DPSYLKLFAFAKEKLQELKDLKEILNS----
METE_STRGC      -AENIVLTSSCSLLHVPFTTANE-EF---EPAILNHFAFAVEKLDEIRDLDAIRNG----
METE_STRSV      -AENIVLTSSCSLLHVPFTTANE-EF---EPAILNHFAFAVEKLDEIRDLDAIRNG----
METE_STRPN      -AENIVLTSSCSLLHVPFTTANE-EF---EPALLNHFAFAVEKLDEIRDLDAIRNG----
METE_STRP4      -AENIVLTSSCSLLHVPFTTANE-EF---EPALLNHFAFAVEKLDEIRDLDAIRNG----
METE_STRR6      -AENIVLTSSCSLLHVPFTTANE-EF---EPALLNHFAFAVEKLDEIRDLDAIRNG----
METE_STRP2      -AENIVLTSSCSLLHVPFTTANE-EF---EPALLNHFAFAVEKLDEIRDLDAIRNG----
METE_STRPI      -AENIVLTSSCSLLHVPFTTANE-EF---EPALLNHFAFAVEKLDEIRDLDAIRNG----
METE_STRTD      -AEKIVLTSSCSLLHVPFTTANE-EF---EPAILNHFAFAVEKLDELRDLDAIRNG----
METE_STRSY      -AENVVITTSCSLLHVPFTTANE-EF---EPAILNHFAFAVEKLSELRDLDAIRNG----
METE_LACLM      -IDNIVINTSCSLQHVPVTTENETKL---SKEILNHFAFAKEKLVEVSEISEIYVK----
METE_LACLS      -IDNIVINTSCSLQHVPVTTENEIKL---SKEILNHFAFAKEKLVEVSEISEIYVK----
METE_LACLA      -VADIVINTSCSLQHVPVTIKNETKL---SKEILKHFSFATEKLNEIDEISDIYFN----
METE_DESRM      -KEDIILSTTCSLLHVPYSLKHENHL---DKDIKSWMSFAREKLDELSDLAKLFFVENNS
METE_CORGL      ----IAVSTSCSLLHVPYTLEAEN----IEPEVRDWLAFGSEKITEVKLLADAL------
METE_CORGB      ----IAVSTSCSLLHVPYTLEAEN----IEPEVRDWLAFGSEKITEVKLLADAL------
METE_COREF      ----VAVSTSCSLLHVPYALTAETG---LNPEVREWLAFGEEKVREVVALADAL------
METE_MYCA1      ----VAVSTSCSTLHVPYSLEPETD---LDDALRSWLAFGREKVAEVVTLARALRDGREA
METE_MYCPA      ----VAVSTSCSTLHVPYSLEPETD---LDDALRSWLAFGREKVAEVVTLARALRDGREA
METE_MYCLE      ----VAVSTSCSTLHVPYSLEPETD---LDDNLRSWLAFGAEKVAEVVVLARALRDGRDA
METE_MYCBO      ----VAVSTSCSTLHVPYSLEPETD---LDDALRSWLAFGAEKVREVVVLARALRDGHDA
METE_MYCBP      ----VAVSTSCSTLHVPYSLEPETD---LDDALRSWLAFGAEKVREVVVLARALRDGHDA
METE_MYCTU      ----VAVSTSCSTLHVPYSLEPETD---LDDALRSWLAFGAEKVREVVVLARALRDGHDA
METE_MYCTA      ----VAVSTSCSTLHVPYSLEPETD---LDDALRSWLAFGAEKVREVVVLARALRDGHDA
METE_RHOJR      ----LAVSTSCSLLHVPYTLDAETG---IDKALRSWLAFGTEKVREVVTLGTALTSGRES
METE_STRAW      ----VDVAASCSLLHVPLDAAAERD---IAPQVLRWLAFARQKTAEIVTLAKGLGHGTDA
METE_STRCO      ----VDVSASCSLLHVPLDTGAERD---IEPQILRWLAFARQKTAEIVTLAKGLAQGTDA
METE_STRGG      ----VDVSASCSLLHVPLDADAERG---IDPETARWLAFAKQKTEEIVVLARGLGSGTDA
METE_HERA2      ---RLILSSSCSLLHLPETVTAERNL---PVAVSSGLAFAQERLAELELLANALRDGIAS
METE_SYNJB      ----LRVQPSASLQFVPHDAALEAQL---PEPLRNVLSFAEQKLAEVALLARALNGED--
METE_THEVB      ----IRLHPSSSLQFVPYDAKREVKL---PEPLRDVLSFAEQKLDEVVLLARVLNSNDGT
METE_TRIEI      ----ISVQPSASLQFVPYDVRREVKL---PEALRNVLSFAEQKLEETVLLSKALTGKS--
METE_BACVZ      --EELWIQPSSSLLHVPVAKHPDEH---LEKDLLNGLSYAKEKLAELGVLKEGLLSGKAA
METE_BACSU      --DELWIQPSSSLLHVPVAKHPDEH---LEKDLLNGLSYAKEKLAELTALKEGLVSGKAA
METE_BACLD      --DEVWIQPSNSLLHVPVAKHPGEH---LADDLLNGLSFAKEKLLELTLLKNGLVSGKAA
METE_BACP2      --KEVWLQPSSSLLHVPVAKHPSEQ---LEEKLLNGLSYATEKLAELTTLKEGLTKGAAA
METE_BACAN      --KDLIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACC0      --KDLIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLTHSALTQGTES
METE_BACHK      --KDLIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACAH      --KDLIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACCZ      --KDFIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACC7      --KNFIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACC1      --KDFIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACC2      --KDFIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTKGTES
METE_BACCR      --KDIIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACC4      --KDIIVQPSCSLLHTPIDKTEETH---LSTELFDALAFANQKLEELVLIHSALTQGTES
METE_BACMK      --KGLIVQPSCSLLHTPIDKTEETH---LTSELFDALAFANQKLEELVLIHSALTKGVES
METE_BACCN      --KDWIIQPSCSLLHTPVDKTEETH---LSPELFDALAFANQKLEELTLIKRGLSEGVNS
METE_HALH5      --DRLVLQPSCSLLHVPVTTKREEK---LDPTLLGVLAFANEKLTELHTLKQLAAGNEAE
METE_LISMO      --GKLIVQPSNSLLHVPVTKLSEPD---LDEVILGGLSFADQKLDEIAILTKALTDGAES
METE_LISMF      --GKLIVQPSNSLLHVPVTKLSEPD---LDEVILGGLSFADQKLEEITILTKALTNGAES
METE_LISIN      --DKLIVQPSNSLLHVPVTKLSEPD---LDEVILGGLSFADQKLDEIAILTKALTEGAES
METE_LISW6      --DKLIVQPSNSLLHVPVTKLSEPD---LDEVILGGLSFADQKLDEIVILTKALTEGVES
METE_LACPL      --DQLWLQPANSLLHVPITTKNETK---ADPVLLGGLAFADQKLAELHTLTVAANQGVAA
METE_STAAC      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAA8      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAAE      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAAT      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAA3      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAAR      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAAW      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAAS      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDSV
METE_STAA1      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLLNQNDSV
METE_STAAN      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLLNQNDSV
METE_STAAM      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLLNQNDSV
METE_STAA2      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLLNQNDSV
METE_STAA9      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLLNQNDSV
METE_STAAB      --NELVIQPSSSLLHVPVSLDDET----LDTSVGEGLSFATEKLDELDALRRLFNQNDNF
METE_STAES      --QQLVIQPSSSLLHVPVSLDDET----LDESIAEGLSFATEKLDELDALRRLFNDNDLS
METE_STAEQ      --QQLVIQPSSSLLHVPVSLDDET----LDESIAEGLSFATEKLDELDALRRLFNDNDLS
METE_STAHJ      --KHIVIQPSSSLLHVPVSLDDET----LEQSIEEGLSFATEKLDELDALRRLFNQNDSA
METE_STRA3      --KRLTLQPSSSLLHVPVTTKYETH---LDPVLKNGLSFADEKLKELELLASAFDGNKTK
METE_STRA5      --KRLTLQPSSSLLHVPVTTKYETH---LDPVLKNGLSFADEKLKELELLASAFDGNKTK
METE_STRA1      --KRLTLQPSSSLLHVPVTTKYETH---LDPVLKNGLSFADEKLKELELLASAFDGNKTK
METE_STRMU      --AALTIQPSCSLLHVPVTTKNETD---LDPVLRNGLAFADEKLTEVKRLAEHLDGREDP
METE_THEMA      --GASAISNSCPLFHLPVTLELE---NNLPGGLKEKLAFAKEKLEELKMLKDFLEG----
METE_THESQ      --GASAISNSCPLFHLPVTLELE---NNLPGGLKEKLAFAKEKLEELKMLKDFLEG----
METE_THEP1      --GASAISNSCPLFHLPITAQWE---NSLPDGLREKLAFAKEKLEELKVLKEFFEG----
METE_AQUAE      --ANLVVSNSCPLYHLPVTVEPE---DELPEGLKERLSFAKEKLREIRLIKEALEG----
METE_THEYD      --DKIMLSNSSPLIHLPITVEAER--GHIQEDILNMLSFANERLEELTILKRAIND----
                      :  : .  . *                   :.:  ::                 

METE_RHOPA      ---AAVQDQLSASAKAAATRRKSPKVHDMAVSSRAAAVTPAMTQRNSGFAARATLQHQRL
METE_RHOPT      ---AAVQDQLSASAKAAATRRKSPKVHDMAVSSRAAAVTPAMTQRNSGFAARATLQHQRL
METE_NITWN      ---ASVADALKASADAAAARKASPKVHDAKVEGRIAAVTSDMARRKSAFAERAKLQRERF
METE_BRADU      ---QNVGLALAESECAATARRTSPKIHNANVAVRMRAIDQTMRQRATPFARRSEIQRERF
METE_RHILO      ---DAVAAELEASAEAAAARATSAKVHDPLVEGRVASIKVAMTRRKSAFDVRSKLQGDTF
METE_CAUVC      ---ASVAAALEASAQAARARATSPRIHDPKVAERLAAVTPDMTRRRSPYDQRREAQRARL
METE_CHESB      ---SLVQSLIDMASRALAVRASSTRVNDPHVAGRLSAVTPEMAKRSEPFSERRKLQQERL
METE_ACICJ      ---GAIAEALEASDAALRTRRDSARVHRTDVAARLLGATPEMERRPAPHAARRARQRQRL
METE_XYLF2      ---PEAETALTQTRQALEARRQSPKVHRPDVAQRLAALTPDTTRRNTAYPQRSQAQQHTL
METE_XYLFT      ---PEAETALTQTRQALEARRQSPKVHRPDVAQRLAALTPDTTRRNTAYPQRSQAQQHTL
METE_XYLFM      ---PEAETALTQTRQALEARRQSPKVHRPDVAQRLAALTPDTTRRNTAYPQRSQAQQHTL
METE_XYLFA      ---PEAETALTQTRQALEARRQSPKVHRPEVAQRLAALTPDTTQRNTAYPQRSQAQQQTL
METE_CYTH3      ---SEELRLLKANTESIENRAKSKLIHKQHVKARVKAVQPSDSQRKSLFKSRQQIQEKAL
METE_FLAJ1      ---PKNSADYERNVIANENRKTSKLIHNNEVKARTAGITAADDKRKSAFASRRKSQIKAL
METE_PARL1      ---TSISTELAENAALFEARRNSPRIHNPAVRARVRDIDPHADRRGRPFADRQSIQQKRF
METE_SALRD      ---DATEALFEKSRRAHAARAESDWINDAAVQDRVAGIDASMTERDSPHSSRSPLQREAL
METE_DESVH      YG-PSTAASLEANREVRRQRAVSPRIHDPAVASRLAAVTSDMEHRTSPYAERIVAQRAAL
METE_DESVM      DA-PETAAALARNRAALAARAASPVIHDPAVAVRAGTVTPEMGWRATPYTARIAAQRAAL
METE_SYNC1      -G-EDVTEVLQANDTAMENRRKSALVHRDAVRRRMADISPDMYCRRSSFEER-KKQQAWL
METE_ECODH      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOLI      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECO57      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECO5E      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_SHIDS      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_SHIB3      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_SHIBS      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOL5      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRTNVYEVRAEAQRARF
METE_ESCF3      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOSE      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_SHISS      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOLC      ----GDTAALAEWSAPIQARRNSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECO24      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_SHIFL      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_SHIF8      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECO8A      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOHS      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOLU      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOUT      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECO45      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOK1      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOL6      ----GDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECOSM      ----GDTAALAAWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_ECO7I      ----GDTAALAAWSAPIQARRHSTRVHNPAVEKRLAAITAQDSQRANVYEVRAEAQRARF
METE_SALA4      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALNS      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALPA      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALPK      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALCH      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALPB      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALSV      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALEP      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQASQRENPYEVRAEAQRARF
METE_SALG2      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQASQRENPYEVRAEAQRARF
METE_SALHS      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALTY      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALDC      ----GETAALEEWSAPIQARRHSRRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALTI      ----GETAALEEWSVPIQARRHSHRVHNAAVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_SALAR      ----GDTAAVTEWSAPIQARRHSTRVHNVGVEKRLAAITAQDSQRENPYEVRAEAQRARF
METE_ENT38      ----GDTAKLVEWSAPIQARRHSTRVHNAAVEKRLAAITAKDSQRENAYEVRAEAQRARF
METE_CITK8      ----GDTAKLEAWSAPIQARRHSTRVHNAAVEKRLAAITAQDSQRASPYAARAQAQRNRF
METE_KLEP3      ----GDTAAITEWSAPIQARRHSTRVHNAEVEKRLAAITAQDSQRASPYEVRAQAQRQRF
METE_KLEP7      ----GDTAAITEWSAPIQARRHSTRVHNAEVEKRLAAITAQDSQRASPYEVRAQAQRQRF
METE_CROS8      ----GDTTKIEQWSAPIQARKHSARVHNPAVEQRLKAITPQDSQRAHAYPVRAEAQRARF
METE_PECAS      ----GNGQALEAYSAPIRARRTSTRVNNVAVAQRLAAITAQDSQRQNVYSVRADAQRERF
METE_ERWT9      ----NDPASLEAWSAPIRSRKHSTRVHNAAVGQRLAAISPQDSLRKNRYPVRAKAQRQRF
METE_YERPA      ----AKLAELAAYSAPIRARRSSSRVHNAQVEQRLAAITSQDIERQLPYEARAETQRKRF
METE_YERPN      ----AKLAELAAYSAPIRARRSSSRVHNAQVEQRLAAITSQDIERQLPYEARAETQRKRF
METE_YERPE      ----AKLAELAAYSAPIRARRSSSRVHNAQVEQRLAAITSQDIERQLPYEARAETQRKRF
METE_YERPP      ----AKLAELAAYSAPIRARRSSSRVHNAQVEQRLAAITSQDIERQLPYEARAETQRKRF
METE_YERPS      ----AKLAELAAYSAPIRARRSSSRVHNAQVEQRLAAITSQDIERQLPYEARAETQRKRF
METE_YERP3      ----AKLAELAAYSAPIRARRSSSRVHNAQVEQRLAAITSQDIERQLPYEARAETQRKRF
METE_YERE8      ----AKLAELAAYSAPIRARRASSRVHNPQVEQRLAAITAQDIERQQPYEARAAAQRKRF
METE_SERP5      ----AKQAELDAYSAPIRARRQSSRVHNAQVGQRLAAITAQDSERQRPYAERAQAQRERF
METE_PHOLL      ----SKQAELDAYSAPIRARRESKRVNNQAVTERLAAINPQDSERNQPYLQRAEIQRQRY
METE_PROMH      ----EYDEQLAQYSAPIRQREHSSRVHNAKVAARLQAINAQDGERTSPYQQRAKVQRARF
METE_SODGM      ----ANQARLGEYSAPIRARRHSSRVHNPEVKARLEKITAADSQRQQPYAARAALQRARF
METE_BAUCH      ----KYQAILADYSAPLWARQTSEKVHNRQVKIRTEQITENHSQRQQHYLDRINVQRARF
METE_BLOFL      N--SDQQNILKKYYNTNIQRLNSNIINNPQVQERCKNIITLDHSRKTKHITRMKLQHNRF
METE_BLOPB      D--ATYEDTLSEYYISNNLRSYSSTIHNIQVKKRLEHIDEISYSRSSPYTTRVTLQHKKL
METE_BUCAI      ----NDIDSIKEWSLPIYERSVSKRVNKIEVENRLSNVLIDKHQRLSPYKTRSIEQNKKF
METE_BUCAP      ----NDTDSIQKWCSSIYERNFSKRVQKIEVQNRLSEILNVNFKRSDSYNIRSREQKKKF
METE_BUCBP      ----TVTEDIRVWSQPIHSRKKSAIVHNVDVKERLKSITSNDFKRNNVFSVRKQKQHKNL
METE_BUCCC      ----LDIKELKNWIKPIHEYKSSNIVNNTSVQKRTLKISSEQFIRKNEFSVRSKIQKETL
METE_VIBHA      -----AILVCDTYSQPIKDRKTAAHVNKPHVQARLNSISASLTERSAPYAERAAHQAEVL
METE_VIBC1      -----AILACETYSQPIQDRKTATHVNKPQVQERLNSITASLTQRSAPYAERAAHQAEVL
METE_VIBPA      -----AILACDTYSQPIKARKTATHVNKPQVQVRLNNITASLAERSAPYAERAAHQAEVL
METE_VIBVU      -----AIAQCEAYSQPIQARKSAAHVHKATVQSRVNAITAELAQRSVPYAERARHQAEVL
METE_VIBVY      -----SIAQCEAYSQPIQARKSAAHVHKATVQSRVNAITAELAQRSVPYAERARHQAEVL
METE_VIBCH      -----AILACDTYSQPIVARKSSHIVNKASVQTRINNITAALAERSAPYIERAHHQAEVL
METE_ALIF1      -----AILACHQYSQPLRERESAEHINKPAVQQRLAAITPALAERAEAYSVRAQHQAEKL
METE_ALIFM      -----AILACHQYSQPLRERESAEHINKPAVQQRLAAITPALAERAEAYSVRAQHQAEKL
METE_PHOPR      -----AIQECAKYSAPIKARATSALVNNPDVRQRTNAITAALAERTAPYAERTRQQRAAL
METE_AERS4      ------LDKITAYSQPLVDRESDSRVHKKAVQSRLASLTNSDFDRQSAYPVRAQAQRNDL
METE_SHEON      ----ESVAAKEIVNTCLARREAKAQAADAKVIARVAALTPADYERVSEFTERQAVQQRKY
METE_BORBR      ----AVQQGLAAQRAALQARRQSPRIHNPAVAQRMAGQAGVSRER-APFGQRIARQQSEL
METE_BORPA      ----AVQQGLAAQRAALQARRQSPRIHNPAVAQRMAGQAGVSRER-APFGQRIARQQSEL
METE_BORPE      ----AVQQGLAAQRAALQARRQSPRIHNPAVAQRMAGQAGVSRER-APFGQRIARQQSEL
METE_BORPD      ----GVDEALAAQRAALRARRQSARIHNPAVGRRMAESNAVTRER-APFAERIARQQQLL
METE_BORA1      ----AVQEGLAAQRAALAARRSSPRIHNPAVGRRMAASEQVSRDR-APFAERIRQQQARL
METE_ALCBS      -----VNSGLQTQRAALQARGLSSRIHNPAVAQRLADASQLSRDRVSPFAERIAQQQHAL
METE_ALKEH      ----ADEQAAAEASAALADRQASTHIHKAEVAERMQRVGPADRQRGQPYPERARKQRKRL
METE_CHRSD      ----EDTARLEAATSALDARRQSPRIHKPAVGERLAAVSADDAERASPYATRAKAQHRHL
METE_PSEAE      ----EVLAALEESRAVQASRASSPRIHKPAVQARLAAIKASDAQRRSPFAERIARQRAGL
METE_PSEAB      ----EVLAALEESRAVQASRASSPRIHKPAVQARLAAIKASDAQRRSPFAERIARQRAGL
METE_PSEA8      ----EVLAALEESRAVQASRASSPRIHKPAVQARLAAIKASDAQRRSPFAERIARQRAGL
METE_PSEE4      ----DVVTVLAQSRAVQHRRATSPRIHKPAVQARVAAIKPADSQRATAFEQRIAKQRAGL
METE_PSEPW      ----EVAAALARSRAIQAGRASSPRIHKPAVQARVHAIKPGDSQRQSAFGQRIAKQRAGL
METE_PSEF5      ----AVLKALEQSRAVQASRAASPRIHKPAVQARVAAITTKDSQRRSAFTQRIAKQRAGL
METE_PSEMY      ----SVQAALEQSRVVRAARAASTRIHKPEVQARLAAIRPRHAQRQSPFAERIAQQRECL
METE_PSEA7      ----EVRQAFEVSRRVEASRRRSTRIHKREVQARLAAVRPQDSRRASAFAERAVQQRARL
METE_STUS1      ----EVQAALARSRAVQAARAQSPRIHKPAVQARLAAIEAKDSRRTSVFATRIELQRARL
METE_PSESM      ----EVVEALAQSCEIQASRAQSSRVHNPQVQARLASVTAADHQRRSAFAERITVQRERL
METE_ACIF2      -----VAQELAAARAAVASRKSSPRIHNPAVAQRLEGLGQDDGRRKSPFPIREAAQRARF
METE_ACIF5      -----VAQELAAARAAVASRKSSPRIHNPAVAQRLEGLGQDDGRRKSPFPIREAAQRARF
METE_ACTPJ      -----VAEQLNDSQTAADARANSNVIHKAEIAQRLANLPANADKRQSPFAERIKLQNKWL
METE_ACTP7      -----VAEQLNDSQTAADARANSNVIHKAEVAQRLANLPTNADKRQSPFAERIKLQNKWL
METE_ACTP2      -----VTEQLNDSQTAADARANSNVIHKAEVAQRLANLPANADKRQSPFAERIKLQNKWL
METE_HAEIE      -----VQAALDASQAAADARATSKEIHRPEVAERLANLPKGADQRKSPFAERIVKQNAWL
METE_HAEIG      -----VQAALDASQAAADARATSKEIHRPEVAERLANLPKGADQRKSPFAERIVKQNAWL
METE_HAEIN      -----VQAALDASQVAADARATSKEIHRPEVAERLANLPKGADQRKSPFAERIVKQNAWL
METE_HAES1      -----VNVELDASQVAADARANSKEIHRPEVAERLANLPKNADQRKSPFGERIKLQNAWL
METE_HISS2      -----VNVELDASQVAADARANSKEIHRPEVAERLANLPKNADQRKSPFGERIKLQNAWL
METE_PASMU      -----VQAELDASQAAADARANSKEIHRPEVAERLANLPTDADKRKSPFAERIAKQNAWL
METE_NEIMA      -----VAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFADRIKAQQAWL
METE_NEIMF      -----VAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFADRIKAQQAWL
METE_NEIMB      -----VAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFADRIKAQQAWL
METE_NEIM0      -----VAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFVNRIKAQQAWL
METE_NEIG1      -----VAEELAASQAAADSRANSSEIHRADVAKRLADLPVNAGQRKSPFADRIKAQQAWL
METE_CHRVO      -----IAGELSGSDFAREQRRASPRIHDPAVARRLAALPEGTDRRASPYPIRAERQQAWL
METE_BURMA      -----VAAEFDDAAVVAAARRTSARIHNPLVKRRVAALTDADARRASAYSVRAAAQRARF
METE_BURM9      -----VAAEFDDAAVVAAARRTSARIHNPLVKRRVAALTDADARRASAYSVRAAAQRARF
METE_BURM7      -----VAAEFDDAAVVAAARRTSARIHNPLVKRRVAALTDADARRASAYSVRAAAQRARF
METE_BURMS      -----VAAEFDDAAVVAAARRTSARIHNPLVKRRVAALTDADARRASAYSVRAAAQRARF
METE_BURP1      -----VAAEFDDAAAAAAARRTSARIHNPLVKRRVAALTDADARRASAYSVRAAAQRARF
METE_BURPS      -----VAAEFDDAAAAAAARRTSARIHNPLVKRRVAALTDADARRASAYSVRAAAQRARF
METE_BURP0      -----VAAEFDDAAAAAAARRTSARIHNPLVKRRVAALTDADARRASAYSVRAAAQRARF
METE_BURP6      -----VAAEFDDAAAAAAARRTSARIHNPLVKRRVAALTDADARRASTYSVRAAAQRARF
METE_BURTA      -----VAAEFDAAAVAAAARRTSARIHNPLVKRRVAALTDADARRASAYPARAAAQRARF
METE_RALPJ      -----VQGELDDNRIAIASRTQSRRVHNAGVKKRVAAIRAADAVRAAPYPARADAQQARL
METE_RALSO      -----AHAALAGSAAAIASRAASRRVHNDSVKKRAAAIRAQDAERAAPYPVRAAAQQARL
METE_PARPJ      -----AEATLAAADRALDARRHSSTVVNALVQKRVAAVSSAMADRQSPFAERNRLQREAL
METE_PARXL      -----AEPALAATDRALEARRRSSAVVNALVQKRVAAVSSAMAERQSPFAERNRLQREAL
METE_CUPNE      -----VAEALAASDAAQASRRASRRVVKPRVQQRLAAVSAGMADRASPFAERIERQRQAL
METE_CUPNH      -----VAEALAASDAAQASRRASRRVVNPRVQQRLAAVSAGMADRASPFAERIERQRQAL
METE_METCA      -----VAAELAERDRLLQTRAQSPLIHDPGVKRRLEGLSDADFRRHSPFAERSPLQRERL
METE_NITEU      -----VEAILTASDEARRSRTESSRIHNPIVHQRVDNLTERDSQRNHPFATRKHLQQQRF
METE_BURCM      -----VADALAANAAAIDSRRRSPRVNNPAVKAALARIDAQLGNRASPYTQRAPKQSARL
METE_BURA4      -----VADALAANAAAIDSRRRSPRVNNPAVKAALARIDAQLGNRASPYTQRAPKQSARL
METE_BURO1      -----VADALAANAAAIDSRRRSPRVNNPVVKAAIARIDAQLGNRASPYTQRASKQSARL
METE_BURCH      -----VADALAANAAAIDSRRRSPRVNNPVVKAAIARIDAQLGNRASPYTQRASKQSARL
METE_BURO0      -----VADALAANAAAIDSRRRSPRVNNPAVKAAIARIDARLGNRTSPYTQRASKQSARL
METE_BURCJ      -----VADALAANAAAIESRRRSPRVNNPAVKAAIARIDARLGNRASPYAQRASKQSARL
METE_BURL3      -----VADALAANAAAIHSRRHSPRVNNPAVKAAIARIDAQLGNRVSPYTQRAPKQSARL
METE_BURVG      -----VADALAENAAAIESRRRSPRVHNPAVKSAVARIDARLGNRASAYPQRAAAQSARL
METE_PARP8      -----VEAELLANAKAIESRRASPRVHNAAVKAALARIDASLGQRANAYPARAAKQAAAL
METE_THIDA      -----VSAELAANRAACDARRNSPRVNDPAVKAAVAAITPQSGARQSPYAVRAAKQAAHL
METE_HAHCH      -----VADALKENQDCVSSRKHSPRVHNPAVKEAVEAITAEMGDRRSDYQTRAARQAQRL
METE_MARN8      -----VRAELADNQLAIDSRRNSHRVTNPEVRKAVASVTPELGNRHSPYPQRIARQRERL
METE_RUTMC      -----VTKEIANNIDAINSKKYSPLVHNAKVKERIAKVNDELGNRQSDYKSRTKLQSEKF
METE_PSYIN      -----VEAAFTYNKLCIENRRQSPQVHKQDIKSKVLNITPELGQRNLAIKQREALQQSYL
METE_SACD2      -----VAEALVHNAGAIAARKASAKVNNAKVQSLVNNISPSLSERESPFATRIEKQQAKY
METE_COXBU      -----IGAELKKNEEVIISRKTSKRIHNPNVEKKAASVTERLMRRQHEHSIRKNKQTAQL
METE_COXBN      -----IGAELKKNEEVIISRKTSKRIHNPNVEKKAASVTERLMRRQHEHSIRKNKQTAQL
METE_COXB1      -----IGAELKKNEEVIISRKTSKRIHNPNVEKKAASVTERLMRRQHEHSIRKNKQTAQL
METE_COXBR      -----IGAELKKNEEVIISRKTSKRIHNPNVEKKAASVTERLMRRQHEHSIRKNKQTAQL
METE_COXB2      -----IGAELKKNEEVIISRKTSKRIHNPNVEKKAASVNERLMRRQHEHSIRKNKQTAQL
METE_NITOC      -----VAQALADSAAAQASRRQSERIYRPEIRARMTEVNEDMTRRRHKYPVRAQVQREEL
METE_BIFLO      ---KKASAALAANQALFDGTRVAA---DPAVAERIGKLSDADYVRQPAREERQALQREAL
METE_BIFLD      ---KKASAALAANQALFDGTRVAA---DPAVAERIGKLSDADYVRQPAREERQALQREAL
METE_BIFAA      ---KKASAELAANQALFDGTRVAA---DPAVAKRIASLTDADFVRQPARAERQKEQREAL
METE_CAMJE      ---SEENPLFRANQELFKNIPERL---DEKVKARLKALKKEDFTRTPSFKERALIQKEFL
METE_CAMJR      ---SEENPLFRANQELFKNIPERL---DEKVKARLKALKKEDFTRTPSFKERALIQKEFL
METE_CAMJJ      ---SEENPLFRANQELFKNIPERL---DEKVKARLKALKKEDFTRTPSFKERALIQKEFL
METE_CAMJ8      ---SEENPLFRANQELFKNIPERL---DEKVKARLKALKKEDFTRTPSFKERALIQKEFL
METE_CAMJD      ---SEENPLFKANQELFKNIPERL---DEKVKARLKALKKEDFTRTPSFKERALIQKEFL
METE_STRGC      ---QGAE-ALAANKELFATERVGE---NAELRARIAGLTDADYTRLPAFAEREAIQEEAF
METE_STRSV      ---GGAE-ALAANKELFATERVGE---NAELRARIAGLTDADYTRLPVFAEREEIQHKTL
METE_STRPN      ---QGSE-ALAANKELFATERVGE---NAELRARIAGLTDADYTRLPAFAEREAIQEEAF
METE_STRP4      ---QGSE-ALAANKELFATERVGE---NAELRARIAGLTDVDYTRLPAFAEREAIQEEAF
METE_STRR6      ---QGSE-ALAANKELFATERVGE---NAELRARIAGLTDADYTRLPAFAEREAIQEEAF
METE_STRP2      ---QGSE-ALAANKELFATERVGE---NAELRARIAGLTDADYTRLPAFAEREAIQEEAF
METE_STRPI      ---QGSE-ALAANKELFATERVGE---NAELRARIAGLTDTDYTRLPAFAEREAIQEEAF
METE_STRTD      ---QGAE-SLAANKELFAIERVGA---NAELRARIAGLTEADYTRLPAFAEREAIQKDAF
METE_STRSY      ---QGEV-ALTANKELFALERVGR---DAALADRLAGLTDTDYTRLPVFAERESIQREKL
METE_LACLM      ---KNTS-LLDKNIALFDKNRVQE---NIQLKQKIIHLTDKDFIRTPSLVERRADQIKAL
METE_LACLS      ---KNTS-LLDKNIALFDKNRVQE---NIQLKQKITHLTDKDFIRTPSLVERRADQIKAL
METE_LACLA      ---KNTS-FLKKNVELFENERVRE---NSKLKQKLDKLTEKDFTRQPSLVERRASQSQSL
METE_DESRM      ---EDILTILENNQRIFREKQQSSKVIDPIVRERVGNIKRR--ERDGSFNDRNEAQRKKL
METE_CORGL      ------AGNIDAAAFDAASAAIASRRTSPRTAPITQELPG--RSRG-SFDTRVTLQEKSL
METE_CORGB      ------AGNIDAAAFDAASAAIASRRTSPRTAPITQELPG--RSRG-SFNTRVTLQEKSL
METE_COREF      ------AGEINESLFDAAAAALADRRHSVLTAARDADITDADRSRS-PFEVRAAAQDEAL
METE_MYCA1      -----VADEIAASNAAVASRKSDPRLHNDRVRARIDSIVASGSHRG-DPAQRRASQDARL
METE_MYCPA      -----VADEIAASNAAVASRKSDPRLHNDRVRARIDSIVASGSHRG-DPAQRRASQDARL
METE_MYCLE      -----VADEIAASNAAVASRRSDPRLHNGQVRARIDSIVASGTHRG-DAAQRRTSQDARL
METE_MYCBO      -----VADEIASSRAAIASRKRDPRLHNGQIRARIEAIVASGAHRG-NAAQRRASQDARL
METE_MYCBP      -----VADEIASSRAAIASRKRDPRLHNGQIRARIEAIVASGAHRG-NAAQRRASQDARL
METE_MYCTU      -----VADEIASSRAAIASRKRDPRLHNGQIRARIEAIVASGAHRG-NAAQRRASQDARL
METE_MYCTA      -----VADEIASSRAAIASRKRDPRLHNGQIRARIEAIVASGAHRG-NAAQRRASQDARL
METE_RHOJR      -----VDDEFALARAAASTRNTDRRLHDATVRARLDALTASDPGRS-PAAERREAQSA-L
METE_STRAW      -----IAAQLAANRADLVSRADSALTRDPAVRSRTAATTDADARRSGPYPERAAAQRARL
METE_STRCO      -----ITGELAASRADMASRAGSPITRNPAVRARAEAVTDDDARRSQPYAERTAAQRAHL
METE_STRGG      -----IASELAANRADLASRTGAALTRDPAVRARTAAVTEADGRRSQPYAERSAAQRAGL
METE_HERA2      -----VQPTWDAALASRQQWLDGVGRIVPAVRERTAALGTETPARL-AYAERVPLQQAKL
METE_SYNJB      ------TAAQQAEIQQQWQSFAQFSPPNPQVRQALANLKLQDFERFLPYEQR---LSRQV
METE_THEVB      NREILMKNPELTAIQAQWKAFEQFSPVNPTVQARLRNLSVRDLERPLPYEQR---RTLQP
METE_TRIEI      ------NKSEIENIEIYWQEFYKFSPANEKVKSQIKALKETDFRRSMSYLER---LDNQI
METE_BACVZ      -----VSEQIEESKAALKALKAFATGANSAQKEELNQLTEKDFSRPASFEERLALQNESL
METE_BACSU      -----ISEEIQQAKADIQALKQFATGANSEQKKELEQLTDKDFKRPIPFEERLALQNESL
METE_BACLD      -----IQAEIDEAHGHLQDLKQYGAATNSAFAEERGKLTEEDFKRPTAFEERLRIQNDSL
METE_BACP2      -----IEAAINEAEQALLTLKEFAKGTNADFTAERNNLSSKDFKRPVAFEERLRIQNESL
METE_BACAN      -----ISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACC0      -----ISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACHK      -----ISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACAH      -----ISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACCZ      -----ISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYKLQQVAL
METE_BACC7      -----IRNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACC1      -----IHNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACC2      -----ISNELETYRNVHHTIRSSAVRNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACCR      -----ISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACC4      -----ISNELETYRNVHHTIRSSAARNREDVKAARTALKEEDFSRPLPFEKRYELQQVAL
METE_BACMK      -----ISSDLTTYRNAHHAIRSSAARNREDVKVARTSLKEDDFSRPLPFEKRYELQQVAL
METE_BACCN      -----IEIEITTYRNSHEAVRSSAARNRKDVQTARASLKEEDFSRPLPFEQRYDLQQKAL
METE_HALH5      -----VKEALEANDDALAALEKSGWRSGAATSHNLENK-----KRPQSFNERRPLQEEKW
METE_LISMO      -----VTAELEDARAAVTALNESSHRNNLEVQEAIANLGNVRVDRELPFAERIKLQHAWL
METE_LISMF      -----VAAELEESRAAVTALNESSHRNNLEVQEAIANLKNVRVDRELPFAERIKLQHAWL
METE_LISIN      -----VAAELNEAREAVKALNESSHRNNLEVQAAIANLENVRVDRELPFAERIKLQHEWL
METE_LISW6      -----VAKELEEARKAVKVLNESSHRNNLEVQAAIANLKNVRVDRELVFAERIKLQHAWL
METE_LACPL      -----VQAVFDHNQANLTALNQSSHRNNQSVRAAEAQLSNQKFERQAPFATRIKLQHDRL
METE_STAAC      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAA8      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAE      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAT      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAA3      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAR      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAW      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAS      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAA1      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAN      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAM      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAA2      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAA9      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAAB      -----KYDKLKARYERFQNQ--------SFKNLDYD-FESVRTSRQSPFAQRIEQQQKRL
METE_STAES      -----KYEHYKARYERFQSQ--------SFKNLEYD-FESVPTHRKSPFAKRKQLQNQRL
METE_STAEQ      -----KYEHYKARYERFQSQ--------SFKNLEYD-FESVPTHRKSPFAKRKQLQNQRL
METE_STAHJ      -----KYDKLKARYERFQSQ--------SFKNLEYD-FDSVPTSRKSPFPERKKAQDARL
METE_STRA3      -----GYHEALSRFSALQAA--------DFRHVALESLAEVKLER-SPYKLRQALQAEKL
METE_STRA5      -----GYHEALSRFSALQAA--------DFRHVALESLAEVKLER-SPYKLRQALQAEKL
METE_STRA1      -----GYHEALSRFSALQAA--------DFRHVALESLAEVKLER-SPYKLRQALQAEKL
METE_STRMU      -----AYDLHIAHFDALQAA--------DFRNVKLEDLSRVATKRPSDFAKRRDIQQEKL
METE_THEMA      ------KTFDLPNVSFED------FAVDLQAVERVRNLPEDSFRREKEYTERDRIQRERL
METE_THESQ      ------KTFDLPNVSFED------FAVDLQAVERVRNLPEDSFRREKEYTERDRIQRERL
METE_THEP1      ------KKVNLPEVSFED------FAVDESVSKKIKQLTPDSFRREKEYQERDRIQREEL
METE_AQUAE      ------KEEALREVESSEKVMTAVFAQNPEVRRRLASLSEKDFQRELPYKERDKIQRDIL
METE_THEYD      ------GAALPARKSIVHE-----IFSKAEVRSKISSIDEKAILRKPEFQERYRMQMDSL
                                                            *      *        

METE_RHOPA      QLPAFPTTTIGSFPQTAQIRQARAAHAKGAISDADYNTFLRGETARAIQWQEKVGLDVLV
METE_RHOPT      QLPAFPTTTIGSFPQTAQIRQARAAHAKGAISDADYNTFLRGETARAIQWQEKVGLDVLV
METE_NITWN      GLPPFPTTTIGSFPQTAEVRKARSAHAKGTLSDTDYEKFLQEETARTIRWQEDIGLDVLV
METE_BRADU      GLPAFPTTTIGSFPQTTAVRNARAAHARGAMSEEQYDRFLKEEIARAVRWQEDIGLDVLV
METE_RHILO      GLPSFPTTTIGSFPQTAEVRKARAAHAKGELSYVDYEAFLKKEIEAAVRWQEEIGLDVLV
METE_CAUVC      NLPPLPTTTIGSFPQTTEVRQARAAFAKGQISDATYEAFLRQETARAVAWQETVGLDVLV
METE_CHESB      NLPAFPTTTIGSFPQTAEVRQARAACAKGELSEAGYDGFLKGETEKAIRWQEEIGIDVLV
METE_ACICJ      PLPAFPTTTIGSLPQTSGVRRTRAALARGEIGAAEYDEAIATWTEDAIRLQERIGLDVLV
METE_XYLF2      NLPAYPTTTIGSFPQTLEVREARAQFKSGKLSESDYEAFLKAETERCVRTQEEIGLDVLV
METE_XYLFT      NLPAYPTTTIGSFPQTLEVREARAQFKSGKLSESDYEAFLKAETERCVRTQEEIGLDVLV
METE_XYLFM      NLPAYPTTTIGSFPQTLEVREARAQFKSGKLSESDYEAFLKAETERCVRTQEEIGLDVLV
METE_XYLFA      NLPAYPTTTIGSFPQTLEVREARAQFKSGKLSESDYETFLKAETERCIRTQEEIGLDVLV
METE_CYTH3      QLPLMPTTTIGSFPQTDEVRANRAKYKKGDITLAQYEDFVKTEMTKAIEWQEKIGIDVLV
METE_FLAJ1      NLPLFPTTTIGSFPQTTEVRSWRAKFKKGELTTEQYNDLIEKETEAAIRFQEETGIDVLV
METE_PARL1      GLPKLPTTTIGSFPQTSDVRKARASLRRGDWNEAQYDAFMKAEIEKTIRLQERIGLDVLV
METE_SALRD      DLPTLPTTTIGSFPQTDDMRRMRAQYKKDEISKDEYEDFIEEQIADTIAAQEEIGLDVLV
METE_DESVH      HLPTLPTTTIGSFPQTPDIRAARRALRDGSLTQDAYEAAMRDALAMMVREQEALGLDVLV
METE_DESVM      RLPVLPATTIGSFPQTVDIRAQRRKLRTGQITEAQYDAAMREAIATAIREQEALGLDVLV
METE_SYNC1      RLPTLPTTTIGSFPQVAGVRSARRSFKQGRISEEQYRAEMQRYIREAIAQQEALGLDVLV
METE_ECODH      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOLI      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECO57      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIRQAIVEQERLGLDVLV
METE_ECO5E      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIRQAIVEQERLGLDVLV
METE_SHIDS      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIRQAIVEQERLGLDVLV
METE_SHIB3      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_SHIBS      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOL5      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ESCF3      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOSE      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIRQAIVEQERLGLDVLV
METE_SHISS      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIRQAIVEQERLGLDVLV
METE_ECOLC      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIRQAIVEQERLGLDVLV
METE_ECO24      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIRQAIVEQERLGLDVLV
METE_SHIFL      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_SHIF8      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECO8A      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOHS      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOLU      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOUT      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECO45      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOK1      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOL6      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECOSM      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_ECO7I      KLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYRTGIAEHIKQAIVEQERLGLDVLV
METE_SALA4      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALNS      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYHTGIAEHIKQAIIEQERLGLDVLV
METE_SALPA      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALPK      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALCH      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALPB      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALSV      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALEP      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALG2      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALHS      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANHYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALTY      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANHYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALDC      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALTI      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_SALAR      KLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANHYRTGIAEHIRQAIIEQERLGLDVLV
METE_ENT38      NLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIKQAIIEQERLGLDVLV
METE_CITK8      NLPSWPTTTIGSFPQTTEIRGLRLDFKKGNLDANHYRTGIAEHIKQAIVEQERLGLDVLV
METE_KLEP3      NLPKWPTTTIGSFPQTTEIRGLRLDFKKGNLDASHYRTGIAEHIKQAIVEQERLGLDVLV
METE_KLEP7      NLPKWPTTTIGSFPQTTEIRGLRLDFKKGNLDASHYRTGIAEHIKQAIVEQERLGLDVLV
METE_CROS8      NLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDAANYRTGIAEHIKQAIAEQERLGLDVLV
METE_PECAS      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGNNYRTGIAEHIKQAVAEQERLGLDVLV
METE_ERWT9      QLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGTHYRTGIAEHIKQAIVEQERLGLDVLV
METE_YERPA      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGKNYRTGISEHIKHAIAEQERLGLDVLV
METE_YERPN      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGKNYRTGISEHIKHAIAEQERLGLDVLV
METE_YERPE      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGKNYRTGISEHIKHAIAEQERLGLDVLV
METE_YERPP      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGKNYRTGISEHIKHAIAEQERLGLDVLV
METE_YERPS      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGKNYRTGISEHIKQAIAEQERLGLDVLV
METE_YERP3      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGKNYRTGISEHIKQAIAEQERLGLDVLV
METE_YERE8      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGKNYRTGISEHIKQAIAEQERLGLDVLV
METE_SERP5      NLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGNNYRTSISEHIKQAIVEQERLGLDVLV
METE_PHOLL      NLPLWPTTTIGSFPQTTEIRGLRLDFKKGRVDGTSYRTNICEHIKQAINEQERLGLDVLV
METE_PROMH      NFPLWPTTTIGSFPQTTEIRTVRLDFKKGRIDTTAYRTNISEHIKQAIDEQERLGLDVLV
METE_SODGM      KLPAWPTTTIGSFPQTTEIRGLRLDFKRGRLDGGHYRTGISEHIKQAIVEQERLGLDVLV
METE_BAUCH      NLPILPTTTIGSFPQTTAIRSLRLDLKSGRIDNEYYKNAICNHIKQAITEQDALGLDVLV
METE_BLOFL      NLPLYPTTTIGSFPQTSEIRKLRLKFKNKQINEDYYYTHIQQYIKKIIQEQEKLDLDILV
METE_BLOPB      NLPLFPTTTIGSFPQTEEIRKLRSRFKNNQINKEDYHLNIKNYIKKIIMEQEKLDLDILV
METE_BUCAI      NFPILPTTTIGSFPQTISIRKLRRDFKLGLVTEEEYTKIIKKNIKKVIKIQEELDIDVLV
METE_BUCAP      NLPILPTTTIGSFPQTLQIRKLRRDYKQGLINDVDYEIGIKKHIKEVIKEQEKLGIDVLV
METE_BUCBP      KLPILPTTTIGSFPQTADIRKARFDFKKGNINHDQYNTFISKHIQNAILKQEKLGIDVLV
METE_BUCCC      CLPVLPTTTIGSFPQTSEIRKLRLDYKNKKINQLDYEKQIKIHIKKNIIQQEQLGLDVLV
METE_VIBHA      GLPLLPTTTIGSFPQTSEIRVQRSAFRSGQLSTDDYHQALKGHIADAVRRQEALDLDVLV
METE_VIBC1      GLPLLPTTTIGSFPQTGDIRVQRSAYRTGKLSQTEYNQALKGHIADAVKRQEALDLDVLV
METE_VIBPA      GLPLLPTTTIGSFPQTGEIRVQRSAYRTGQLSESDYIQALKGHIADAVKRQEALDLDVLV
METE_VIBVU      QLPLLPTTTIGSFPQTSEIRVQRSAYRSGQLSSAEYEQALKGHIADAVKRQEALDLDVLV
METE_VIBVY      QLPLLPTTTIGSFPQTSEIRVQRSAYRSGQLSSAEYEQALKGHIADAVKRQEALDLDVLV
METE_VIBCH      GLPFLPTTTIGSFPQTGEIRTERSAYRQGKLSEQEYVQALKGHIADAVKRQEALGLDVLV
METE_ALIF1      GLPLLPTTTIGSFPQTSDIRQQRSAYRTGKLNEQDYVTAMKGHIADAVERQERLDLDVLV
METE_ALIFM      GLPLLPTTTIGSFPQTSDIRQQRSAYRTGKLNEQDYVTAMKGHIADAVERQERLDLDVLV
METE_PHOPR      NLPLLPTTTIGSFPQTNEIRTQRRDFKAGYLTEADYNTALKGHIADAIQRQEDLDLDVFV
METE_AERS4      KLPLLPTTTIGSFPQTSEIRVLRQEWRAGRIDDSAYEAGIQAQIKDAIERQEAIGLDVLV
METE_SHEON      RLPLLPTTTIGSFPQTPAIRGLRSRWRKGELSDAQYTEQLQQVTRDTIDRQLKLGIDVLV
METE_BORBR      RLPAFPTTTIGSFPQTAEIRALRRDWKSGALTDSAYENAIRKEIEEVIRFQEKVGLDVLV
METE_BORPA      RLPAFPTTTIGSFPQTAEIRALRRDWKSGALTDSAYENAIRKEIEEVIRFQEKVGLDVLV
METE_BORPE      RLPAFPTTTIGSFPQTAEIRALRRDWKSGALTDSAYENAIRKEIEEVIRFQEKVGLDVLV
METE_BORPD      KLPAFPTTTIGSFPQTAEIRALRRDWKSGALSDSAYEAAIRKEIESVIRFQEKIGLDVLV
METE_BORA1      NLPPFPTTTIGSFPQTAEIRGLRRDWKSGALSDSTYEALIRKEIEAVIRFQEKVGLDVLV
METE_ALCBS      QLPAFPTTTIGSFPQTREIRTARRDWKAGKLNDAQYQQQMQEEIARCIRYQEEVELDVLV
METE_ALKEH      ALPLFPTTTIGSFPQTAEIRAARRDLKAGRLTPEAYEARMREEIAFAVARQEEIGLDVLV
METE_CHRSD      DLPLFPTTTIGSFPQTQDIRAARRAFKSGELSRDDYEARMRDEIAHAVERQEALAIDVPV
METE_PSEAE      DLPAFPTTTIGSFPQTSSIRLARQSFKQGKLSEAEYIEAMHSEIRHAVQIQEQLGLDVLV
METE_PSEAB      DLPAFPTTTIGSFPQTSSIRLARQSFKQGKLSEAEYIEAMHSEIRHAVQIQEQLGLDVLV
METE_PSEA8      DLPAFPTTTIGSFPQTSSIRLARQSFKQGKLSEAEYIEAMHSEIRHAVQIQEQLGLDVLV
METE_PSEE4      DLPAFPTTTIGSFPQTSAIRLARQSFKQGKLTEADYVEAMHSEIRHAVEIQENLGLDVLV
METE_PSEPW      NLPAYPTTTIGSFPQTPAIRLARQAFKQGKLTEADYVEAMHSEIRHAVQIQENLGLDVLV
METE_PSEF5      DLPLFPTTTIGSFPQTASIRLARQSFKQGKLSVAEYTEAMHSEIRHAVLVQERLGLDVLV
METE_PSEMY      QLPLLPTTTIGSFPQTSAIRLARQSFKQGKLSAAEYTEAMHAEIRHAVEVQENLGLDVLV
METE_PSEA7      ELPAFPTTTIGSFPQTSAIRLARQSWKQGRLSQAEYTEAMHSEIRHAVQVQERLGLDVLV
METE_STUS1      QLPAFPTTTIGSFPQTPAIRLARQAYKQGRLSLGDYTEAMQAEIRHAVAVQEQIGLDVLV
METE_PSESM      KLPAFPTTTIGSFPQTSAIRLARQAHKQGKLSLNDYTDAMRHEIRHAVQVQENLGLDVLV
METE_ACIF2      KLPAFPTTSIGSFPQTPEIRKARLQNRKGELSNADYQKAMEAEIALVVKEQERLGIDVPV
METE_ACIF5      KLPAFPTTSIGSFPQTPEIRKARLQNRKGELSNADYQKAMEAEIALVVKEQERLGIDVPV
METE_ACTPJ      NLPLLPTTNIGSFPQTLEIRHARAAFKKGELSLADYEAAMKKEIEFVVRKQEELDLDVLV
METE_ACTP7      NLPLLPTTNIGSFPQTLEIRHARAAFKKGELSLADYEAAMKKEIEFVVRKQEELDLDVLV
METE_ACTP2      NLPLLPTTNIGSFPQTLEIRHARAAFKKGELSLADYEAAMKKEIEFVVRKQEELDLDVLV
METE_HAEIE      NLPLLPTTNIGSFPQTTEIRHARASFKKGELSLADYEAAMKKEIEYVVRRQEELDLDVLV
METE_HAEIG      NLPLLPTTNIGSFPQTTEIRHARASFKKGELSLADYEAAMKKEIEYVVRRQEELDLDVLV
METE_HAEIN      NLPLLPTTNIGSFPQTTEIRHARASFKKGELSLADYEAAMKKEIEYVVRRQEELDLDVLV
METE_HAES1      NLPLLPTTSIGSFPQTTDIRRARAAFKKGDLSLEEYENSMKKEIELVVREQEKLDLDVLV
METE_HISS2      NLPLLPTTSIGSFPQTTEIRRARAAFKKGDLSLEEYENSMKKEIELVVREQEKLDLDVLV
METE_PASMU      NLPLLPTTNIGSFPQTVEIRQARAKFKKGELSVADYEAAMKKEIEFVVRRQEELDLDVLV
METE_NEIMA      NLPLLPTTNIGSFPQTTEIRQARAAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLV
METE_NEIMF      NLPLLPTTNIGSFPQTTEIRQARAAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLV
METE_NEIMB      NLPLLPTTNIGSFPQTTEIRQARSAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLV
METE_NEIM0      NLPLLPTTNIGSFPQTTEIRQARAAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLV
METE_NEIG1      NLPLLPTTNIGSFPQTTEIRQARAAFKKGELSASDYEAAMKKEIALVVEEQEKLDLDVLV
METE_CHRVO      KLPPLPTTTIGSFPQTPAIRASRAAFKKGELSAAGYRQAMEKEIELAIRRQEALGLDVLV
METE_BURMA      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURM9      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURM7      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURMS      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURP1      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURPS      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURP0      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURP6      GLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDHLGYLEAMREQVRIAIDKQLAYGLDVLV
METE_BURTA      DLPPLPTTTIGSFPQTPEIRRARAAFRQGVLDHLGYLEAMREQVRIAIDKQLSYGLDVLV
METE_RALPJ      NLPLLPTTTIGSFPQTPEIRRARAQHKRGDLPALDYLQRMRTEIADVVRRQEALGLDMLV
METE_RALSO      NLPLLPTTTIGSFPQTAEIRQARAQYKRGELQALTYLERMRAEIADVVQRQEALGLDMLV
METE_PARPJ      GLPLLPTTTIGSFPQTPAIRQARAAYKRGELRALDYLQRMRAEIEIAVRKQEELGLDVLV
METE_PARXL      GLPLLPTTTIGSFPQTAAIRQARAAYKRGELRALDYLQRMRTEIEIAVRKQEELGLDVLV
METE_CUPNE      QLPLLPTTTIGSFPQTAAIRQTRAAFKRGEIGALEYLERIRAEIAVAVRKQEALGLDVLV
METE_CUPNH      QLPLLPTTTIGSFPQTAAIRQTRAAFKRGEIGALEYLERIRAEIAVAVRKQEALGLDVLV
METE_METCA      RLPPFPTTTIGSFPQTPKIRAARAAHRRGELNGDAYRDAMRAAIREAVYKQESLGLDLLV
METE_NITEU      NLPLLPTTTIGSFPQTATIRQARAAFRKNELSHLEYLSAMRAEIREMIRKQEEIGLDVLV
METE_BURCM      NLPAFPTTTIGSFPQTADIRHARSQFKAGALDEAGYRAAMQAEIERSVREQESLGLDVLV
METE_BURA4      NLPAFPTTTIGSFPQTADIRQARRQFKSGALDEAGYRAAMQAEIERSVREQESLELDVLV
METE_BURO1      NLPAFPTTTIGSFPQTAEIRQARSRFRAGALDEAGYRTAMRAEIERSVREQESLELDVLV
METE_BURCH      NLPAFPTTTIGSFPQTAEIRQARSRFRAGALDEAGYRTAMRAEIERSVREQESLELDVLV
METE_BURO0      NLPAFPTTTIGSFPQTAEIRQARSRFKAGALDEAGYRKAMQAEIERSVREQESLELDVLV
METE_BURCJ      NLPAFPTTTIGSFPQTAEIRQARSRFKAGTLDEAGYRTAMQAEIERSVREQESLELDVLV
METE_BURL3      NLPAFPTTTIGSFPQTGEIRQARSQFKAGTLDEAGYRKAMQAEIERSVREQESLELDVLV
METE_BURVG      KLPLFPTTTIGSFPQTAEIRDARRRFKAGELDEAGYRHAMHAEIERSVREQESLQLDVLV
METE_PARP8      ALPAFPTTTIGSFPQTADIRRARSQFKAGELDYAGYKLAMEREITRAVKEQETLGLDVLV
METE_THIDA      RLPRFPTTTIGSFPQTAEIRQARRRFKAGEIDDAAYRAAMQDEIAHSVRAQEALGLDVLV
METE_HAHCH      QLPAFPTTTIGSFPQTADIRNARRRYRQGELQDNEYRTLMQQEIERCVREQENLGLDVLV
METE_MARN8      NLPAFPTTTIGSFPQTREIRQARLQFRKGELSEQAYIEQMRAEIVRCVEAQEKLGLDVLV
METE_RUTMC      NLPLYPTTTIGSFPQTLEIRQARHDYKLGKLSAEQYMQTMRSEIRYCVQVQEHLGLDVLV
METE_PSYIN      NLPSYPTTTIGSFPQTSDIRQLRQAKRLGDINEEQYKKSIKESIEFCINEQDQLGLDVLV
METE_SACD2      NLPTLPTTTIGSFPQTSEIRKNRKAFKSGEISQQQYDRTLRAEIAHAIELQEKIGIDVLV
METE_COXBU      NLPLFPTTTIGSFPQTSQIRCLRRDYKQGKIDDALYEEKIRQEIAEVIGIQVKLGLDVLV
METE_COXBN      NLPLFPTTTIGSFPQTSQIRCLRRDYKQGKIDDALYEEKIRQEIAEVIGIQVKLGLDVLV
METE_COXB1      NLPLFPTTTIGSFPQTSQIRCLRRDYKQGKIDDALYEEKIRQEIAEVIGIQVKLGLDVLV
METE_COXBR      NLPLFPTTTIGSFPQTSQIRCLRRDYKQGKIDDALYEEKIRQEIAEVIGIQVKLGLDVLV
METE_COXB2      NLPLFPTTTIGSFPQTSKIRCLRRDYKQGKIDDALYEEKIRQEIAEVIGIQVKLGLDVLV
METE_NITOC      KLPLYPTTTIGSFPQTPDIRKARRDFKAGRIAEPEYRRQMEAEIARAIQAQESYGLDVLV
METE_BIFLO      GLPLLPTTTIGSFPQTKEIRAERAKLRKGEVTKEAYDEFIKAQIDAVIKKQEEIGLDVLV
METE_BIFLD      GLPLLPTTTIGSFPQTKEIRAERAKLRKGEVTKEAYDEFIKAQIDAVIKKQEEIGLDVLV
METE_BIFAA      NLPLLPTTTIGSFPQTKEVRAERAKLRKGEITKAEYDEFMKNQIDACIKHQEEIGLDVLV
METE_CAMJE      KLPLLPTTTIGSFPQSADVRSNRLAFKQEKISAQNYTEFNQQKIKECIQIQEEIGLDVLV
METE_CAMJR      KLPLLPTTTIGSFPQSADVRSNRLAFKQEKISAQNYTEFNQQKIKECIQIQEEIGLDVLV
METE_CAMJJ      KLPLLPTTTIGSFPQSTDVRSNRLAFKQEKISAQNYTEFNQQKIKECIQIQEEIGLDVLV
METE_CAMJ8      KLPLLPTTTIGSFPQSADVRSNRLAFKQEKISAQNYTEFNQQKIKECIQIQEEIGLDVLV
METE_CAMJD      KLPLLPTTTIGSFPQSADVRSNRLAFKQKKISAQNYTEFNQQKIKECIQIQEEIGLDVLV
METE_STRGC      KLPALPTTTIGSFPQTKEVRAKRLAFRKGELSAEDYDKFLAEQIDEWIKWQEEVGFDVLV
METE_STRSV      NLPPLPTTTIGSFPQTKEVRAKRLAFRKGELSQEDYDKFLAEQIDEWIKWQEEVGFDVLV
METE_STRPN      KLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAETIDEWIKWQEDIDFDVLV
METE_STRP4      KLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAETIDEWIKWQEDIDFDVLV
METE_STRR6      KLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAETIDEWIKWQEDIDFDVLV
METE_STRP2      KLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAETIDEWIKWQEDIDFDVLV
METE_STRPI      KLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAETIDEWIKWQEDIDFDVLV
METE_STRTD      KLPLLPTTTIGSFPQTKEVRAKRLAFRKNELSQEEYDAFLAEIIDEWIKWQEEVGFDVLV
METE_STRSY      NLPLLPTTTIGSFPQTKEVRSTRLAFRKGNISEEEYDAFVKTQTDEWIAWQEEVDFDVLV
METE_LACLM      NLPLLPTTTIGSFPQTPEIRKSRLQYKRGELSKSDYEAFLEEKIKECLELQENIGLDVLV
METE_LACLS      RLPLLPTTTIGSFPQTPEVRKARLQYKRGELSKSDYEAFLEEKIKECLELQENIGLDVLV
METE_LACLA      NLPVLPTTTIGSFPQTAEVRKVRLQNKRGELRQADYDTFLEEKIKECLKLQEDIGLDVLV
METE_DESRM      DLPLLPTTTIGSFPQTEEIRKLRRDFKNNVISQIEYDTGIKNYIDSCIQFQEDIGLDVLV
METE_CORGL      ELPALPTTTIGSFPQTPSIRSARARLRKESITLEQYEEAMREEIDLVIAKQEELGLDVLV
METE_CORGB      ELPALPTTTIGSFPQTPSIRSARARLRKESITLEQYEEAMREEIDLVIAKQEELGLDVLV
METE_COREF      DLPPLPTTTIGSFPQTREIRSARARYRAGHLTPEQYEDAMRAEIAQVIRAQEDLGLDVLV
METE_MYCA1      HLPPLPTTTIGSYPQTSAIRKARAALRSGEIDQAEYERRMKKEIADVITLQEQLGLDVLV
METE_MYCPA      HLPPLPTTTIGSYPQTSAIRKARAALRSGEIDQAEYERRMKKEIADVITLQEQLGLDVLV
METE_MYCLE      HLPPLPTTTIGSYPQTSAIRKARAALQDAEIDEAEYISRMKKEVADAIKLQEQLGLDVLV
METE_MYCBO      HLPPLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLV
METE_MYCBP      HLPPLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLV
METE_MYCTU      HLPPLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLV
METE_MYCTA      HLPPLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLV
METE_RHOJR      SLPVLPTTTIGSYPQTTQIRVARAARRKGEIDEAEYLKRMRAEVADVVALQEKLDLDVLV
METE_STRAW      GLPLLPTTTIGSFPQTAELRTARADLRAGRIDSAGYEERIRAEIGEVISFQEKAGLDVLV
METE_STRCO      GLPPLPTTTIGSFPQTGEIRAARADLRDGRIDIAGYEERIRAEIQEVISFQEKTGLDVLV
METE_STRGG      GLPLLPTTTIGSFPQTTELRTARAELRAGRIDEAEYEERVKDEIREVLSFQEKAGIDVLV
METE_HERA2      NLPLLPTTTIGSFPQTAALRKARAEAKR---NPTGYAETINAEIAHVIALQEQWGIDVLV
METE_SYNJB      QLPPLPTTTIGSFPQTPEVRQWRAKYKRGEVSQAEYEAAIDAEIAKCIRIQEEIGLDVLV
METE_THEVB      TLPPLPTTTIGSFPQTAEVRQLRVKLKRHEITQAEYEAAIDEEIAKCVRLQEEVGLDVLV
METE_TRIEI      KLPAFPTTTIGSFPQTKQVRKLRARYKKGELTQAEYLAQIDANIAYCIGLQEGMGMDVLV
METE_BACVZ      GLPLLPTTTIGSFPQSAEVRSARQKWRKKDWTDEQYQAFINAETKRWVDIQEEIGLDVLV
METE_BACSU      GLPLLPTTTIGSFPQSAEVRSARQKWRKAEWSDEQYQNFINAETKRWIDIQEELELDVLV
METE_BACLD      GLPLLPTTTIGSFPQTADVRSARQKWRKKEWSDEQYEAFIQEETKKWIDIQEDLGLDVLV
METE_BACP2      ELPLLPTTTIGSFPQSAEVRSARQKWRKNEWTNAEYDEFIKKETKRWIDIQEEIGLDVLV
METE_BACAN      KLPLLPTTTIGSFPQTTEVRQTRKEWRNGIISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACC0      KLPLLPTTTIGSFPQTTEVRQTRKEWRNGIISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACHK      KLPLLPTTTIGSFPQTTEVRQTRKEWRNGIISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACAH      KLPLLPTTTIGSFPQTTEVRQTRKEWRNGIISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACCZ      KLPLLPTTTIGSFPQTTEVRQTRKEWRTGVISNKQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACC7      KLPLLPTTTIGSFPQTTEVRQTRKEWRNGVISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACC1      KLPLLPTTTIGSFPQTTEVRQTRKEWRNGVISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACC2      ELPLLPTTTIGSFPQTTEVRQTRKEWRNGVISNEQYEKFIEKETEKWIRYQEEIGLDVLV
METE_BACCR      ELPLLPTTTIGSFPQTTEVRQTRKEWRNGVISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACC4      ELPLLPTTTIGSFPQTTEVRQTRKEWRNGVISNEQYEQFIEKETEKWIRYQEEIGLDVLV
METE_BACMK      QLPLLPTTTIGSFPQTSEVRQTRKQWRNGDITNEQYNQFIEKETAKWIRYQEDIGLDVLV
METE_BACCN      QLPLLPTTTIGSFPQTPEVRQTRKQWRNGEITNEQYEHFIEQETEKWIRHQENIGLDVLV
METE_HALH5      QLPLLPTTTIGSFPQTKDVRRTRSLWRKGELSTVEYERTMKSYIEKWINIQEELGLDVLV
METE_LISMO      NLPLFPTTTIGSFPQSPEVRKTRADWLKGNITDAEYNAFIEKETARWIKIQEELDIDVLV
METE_LISMF      KLPLFPTTTIGSFPQSPEVRKTRADWLKGNITDAEYNAFIEKETARWIKIQEDLDIDVLV
METE_LISIN      KLPLFPTTTIGSFPQSPEVRKTRADWLKGNITDAEYNAFIEKETARWIKIQEDLDIDVLV
METE_LISW6      NLPLFPTTTIGSFPQSPEVRKTRADWLKGNITDAEYNAFIEKETARWIKIQEELDIDVLV
METE_LACPL      HLPLLPTTTIGSFPQSAQVRAKRAAWRKGNLTDADYQAFLHAETKRWIKLQEDLGLDVLV
METE_STAAC      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAA8      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAE      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAT      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAA3      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAR      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAW      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAS      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAA1      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAN      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAM      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAA2      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAA9      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAAB      NLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWIKIQEDIGLDVLV
METE_STAES      NLPDLPTTTIGSFPQTREVRKFRADWKNNRITDAEYQEFLQNEIARWIKIQEDIGLDVLV
METE_STAEQ      NLPDLPTTTIGSFPQTREIRKFRADWKNNRITDAEYQEFLQNEIARWIKIQEDIGLDVLV
METE_STAHJ      HLPDLPTTTIGSFPQTQEVRKYRADWKNKRISDEAYNNFLESEIARWIKIQEDIGLDVLV
METE_STRA3      QLPILPTTTIGSFPQSPEIRKKRLAWKRGNLSDSDYKDFIKTEIRRWIAIQEDLDLDVLV
METE_STRA5      QLPILPTTTIGSFPQSPEIRKKRLAWKRGNLSDSDYKDFIKTEIRRWIAIQEDLDLDVLV
METE_STRA1      QLPILPTTTIGSFPQSPEIRKKRLAWKRGNLSDSDYKDFIKTEIRRWIAIQEDLDLDVLV
METE_STRMU      HLPLLPTTTIGSFPQSREIRRTRLAWKRGDISDAEYKQFIQAEIERWIRIQEDLDLDVLV
METE_THEMA      NLPLFPTTTIGSFPQTPEVRKMRSKYRKGEISKEEYEAFIKEQIKKAIELQEEIGLDVLV
METE_THESQ      NLPLFPTTTIGSFPQTPEVRKMRSKYRKGEISKEEYEAFIKEQIKKAIELQEEIGLDVLV
METE_THEP1      KLPLFPTTTIGSFPQTSDVRKMRARYRRGEISEEEYESFIKEQIKKVVRIQEEIGLDVLV
METE_AQUAE      KLPLFPTTTIGSFPQTEDVRKMRTAYRTGKISEEEYKNFIKQKIKYAIEVQEDIGLDVLV
METE_THEYD      KLPLFPTTTIGSFPQTKEVRKFRADYKNGKITEEEYKKFIFQEIEKAVKIQEELDIDVLV
                 :*  *:*.*** **   :*  *            *           :  *    :*: *

METE_RHOPA      HGEFERNDMVQYFGEQLSGFAFTKEGWVQSYGSRCVRPPILFGDVSRPKPMTVGWWKYAQ
METE_RHOPT      HGEFERNDMVQYFGEQLSGFAFTKEGWVQSYGSRCVRPPILFGDVSRPKPMTVGWWKYAQ
METE_NITWN      HGEFERNDMVQYFGEQLSGFAFTRHGWVQSYGSRCVRPPVLFGDVSRPRPMTVGWWKYAQ
METE_BRADU      HGEFERNDMVQYFSEQLAGFAFTRNGWVQSYGSRCVRPPILFGDVVRPKPITVEWWRYAQ
METE_RHILO      HGEFERNDMVQYFAEQLRGFAFTQHGWVQSYGSRFVRPPIIIGDVSRQNPMTLHWWRYAQ
METE_CAUVC      HGEFERNDMVQYFGEQLAGFAFTQSGWVQSYGSRCVRPPILFGDVSRPAPMTVDWWRYAQ
METE_CHESB      HGEFERNDMVQYFSEQLSGYAFTKQGWVQSYGSRCVRPPIIFGDVSRPQPMTVDWATYAQ
METE_ACICJ      HGEFERNDMVKYFGEQLDGFAFTRHGWVQSYGSRCVAPPIIWGDVARPRPMTVRWARHAQ
METE_XYLF2      HGEFERNDMVEYFGEQLDGFIFTKLGWVQSYGSRCVKPPIIYGDVVRPAPMTVTWSAYAQ
METE_XYLFT      HGEFERNDMVEYFGEQLDGFIFTKLGWVQSYGSRCVKPPIIYGDVVRPAPMTVTWSAYAQ
METE_XYLFM      HGEFERNDMVEYFGEQLDGFIFTKLGWVQSYGSRCVKPPIIYGDVVRPAPMTVTWSAYAQ
METE_XYLFA      HGEFERNDMVEYFGEQLDGFIFTKLGWVQSYGSRCVKPPIIYGDVVRPAPMTVTWSAYAQ
METE_CYTH3      HGEFERNDMVEYFGEQLKGYVFSENGWVQSYGSRCVKPPIIYGDIERTEPMTVAWTTLAQ
METE_FLAJ1      HGEFERNDMVEYFGEQLDGFTFTKNGWVQSYGSRCVKPPVIYGDVSRPNPMTVKWSKYAQ
METE_PARL1      HGEPERTDMVEYFGEKLEGFAFTSLGWVQSYGSRCVKPPIIFGDVSRPEPMTVEWSRYAQ
METE_SALRD      HGEPERGDMVEHFGRQLDGFLFTENGWVQSYGTRCVRPPIIAGDVSRPEPMTTRWLSYAN
METE_DESVH      HGEPERNDMVEYFGGLLQGFCITSDGWVQSYGTRCVKPPLLYGDVSRPEPMTVAWSAYAR
METE_DESVM      HGEPERNDMVEYFGEQLRGFCITANGWVQSYGTRCVKPPLLYGDVARPGPMTVRWITHAQ
METE_SYNC1      HGEPERNDMVEYFGEQLAGFCFTENGWVQGYGSRCVKPPIIYGDVERLKPMTMEWTTYAQ
METE_ECODH      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDISRPAPITVEWAKYAQ
METE_ECOLI      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDISRPAPITVEWAKYAQ
METE_ECO57      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECO5E      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_SHIDS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_SHIB3      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_SHIBS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECOL5      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ESCF3      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECOSE      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_SHISS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECOLC      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECO24      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDISRPAPITVEWAKYAQ
METE_SHIFL      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDISRPAPITVEWAKYAQ
METE_SHIF8      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDISRPAPITVEWAKYAQ
METE_ECO8A      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDISRPAPITVEWAKYAQ
METE_ECOHS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDISRPAPITVEWAKYAQ
METE_ECOLU      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECOUT      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECO45      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECOK1      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECOL6      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECOSM      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_ECO7I      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIVIGDVSRPAPITVEWAKYAQ
METE_SALA4      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALNS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALPA      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALPK      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALCH      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALPB      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALSV      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALEP      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALG2      HGEAERNDMVEYFGEHLDGFVFTHNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALHS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALTY      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALDC      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALTI      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_SALAR      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_ENT38      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDVSRPEAITVEWAKYAQ
METE_CITK8      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDVSRPEPITVEWAKYAQ
METE_KLEP3      HGEAERNDMVEYFGEHLDGFIFTQNGWVQSYGSRCVKPPVVIGDVSRPQAITVDWAKYAQ
METE_KLEP7      HGEAERNDMVEYFGEHLDGFIFTQNGWVQSYGSRCVKPPVVIGDVSRPQAITVDWAKYAQ
METE_CROS8      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVVIGDISRPAPITVEWAKYAQ
METE_PECAS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDVSRPEAITVEWAKYAQ
METE_ERWT9      HGEAERNDMVEYFGEHLDGFIFTQNGWVQSYGSRCVKPPVIIGDVSRPEAITVNWAKYAQ
METE_YERPA      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_YERPN      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_YERPE      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_YERPP      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_YERPS      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_YERP3      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_YERE8      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_SERP5      HGEAERNDMVEYFGENLDGFVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQ
METE_PHOLL      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPVIIGDVSRPEAITVEWAKYAQ
METE_PROMH      HGEAERNDMVEYFGEHFEGYVFTQNGWVQSYGSRCVKPPVIIGDISRPAPITVDWATYAQ
METE_SODGM      HGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCVKPPIIIGDISRPEAITIEWARYAQ
METE_BAUCH      HGEAERNDMVEYFGEHLNGFIFTQNGWVQSYGSRCVKPPIIIGDISRPKPITVEWAWYAQ
METE_BLOFL      HGEPERNDMVEYFGENLKGFVSSQHGWIQSYGSRCIKPPIIIGDISRPIPITIPWINYAQ
METE_BLOPB      HGEPERNDMVEYFGENLNGFIFTQNGWVQSYGSRCVKPPVIIGDISRSKPITIEWISYAQ
METE_BUCAI      HGEAERNDMVEYFGEHLDGFAFTDNGWVQSYGSRCVKPPIIIGDISRPKPMTIEWSKYAQ
METE_BUCAP      HGEPERNDMVEYFGENLDGFIFTDNGWVQSYGSRCVKPPIIIGDVSRLKPITVKWSKYAQ
METE_BUCBP      HGEFERNDMVEYFGEHLNGFVFTEFGWVQSYGSRCVKPPIIIGDVSRSKPISLDWIKYAQ
METE_BUCCC      HGEPERNDMVEYFSEYLEGFVFTTYGWVQSYGSRCVKPPIIVGDISRITPMTVMWSKYAQ
METE_VIBHA      HGEAERNDMVEYFAENLAGFQTTKFGWVQSYGSRCVKPAIVVADIEREKPITVEWSTYAQ
METE_VIBC1      HGEAERNDMVEYFAENLAGFQTTKFGWVQSYGSRCVKPAIVVADIEREKPITVEWSTYAQ
METE_VIBPA      HGEAERNDMVEYFAENLAGFQTTKFGWVQSYGSRCVKPAIVVADIEREKPITVEWSTYAQ
METE_VIBVU      HGEAERNDMVEYFAENLAGFQTTQFGWVQSYGSRCVKPAIVVADIEREQPITVGWSTYAQ
METE_VIBVY      HGEAERNDMVEYFAEHLAGFQTTQFGWVQSYGSRCVKPAIVVADIEREQPITVGWSTYAQ
METE_VIBCH      HGEAERNDMVEYFAENLAGFQTTQFGWVQSYGSRCVKPAIVVADIEREKPITVEWSTYAQ
METE_ALIF1      HGEAERNDMVEYFAENLNGFQATRFGWVQSYGSRCVKPAIVVADIEREAPITVSWTQYAQ
METE_ALIFM      HGEAERNDMVEYFAENLNGFQATRFGWVQSYGSRCVKPAIVVADIEREAPITVSWTQYAQ
METE_PHOPR      HGEAERNDMVEYFAELLEGFAVTRFGWVQSYGSRCVKPAVIVSDIYRAKPMTVEWTTYAQ
METE_AERS4      HGEAERNDMVEYFGELLDGFAITRFGWVQSYGSRCVKPPVITTDIDRPTPMTLEWTKFAQ
METE_SHEON      HGEAERNDMVEYFGEQLEGVGFTKNGWVQSYGSRCVKPPLIYGDVSRPKAMTVDWAVFAQ
METE_BORBR      HGEPERNDMVEYFGELLAGFAFTKNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSAYAQ
METE_BORPA      HGEPERNDMVEYFGELLAGFAFTKNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSAYAQ
METE_BORPE      HGEPERNDMVEYFGELLAGFAFTKNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSAYAQ
METE_BORPD      HGEPERNDMVEYFGELLAGFAFTRNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSSYAQ
METE_BORA1      HGEPERNDMVEYFGELLAGFAFTKNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSSYAQ
METE_ALCBS      HGEAERNDMVEYFGELLDGFAFTRFGWVQSYGSRCVKPPIIFGDVQRPQAMTVEWARYAQ
METE_ALKEH      HGEAERNDMVEYFGEQLDGFAFTRAGWVQSYGSRCVKPPIIYGDVSRPRPMTVRWSEYAQ
METE_CHRSD      HGEPERNDMVEYFGELLDGFAFTRFGWVQSYGSRCVKPPVIFGDVSRPGPMTVRWSEYAQ
METE_PSEAE      HGEAERNDMVEYFAEQLDGYVFTRFGWVQSYGSRCVKPAVIYGDLSRPRAMTVEWIRYAQ
METE_PSEAB      HGEAERNDMVEYFAEQLDGYVFTRFGWVQSYGSRCVKPAVIYGDLSRPRAMTVEWIRYAQ
METE_PSEA8      HGEAERNDMVEYFAEQLDGYVFTRFGWVQSYGSRCVKPAVIYGDLSRPRAMTVEWIRYAQ
METE_PSEE4      HGEAERNDMVEYFAEQLDGYVFTRFGWVQSYGSRCVKPAVIFGDLSRPKAMTVEWIKYAQ
METE_PSEPW      HGEAERNDMVEYFAEQLDGYVFTRFGWVQSYGSRCVKPAVIYGDLSRPEAMTVAWIRYAQ
METE_PSEF5      HGEAERNDMVEYFAEQLDGYVFTRFGWVQSYGSRCVKPALIFGDLSRPNAMTVEWIRYAQ
METE_PSEMY      HGEAERNDMVEYFAEQLDGYAFTRFGWVQSYGSRCVKPAVIVGDLGRPQAMTVEWIKYAQ
METE_PSEA7      HGEAERNDMVEYFAEQLDGYAFTRFGWVQSYGSRCVKPAVIYGDLSRPRPMTVEWIRYAQ
METE_STUS1      HGEAERNDMVEYFAEQLEGYVFTRFGWVQSYGSRCVKPAIIYGDLSRPRPMTVDWIRYAQ
METE_PSESM      HGEAERNDMVEYFAEQLDGYLFTRFGWVQSYGSRCVKPAIIFGDLSRPQPMTVDWIRYAQ
METE_ACIF2      HGEPERNDMVEYFGEQLAGFAFTRHGWVQSYGSRYVKPPLIFGDVSRPTPMTVAWSKYAQ
METE_ACIF5      HGEPERNDMVEYFGEQLAGFAFTRHGWVQSYGSRYVKPPLIFGDVSRPTPMTVAWSKYAQ
METE_ACTPJ      HGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVTRPEPMTVRWSQYAQ
METE_ACTP7      HGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVTRPEPMTVRWSQYAQ
METE_ACTP2      HGEGERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVTRPEPMTVRWSQYAQ
METE_HAEIE      HGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVTRPEPMTVRWSQYAQ
METE_HAEIG      HGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVIRPEPMTVRWSQYAQ
METE_HAEIN      HGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVTRPEPMTVRWSQYAQ
METE_HAES1      HGEPERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVVRPKAMTVRWSKYAQ
METE_HISS2      HGEPERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVVRPEPMTVRWSKYAQ
METE_PASMU      HGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVVRPEPMTVRWSQYAQ
METE_NEIMA      HGEAERNDMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWSTYAQ
METE_NEIMF      HGEAERNDMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWSTYAQ
METE_NEIMB      HGEAERNDMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWSTYAQ
METE_NEIM0      HGEAERNDMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWSTYAQ
METE_NEIG1      HGEAERNDMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWSTYAQ
METE_CHRVO      HGEAERNDMVEYFGEQLAGFAFTAGGWVQSYGSRCVKPPIIFGDVARPKPMTVDWARYAQ
METE_BURMA      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURM9      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURM7      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURMS      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURP1      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURPS      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURP0      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURP6      HGEAERNDMVEYFGELLWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_BURTA      HGEAERNDMVEYFGELMWGFAITSNGWVQSYGSRCVKPPLVYGDVYLPEPMTVGWASYAQ
METE_RALPJ      HGEAERNDMVEYFGELLWGYAFTANGWVQSYGSRCVKPPVIYGDVYRPEAMTVEWSKYAQ
METE_RALSO      HGEAERNDMVEYFGELLWGYAFTANGWVQSYGSRCVKPPVIYGDVYRPEPMTVEWSRYAQ
METE_PARPJ      HGEAERNDMVEYFGEQLWGYAFTENGWVQSYGSRCVKPPIIYGDVYRPEPMTVETTRYAQ
METE_PARXL      HGEAERNDMVEYFGEQLWGYAFTENGWVQSYGSRCVKPPIIYGDVYRPEPMTVETTRYAQ
METE_CUPNE      HGEAERNDMVEYFGEQLCGYGFTENGWVQSYGSRCVKPPVIYGDVYRPEPMTVDTARYAQ
METE_CUPNH      HGEAERNDMVEYFGEQLCGYGFTENGWVQSYGSRCVKPPVIYGDVYRPEPMTVDTARYAQ
METE_METCA      HGEAERNDMVEYFGERLAGYAFTKHGWVQSYGSRCVKPPIIYGDVARPEPMTVEWIGYAQ
METE_NITEU      HGEPERNDMVEYFGEQLWGYAFTENGWVQSYGSRCVKPPILYGDVYRPEAMTVEWIKYAQ
METE_BURCM      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQ
METE_BURA4      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQ
METE_BURO1      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQ
METE_BURCH      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQ
METE_BURO0      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQ
METE_BURCJ      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQ
METE_BURL3      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQ
METE_BURVG      HGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPSAMTVEWIAYAQ
METE_PARP8      HGEAERNDMVEYFGEQLDGYVFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWICYAQ
METE_THIDA      HGEAERNDMVEYFGEQLDGYAFSRFGWVQSYGSRCVKPPILFGDVRRPRPMTVEWTRYGQ
METE_HAHCH      HGEAERNDMVEYFGEQLDGYVFSQFGWVQSYGSRCVKPPIIFGDISRPQAMTVEWIKYAQ
METE_MARN8      HGEPERNDMVEYFGEQLDGYAFTRFGWVQSYGSRCVKPPILFGDIRRPQAMTVEWIRYAQ
METE_RUTMC      HGEPERNDMVEYFGQQLSGYVFSQFGWVQSYGSRCVKPPIIFGDIFRPKPMTLDWITYAQ
METE_PSYIN      HGEAERNDMVEYFGELLDGFVFTQFAWVQSYGSRCVKPPILFGDVSRPKAMTVEWSSYAQ
METE_SACD2      HGEAERNDMVEYFGEQLDGYVFTQFGWVQSYGSRCVKPPIIFGDVSRPRKITVDWAEYAQ
METE_COXBU      HGEPERNDMVEYFGELLDGIAITSNGWVQSYGSRCVKPPIIFGDVSRERPMTLRWIEYAQ
METE_COXBN      HGEPERNDMVEYFGELLDGIAITSNGWVQSYGSRCVKPPIIFGDVSRERPMTLRWIEYAQ
METE_COXB1      HGEPERNDMVEYFGELLDGIAITSNGWVQSYGSRCVKPPIIFGDVSRERPMTLRWIEYAQ
METE_COXBR      HGELERNDMVEYFGELLDGIAITSNGWVQSYGSRCVKPPIIFGDVSRERPMTLRWIEYAQ
METE_COXB2      HGEPERNDMVEYFGELLDGIAITSNGWVQSYGSRCVKPPIIFGDVSRERPMTLRWIEYAQ
METE_NITOC      HGEAERNDMVEYFGEQLEGFAFTQNGWVQSYGSRCVKPPIIYGDVVRRQPMTVAWLRYAQ
METE_BIFLO      HGEFERNDMVEYFGQNLNGFLFTKNAWVQSYGTRCVKPPIVWGDVSRANPITVEWSAYAQ
METE_BIFLD      HGEFERNDMVEYFGQNLNGFLFTKNAWVQSYGTRCVKPPIVWGDVSRANPITVEWSAYAQ
METE_BIFAA      HGEFERNDMVEYFGQNLNGFLFTKNAWVQSYGTRCVKPPIVWGDVSRANPITVEWSAYAQ
METE_CAMJE      HGEFERNDMVEYFGENLKGFLFTQNGWVQSYGTRCVKPPVIWGDVSRTKPITLAWSKFAQ
METE_CAMJR      HGEFERNDMVEYFGENLKGFLFTQNGWVQSYGTRCVKPPVIWGDVSRTKPITLAWSKFAQ
METE_CAMJJ      HGEFERNDMVEYFGENLKGFLFTQNGWVQSYGTRCVKPPVIWGDVSRTKPITLAWSKFAQ
METE_CAMJ8      HGEFERNDMVEYFGENLKGFLFTQNGWVQSYGTRCVKPPVIWGDVSRTKPITLAWSKFAQ
METE_CAMJD      HGEFERNDMVEYFGENLKGFLFTQNGWVQSYGTRCVKPPIIWGDVSRTKPITLACSKFAQ
METE_STRGC      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRSV      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRPN      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRP4      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRR6      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRP2      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRPI      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRTD      HGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_STRSY      HGEFERNDMVEYFGENLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITVKWSSYAQ
METE_LACLM      HGEFERNDMVEYFGEQLDGYIFTQKAWVQSYGTRCVKPPIVWGDITRPQAMTVRWSAYAQ
METE_LACLS      HGEFERNDMVEYFGEQLDGYIFTQKAWVQSYGTRCVKPPIVWGDITRPQAMTVRWSAYAQ
METE_LACLA      HGEFERNDMVEYFGEKLEGYVFTQKAWVQSYGTRCVKPPIVWTDVTRPEAMTVRWSAYAQ
METE_DESRM      HGEPERNDMVEYFGERLSGFVFTQNGWVQSYGSRCVKPTVIFGDVSRPKPMTIDTILYAK
METE_CORGL      HGEPERNDMVQYFSELLDGFLSTANGWVQSYGSRCVRPPVLFGNVSRPAPMTVKWFQYAQ
METE_CORGB      HGEPERNDMVQYFSELLDGFLSTANGWVQSYGSRCVRPPVLFGNVSRPAPMTVKWFQYAQ
METE_COREF      HGEPERNDMVQYFAELLDGFLTTTNGWVQSYGSRCVRPPILFGTVTRPEPMTVRWFAHAQ
METE_MYCA1      HGEPERNDMVQYFAEQLEGFFATQNGWVQSYGSRCVRPPILYGDVVRTHPMTVEWITYAQ
METE_MYCPA      HGEPERNDMVQYFAEQLEGFFATQNGWVQSYGSRCVRPPILYGDVVRTHPMTVEWISYAQ
METE_MYCLE      HGEPERNDMVQYFAEQLGGFFATQNGWVQSYGSRCVRPPILYGDVSRPHPMTIEWITYAQ
METE_MYCBO      HGEPERNDMVQYFAEQLAGFFATQNGWVQSYGSRCVRPPILYGDVSRPRAMTVEWITYAQ
METE_MYCBP      HGEPERNDMVQYFAEQLAGFFATQNGWVQSYGSRCVRPPILYGDVSRPRAMTVEWITYAQ
METE_MYCTU      HGEPERNDMVQYFAEQLAGFFATQNGWVQSYGSRCVRPPILYGDVSRPRAMTVEWITYAQ
METE_MYCTA      HGEPERNDMVQYFAEQLAGFFATQNGWVQSYGSRCVRPPILYGDVSRPRAMTVEWITYAQ
METE_RHOJR      HGEPERNDMVQYFAEQLDGFFATDNGWVQSYGSRCVRPPILYGDVRRSNPMTVEWITYAQ
METE_STRAW      HGEAERNDMVQYFAERLTGYLTTQHGWVQSYGTRYVRPPVLAGDISRPEPMTVPWTTYAQ
METE_STRCO      HGEPERNDMVQYFAEQLTGYLATQHGWVQSYGTRYVRPPILAGDISRPEPMTVRWTTYAQ
METE_STRGG      HGEPERNDMVQYFAEQLDGYLATQHGWVQSYGTRYVRPPVLAGDISRPEPMTVRWTTYAQ
METE_HERA2      HGEPERNDMVQFFAEHLAGYVATQEGWVQSYGSRCVRPPVIAGDVYRTAALSVAETAYAQ
METE_SYNJB      HGEFERTDMVEYFAQKLEGFAFTEHGWVQSYGSRCVRPPILYGDVVRPQPMTVREFQVAQ
METE_THEVB      HGEFERSDMVEFFGQQLSGFAFTEHGWVQSYGSRCVRPPIIYGDIARPQPMTVREFKVAQ
METE_TRIEI      HGEFERSDMVEYFGEQLDGYTFTTHGWVQSYGSRYVRPPIIFGDIYRPHAMTIREFEVAQ
METE_BACVZ      HGEFERTDMVEYFGEKLAGFAFTKYAWVQSYGSRCVRPPVIFGDVEFIEPMTVKDTVYAQ
METE_BACSU      HGEFERTDMVEYFGEKLAGFAFTKYAWVQSYGSRCVRPPVIYGDVEFIEPMTVKDTVYAQ
METE_BACLD      HGEFERTDMVEYFGEKLGGFAFTKYAWVQSYGSRCVRPPVIYGDVEFKEPMTVKETVYAQ
METE_BACP2      HGEFERTDMVEYFGEKLAGFAFTKFAWVQSYGSRCVKPPIIYGDVEFTAPMTVKETVYAQ
METE_BACAN      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACC0      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACHK      HGEFERTDMVEYFSERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACAH      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACCZ      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACC7      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACC1      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACC2      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACCR      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACC4      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFINGMTIKETVYAQ
METE_BACMK      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPVIYGDVAFISGMTIKETVYAQ
METE_BACCN      HGEFERTDMVEYFGERLAGFSFTKNGWVQSYGSRCVKPPIIFGDVAFISDMTVKETVYAQ
METE_HALH5      HGEFERNDMVEFFGEKLDGFAFTANGWVQSYGSRCVKPPIIYGNVSFTEPMTVAETVYAQ
METE_LISMO      HGEFERTDMVEYFGQKLAGFQATKFGWVQSYGSRAVRPPLIYGDVAFTEEITVKESVYAQ
METE_LISMF      HGEFERTDMVEYFGQKLAGFQATKFGWVQSYGSRAVRPPLIYGDVAFTEEITVKESVYAQ
METE_LISIN      HGEFERTDMVEYFGQKLAGFQATKFGWVQSYGSRAVRPPLIYGDVAFTEEITVKESVYAQ
METE_LISW6      HGEFERTDMVEYFGQKLAGFQATKFGWVQSYGSRAVRPPLIYGDVAFTEEITVKESVYAQ
METE_LACPL      HGEFERTDMVEYFGQKLTGFYATQNGWVQSYGSRGVRPPVIFGDVAYTEPITVAESVYAQ
METE_STAAC      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAA8      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAE      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAT      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAA3      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAR      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAW      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAS      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAA1      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAN      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAM      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAA2      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAA9      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAAB      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKWTAPLTVDETVYAQ
METE_STAES      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPVIYGDVKWTAPLTVKETVYAQ
METE_STAEQ      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPVIYGDVKWTAPLTVKETVYAQ
METE_STAHJ      HGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPVIYGDVKWTEPLTVKETVYAQ
METE_STRA3      HGEFERVDMVEFFGQKLAGFTTTKLGWVQSYGSRAVKPPIIYGDVKHIQPLSLEETVYAQ
METE_STRA5      HGEFERVDMVEFFGQKLAGFTTTKLGWVQSYGSRAVKPPIIYGDVKHIQPLSLEETVYAQ
METE_STRA1      HGEFERVDMVEFFGQKLAGFTTTKLGWVQSYGSRAVKPPIIYGDVKHIQPLSLEETVYAQ
METE_STRMU      HGEFERVDMVEFFGQKLAGFTTTKFGWVQSYGSRAVKPPIIYGDVQHLEPITVEETVYAQ
METE_THEMA      HGEFERTDMVEFFAEKLNGIATTQNGWVLSYGSRCYRPPIIYGTVTRPEPMTLKEITYAQ
METE_THESQ      HGEFERTDMVEFFAEKLNGIATTQNGWVLSYGSRCYRPPIIYGTVTRPEPMTLKEITYAQ
METE_THEP1      HGEFERTDMVEFFAEKLNGIATTQNGWVLSYGSRCYRPPIIYGTVSRTGPMTLKEITYAQ
METE_AQUAE      HGEFERSDMVEYFAIKLDGIATTKHGWVLSYGSRVYRPPIIYGDVSRPAPMTLEEITYAQ
METE_THEYD      HGEFERTDMVEFFAEKLKGFAITKNGWVQSYGSRCVRPPVIYGDVWRDKALTVEETLYAQ
                *** ** ***:.*.  : *   :  .*: .** *   *.::   :     ::      ..

METE_RHOPA      SLTGRPMKGMLTGPVTILNWSFVRDDVPRSTACLQIALAIRDEVGDLEQAGATMIQIDEA
METE_RHOPT      SLTGRPMKGMLTGPVTILNWSFVRDDVPRSTACLQIALAIRDEVGDLEQAGATMIQIDEA
METE_NITWN      SLTAKPMKGMLTGPVTILNWSFVRDDVPRSLACRQIALAIRDEVSDLEQAGATMIQIDEA
METE_BRADU      SLTSKPMKAMLTGPVTILNWSFVRDDIPRSEVCRQLALAMRDEVRDLENAGAAMIQIDEA
METE_RHILO      SLTPKPVKGMLTGPVTILNWSFVRDDLPRSAVCRQVALAIRDEVSDLEKAGAKMIQIDEA
METE_CAUVC      GLTRRPMKGMLTGPVTILNWSFVRDDLPRETACRQIALAIRDEVVDLEATGAAIIQIDEA
METE_CHESB      SLTDKPVKGMLTGPVTMLQWSFVRDDLPRETVCRQIAFALRDEVSDLEAAGIGVIQIDEP
METE_ACICJ      SLTARPVKGMLTGPVTMLQWSFVRDDLPRETVCRQIALALRDEVADLEAAGLAIIQVDEP
METE_XYLF2      SLTDKPMKGMLTGPVTMLQWSFVRDDQERAQTCRQIALALRDEVQDLEKAGIKVIQIDEP
METE_XYLFT      SLTDKPMKGMLTGPVTMLQWSFVRDDQERAQTCRQIALALRDEVQDLEKAGIKVIQIDEP
METE_XYLFM      SLTDKPMKGMLTGPVTMLQWSFVRDDQERAQTCRQIALALRDEVQDLEKAGIKVIQIDEP
METE_XYLFA      SLTDKPMKGMLTGPVTMLQWSFVRDDQERAQTCRQIALALRDEVQDLEKAGIKVIQIDEP
METE_CYTH3      SLTKKYMKGMLTGPVTILQWSFVRDDQPRRDTCMQIAFAIRDEVVDLEAAGIKIIQIDEP
METE_FLAJ1      SLTSKWVKGMLTGPVTILQWSFVRNDQPRSETCTQIALAVRDEVVDLEKAGIKIIQIDEP
METE_PARL1      SLTDRPVKGMLTGPVTILQWSFVRDDQPRSETCRQIALAIRDEVYDLEAAGLGMIQIDEP
METE_SALRD      DQTDTPVKGMLTGPVTMLQWSFVRDDQSRAETCRQIALAIRDEVLDLEDVGIQAIQIDEP
METE_DESVH      SLTARPMKAMLTGPVTIACWSFVRDDISRETVLRQLALALRDEVADLESAGLAVVQVDEP
METE_DESVM      SLTQKPVKGMLTGPVTIACWSFVRDDVPRPVVFRQLALAIRDEVADLEAAGIGVIQIDEP
METE_SYNC1      QQTNRPLKGMLTGPVTMLCWSFVRDDQPRSATCKQIALAIRDEVQDLEQAGIKIIQVDEA
METE_ECODH      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOLI      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECO57      SMTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECO5E      SMTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SHIDS      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SHIB3      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SHIBS      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOL5      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ESCF3      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOSE      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SHISS      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOLC      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECO24      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SHIFL      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SHIF8      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECO8A      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOHS      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOLU      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOUT      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECO45      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOK1      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOL6      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECOSM      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ECO7I      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALA4      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALNS      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALPA      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALPK      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALCH      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALPB      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALSV      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALEP      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALG2      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALHS      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALTY      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALDC      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALTI      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_SALAR      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ENT38      SLTDKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_CITK8      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_KLEP3      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_KLEP7      SLTAKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_CROS8      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_PECAS      SLTDKPMKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDEP
METE_ERWT9      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_YERPA      SLTEKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_YERPN      SLTEKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_YERPE      SLTEKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_YERPP      SLTEKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_YERPS      SLTEKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_YERP3      SLTEKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_YERE8      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_SERP5      SLTDKPVKGMLTGPVTILCWSFPREDVTREVIAKQIALALRDEVEDLEKAGIGIIQIDEP
METE_PHOLL      SLTEKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVDDLQEAGIGIIQIDEP
METE_PROMH      SLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQIALALRDEVDDLQKAGIGIIQIDEP
METE_SODGM      SLTAKPVKGMLTGPVTILCWSFPREDVSRKTIARQIALALRDEVADLEQAGIGVIQIDEP
METE_BAUCH      SLTQKPVKGMLTGPVTILCWSFPREDLDRKTIARQIALALRDEVIDLENAGIGIIQIDEP
METE_BLOFL      SLTNKPVKGILTGPITIMTWSFAREDIPRHMIALQLALAIRDEVMDLEKSGIGVIQIDEP
METE_BLOPB      SLTNKPIKGILTGPVTIMSWSFPREDMQRKTIALQLALSIRDEVIDLEKSGIGIIQIDEP
METE_BUCAI      SLTKKPVKGMLTGPVTILLWSFPREDVSLKKIATQIALALYDEVLDLEKEKIEIIQIDEP
METE_BUCAP      SLTDKPVKAMLTGPVTILFWSFPREDISLEKIAKQIGLALRDEVLDLEKEKIEIIQIDEP
METE_BUCBP      TLTSKPVKGMLTGPVTILLWSFVREDLSKKIISRQIALALRDEVLDLEQSGVKIIQIDEP
METE_BUCCC      SLTKKPVKAMLTGPVTILCWSFPREDISKEDICNQIAISLRDEVLDLENSGINIIQIDEP
METE_VIBHA      SLTNKQMKGMLTGPVTILCWTFPREDITRKAIADQLALALRDEVSDLQQAGINIIQIDEP
METE_VIBC1      SLTSKQMKGMLTGPVTILCWTFPREDITRKEIAEQLALALRDEVSDLQDSGINIIQIDEP
METE_VIBPA      SLTSKQMKGMLTGPVTILCWTFPREDITRQEIAQQLALALRDEVSDLQDAGINIIQIDEP
METE_VIBVU      SLTSKQMKGMLTGPVTILCWTFPREDISRKAIAQQLALALRDEVSDLQDAGINIIQIDEP
METE_VIBVY      SLTSKQMKGMLTGPVTILCWTFPREDISRKAIAQQLALALRDEVSDLQDAGINIIQIDEP
METE_VIBCH      SLTSKQMKGMLTGPVTILCWTFPREDISRQEIAQQLALALRDEVADLQDAGINIIQIDEP
METE_ALIF1      SLTTKQMKGMLTGPVTILGWTFPREDITRKEIAQQLALVLRDEVSDLQQAGINIIQIDEP
METE_ALIFM      SLTTKQMKGMLTGPVTILGWTFPREDITRKEIAQQLALVLRDEVSDLQQAGINIIQIDEP
METE_PHOPR      SLTDKLVKGMLTGPVTILGWTFPREDLPRQGIANQIALALRDEVSDLQAAGIKIIQIDEP
METE_AERS4      SLTDKPVKGMLTGPVTILCWSFPREDVSREQSALQIGLAIRDEVADLEAAGIKIIQIDEP
METE_SHEON      SLTDKPVKGMLTGPVTILHWSFAREDISRDTIATQLALAIRDEVVDLQHAGIGIIQIDEP
METE_BORBR      SLTDKPVKGMLTGPVTILQWSFVRDDQPREATCRQLALALRDEVVDLEAAGIRVIQIDEP
METE_BORPA      SLTDKPVKGMLTGPVTILQWSFVRDDQPREATCRQLALALRDEVVDLEAAGIRVIQIDEP
METE_BORPE      SLTDKPVKGMLTGPVTILQWSFVRDDQPREATCRQLALALRDEVVDLEAAGIRVIQIDEP
METE_BORPD      SLTDKPVKGMLTGPVTILQWSFVRDDQPREQTCRQLALALRDEVVDLEQAGVRVIQIDEP
METE_BORA1      SLTDKPVKGMLTGPVTILQWSFVRDDQPREATCRQLALALRDEVLDLEKAGVKVIQIDEP
METE_ALCBS      SLTHKPVKGMLTGPVTILQWSFVRDDQPRADTCRQIALALRDEVQDLEKAGIKVIQIDEP
METE_ALKEH      SLTGRPMKGMLTGPVTVLQWSFVRDDQPRSETCRQIALALRDEVADLEAAGIPAIQIDEP
METE_CHRSD      SLTDKPMKGMLTGPVTILQWSFVRDDQPRDATCRQIALSLRDEVADLEAAGIKIIQIDEP
METE_PSEAE      SLTDKVMKGMLTGPVTMLMWSFPREDVSREVQARQLALAIRDEVVDLEAAGIRIVQIDEA
METE_PSEAB      SLTDKVMKGMLTGPVTMLMWSFPREDVSREVQARQLALAIRDEVVDLEAAGIRIVQIDEA
METE_PSEA8      SLTDKVMKGMLTGPVTMLMWSFPREDVSREVQARQLALAIRDEVVDLEAAGIRIVQIDEA
METE_PSEE4      GLTRKAMKGMLTGPVTMLMWSFPREDVTREVQARQLALAIRDEVVDLEAAGIKIVQIDEA
METE_PSEPW      GLTRKVMKGMLTGPVTMLMWSFPREDVSRETQARQLALAIRDEVLDLEAADIKIVQIDEA
METE_PSEF5      GLTDKVMKGMLTGPVTMLMWSFPREDVSREVQARQLALAIRDEVLDLEAAGIRIVQIDEA
METE_PSEMY      GLTDKPMKGMLTGPVTMLMWSFPREDVSREVQARQLALAIRDEVVDLEAAGIRIIQIDEA
METE_PSEA7      SLTGKVMKGMLTGPVTMLMWSFPREDVSREVQARQLALALRDEVSDLEQAGIRIVQIDEA
METE_STUS1      QQTDRIMKGMLTGPVTMLMWSFAREDVPREVQARQLALAIRDEVCDLEAAGIRIIQIDEA
METE_PSESM      SLTDKTMKGMLTGPVTMLMWSFSREDVSRQVQAQQLALAIRDEVLDLERAGIKIVQIDEA
METE_ACIF2      SLTQRPMKGMLTGPVTILQWSFVRDDQPRERTALQIALAIRDEVRDLIDAGIGIIQIDEP
METE_ACIF5      SLTQRPMKGMLTGPVTILQWSFVRDDQPRERTALQIALAIRDEVRDLIDAGIGIIQIDEP
METE_ACTPJ      SLTDKVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEKAGIKVIQIDEP
METE_ACTP7      SLTDKVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEKAGIKVIQIDEP
METE_ACTP2      SLTDKVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEKAGIKVIQIDEP
METE_HAEIE      SLTNRVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEAAGIKVIQIDEP
METE_HAEIG      SLTNRVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEAAGIKVIQIDEP
METE_HAEIN      SLTNRVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEAAGIKVIQIDEP
METE_HAES1      SLTKKVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEKAGIKVIQIDEP
METE_HISS2      SLTKKVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEKAGIKVIQIDEP
METE_PASMU      SLTNKVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEKAGIKVIQIDEP
METE_NEIMA      SLTKRPMKGMLTGPVTILQWSFVRNDIPRSTVCKQIALALNDEVLDLEKAGIKVIQIDEP
METE_NEIMF      SLTKRPMKGMLTGPVTILQWSFVRNDIPRSTVCKQIALALNDEVLDLEKAGIKVIQIDEP
METE_NEIMB      SLTKRPMKGMLTGPVTILQWSFVRNDIPRSTVCKQIALALNDEVLDLEKAGIKVIQIDEP
METE_NEIM0      SLTKRPMKGMLTGPVTILQWSFVRNDIPRATVCKQIALALNDEVLDLEKAGIKVIQIDEP
METE_NEIG1      NLTKRPMKGMLTGPVTILQWSFVRNDIPRATVCKQIALALNDEVLDLEKAGIKVIQIDEP
METE_CHRVO      SLTAKPVKGMLTGPVTILQWSFVRDDLPRREVCRQIALALNDEVLDLEAAGIRVIQIDEP
METE_BURMA      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURM9      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURM7      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURMS      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURP1      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURPS      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURP0      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURP6      SLSAKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQIDEP
METE_BURTA      SLTTKPVKGMLTGPVTMLQWSFVRDDQPRATTALQIALALRQETLDLEKAGIGMIQVDEP
METE_RALPJ      SLTSKPMKGMLTGPVTMLQWSFVRDDQPREQTALQIALALRDEVCDLEAAGIAAIQIDEP
METE_RALSO      SLTAKPMKGMLTGPVTMLQWSFVRDDQPREQTALQIALALRDEVRDLEAAGIAAIQIDEP
METE_PARPJ      SLTQRLMKGMLTGPVTMLQWSFVRDDQPRSTTALQLALAIRDEVVDLEKAGIRIIQIDEP
METE_PARXL      SLTQRLMKGMLTGPVTMLQWSFVRDDQPRSTTALQLALAIRDEVVDLEKAGIRIIQIDEP
METE_CUPNE      SLTERPMKGMLTGPITMLQWSFVRDDQPRATTARQLALAIRDEVCDLEQAGIRVIQIDEP
METE_CUPNH      SLTERPMKGMLTGPITMLQWSFVRDDQPRATTARQLALAIRDEVCDLEQAGIRVIQIDEP
METE_METCA      SLTKKPVKGMLTGPVTMLQWSFARDDQPRAVTALQIALAIRDEVADLEAAGVAAIQIDEP
METE_NITEU      SQTGKPVKGMLTGPVTMLMWSFVRDDQPRSTTALQLALAIRDEVADLENAGIGMIQIDEP
METE_BURCM      SLTNKPMKGMLTGPVTILNWSFVRDDQPRSVSCYQLALAIRDEVLDLEKAGVRVIQIDEA
METE_BURA4      SLTNKPMKGMLTGPVTILNWSFVRDDQPRSVSCYQLALAIRDEVLDLEKAGVRVIQIDEA
METE_BURO1      SLTRKPMKGMLTGPVTILNWSFVRDDQPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEA
METE_BURCH      SLTRKPMKGMLTGPVTILNWSFVRDDQPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEA
METE_BURO0      SLTRKPMKGMLTGPVTILNWSFVRDDQPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEA
METE_BURCJ      SLTNKPMKGMLTGPVTILNWSFVRDDQPRSVSCYQLALAIRDEVLDLEQAGVRVIQIDEA
METE_BURL3      SLTNKPMKGMLTGPVTILNWSFVRDDQPRSVSCYQLALAIREEVLDLEKAGVRVIQIDEA
METE_BURVG      SLTSKPMKGMLTGPVTILNWSFVRDDQPRSVSCYQLALAIRDEVLDLERAGVRVIQIDEA
METE_PARP8      AQTAKPMKGMLTGPVTILNWSFVRDDQPRSVSCRQLALAIREEVLDLEKAGVRVIQIDEA
METE_THIDA      SLTEKPMKGMLTGPVTLLNWSFVRDDQPRAESCKQLALTIRDEVADLEKAGVRVIQIDEA
METE_HAHCH      SLTDRPMKGMLTGPVTILNWSFVRDDQPRALTCYQLALAIRAEVQDLERAGVRIIQIDEA
METE_MARN8      SLTDKPVKGMLTGPVTILNWSFVRDDQPRKDSCLQLALAIREEVQDLEKAGVNIIQIDEA
METE_RUTMC      SLTNKPMKGMITGPVTMLNWSFVRDDQPRATTCLQLSLAIRDEVLDLEKSNINIIQIDEA
METE_PSYIN      SLTEKKVKGMLTGPVTILNWSFVRDDQPLQTTCMQIALAIREEVLDLEKAGINIIQIDEA
METE_SACD2      SLTSKPVKGMLTGPITMLQWSFVRDDQPRKITAQQIALALRSEVNDLEAAGITIIQVDEP
METE_COXBU      SLTTKSVKGMLTGPVTILAWSFVRDDQPRSQTAKQIALALRDEVQDLERSGVRVIQIDEP
METE_COXBN      SLTTKSVKGMLTGPVTILAWSFVRDDQPRSQTAKQIALALRDEVQDLERSGVRVIQIDEP
METE_COXB1      SLTTKSVKGMLTGPVTILAWSFVRDDQPRSQTAKQIALALRDEVQDLERSGVRVIQIDEP
METE_COXBR      SLTTKSVKGMLTGPVTILAWSFVRDDQPRSQTAKQIALALRDEVQDLERSGVRVIQIDEP
METE_COXB2      SLTTKSVKGMLTGPVTILAWSFVRDDQPRSQTAKQIALALRDEVQDLERSGVRVIQIDEP
METE_NITOC      SLTSRRVKGMLTGPVTLLQWSFVRDDQPRADTCLQLALVLRDEVRDLEQADIKLIQVDEP
METE_BIFLO      SKTDHVMKGMLTGPVTILNWSWPREDITHEEQTKQLALAIRDEVLDLEAAGIKVIQIDEA
METE_BIFLD      SKTDHVMKGMLTGPVTILNWSWPREDITHEEQTKQLALAIRDEVLDLEAAGIKVIQIDEA
METE_BIFAA      SRTDHVMKGMLTGPVTILNWSWPREDITHEQQTQQLALAIRDEVLDLEKAGIKVIQIDEA
METE_CAMJE      SLSQKIVKGMLTGPVTILNWSFPREDISLKESTEQIALAIRDEVLDLENAGIKIIQIDEA
METE_CAMJR      SLSQKIVKGMLTGPVTILNWSFPREDISLKESTEQIALAIRDEVLDLENAGIKIIQIDEA
METE_CAMJJ      SLSQKIVKGMLTGPVTILNWSFPREDISLKESTEQIALAIRDEVLDLENAGIKIIQIDEA
METE_CAMJ8      SLSQKIVKGMLTGPVTILNWSFPREDISLKESTEQIALAIRDEVLDLENAGIKIIQIDEA
METE_CAMJD      SLSQKIVKGMLTGPVTILNWSFPREDISLKESTEQIALAIRDEVLDLENAGIKIIQIDEA
METE_STRGC      SRTEKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGVKIIQIDEA
METE_STRSV      SRTDKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGVKIIQIDEA
METE_STRPN      SRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGVKIIQIDEA
METE_STRP4      SRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGVKIIQIDEA
METE_STRR6      SRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGVKIIQIDEA
METE_STRP2      SRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGVKIIQIDEA
METE_STRPI      SRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGVKIIQIDEA
METE_STRTD      SRTDKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGIKIIQIDEA
METE_STRSY      SRTNKPVKGMLTGPVTILNWSFPREDISIKESTLQIALAIKEEVLDLEAAGIKIIQIDEA
METE_LACLM      SQTSKPVKGMLTGPVTILNWSFPREDISLKESTLQLALAVQEEVLDLEKSGVKIIQIDEA
METE_LACLS      SQTSKPVKGMLTGPVTILNWSFPREDISLKESTLQLALAVQEEVLDLEKAGIKIIQIDEA
METE_LACLA      SQTSKPVKGMLTGPVTILNWSFPREDISLKASTLQLALAVQEEVLDLEKAGIKIIQIDEA
METE_DESRM      SKTNKIVKGMLTGPVTILNWSYCRSDMERSAVCEQIALAIRDEINDLQKAGIKIIQVDEA
METE_CORGL      SLTQKHVKGMLTGPVTILAWSFVRDDQPLATTADQVALALRDEINDLIEAGAKIIQVDEP
METE_CORGB      SLTQKHVKGMLTGPVTILAWSFVRDDQPLATTADQVALALRDEINDLIEAGAKIIQVDEP
METE_COREF      SLTNRPVKGMLTGPVTILAWSFVRDDQPLAVTADQIALALREEITDLVDAGAKIIQVDEP
METE_MYCA1      SLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQAAGIAVIQVDEP
METE_MYCPA      SLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQAAGIAVIQVDEP
METE_MYCLE      SLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQSAGIAIIQVDEP
METE_MYCBO      SLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQSAGIAVIQVDEP
METE_MYCBP      SLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQSAGIAVIQVDEP
METE_MYCTU      SLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQSAGIAVIQVDEP
METE_MYCTA      SLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQSAGIAVIQVDEP
METE_RHOJR      SLTQRPVKGMLTGPVTILAWSFVRDDQPLADSANQVALAIRDETVDLQGAGIRIVQVDEP
METE_STRAW      SLTDRPVKGMLTGPVTMLAWSFVRDDQPLGETARQVALALRDEVGDLEAAGTSVIQVDEP
METE_STRCO      SLTEKPVKGMLTGPVTMLAWSFVRDDQPLGDTARQVALALRDEVNDLEAAGTSVIQVDEP
METE_STRGG      SLTARPVKGMLTGPVTMLAWSFVRDDQPLGDTARQVALALRDEVNDLEANGTSVIQVDEP
METE_HERA2      SLTKRPVKGMLTGPVTMLQWSFVRDDLPRSAVAAQIGLALRDEVTDLEAAGINIIQIDEP
METE_SYNJB      SHTQKPVKGMLTGPVTMLNWSFPRVDIPRREQALQIALALRAEVADLEAAGAVMVQVDEP
METE_THEVB      SLTDKIVKAMLTGPVTMINWSFTRTDIPRSEQAMQIALALRDEVADLEAAGAKMIQIDEP
METE_TRIEI      SLTEKPVKGMLTGPVTMLNWSYPRTDISRQEQAFQLALAIREELKDLEKAGAAFIQVDEP
METE_BACVZ      SLTEKHMKGMLTGPVTILNWSFPRVDISRKEIAFQIGLALRKEVKALEDAGIQIIQVDEP
METE_BACSU      SLTSKHVKGMLTGPVTILNWSFPRNDISRKEIAFQIGLALRKEVKALEDAGIQIIQVDEP
METE_BACLD      SLTSKKVKGMLTGPVTILNWSFARYDLPRKEIAFQIACALRKEVEALEKAGIQIIQVDEP
METE_BACP2      SLTEKKVKGMLTGPVTILNWSFPRTDISRKDIAFQIAFALRKEVEALEEAGIQVIQVDEP
METE_BACAN      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACC0      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACHK      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACAH      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACCZ      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACC7      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACC1      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACC2      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACCR      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACC4      SLTEKVVKGMLTGPVTILNWSFVRNDIPRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACMK      SLTEKVVKGMLTGPVTILNWSFVRNDISRKEVSYQIALALRHEIELLESSGIRVIQVDEP
METE_BACCN      SLTNKVVKGMLTGPVTILNWSFVRNDLPRKEVCYQIALALRHEIERLESSGIRIIQVDEP
METE_HALH5      SLTDKPVKGMLTGPVTILNWSFVRDDLPLTVIAHQIAEALTHEVTALEEAGIEMIQIDEP
METE_LISMO      SLTKRPVKGMLTAPVTIINWSFVRDDVPESVVANQVGLALRKEVEALERNGIKVIQVDEP
METE_LISMF      SLTKRPVKGMLTAPVTIINWSFVRDDVPESVVANQVGLALRKEVEALERNGIKVIQVDEP
METE_LISIN      SLTKRPVKGMLTAPVTIINWSFVRDDVPESVVANQVGLALRKEVEALERNGIKVIQVDEP
METE_LISW6      SLTKRPVKGMLTAPVTIINWSFVRDDVPESVVANQVGLALRKEVEALERNGIKVIQVDEP
METE_LACPL      SLTDQPVKGMLTAPLTIINWSFVRDDIPRAQVQNQIALALRQEVQNLEKAGIKIIQVDEP
METE_STAAC      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAA8      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAE      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAT      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAA3      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAR      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAW      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAS      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAA1      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAN      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAM      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAA2      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAA9      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAAB      SLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLALEAAGIKVIQVDEP
METE_STAES      SLTDKPVKGMLTGPVTILNWSFERVDVPRKVVQDQIALAIDEEVLALEEAGIKVIQVDEP
METE_STAEQ      SLTDKPVKGMLTGPVTILNWSFERVDVPRKVVQDQIALAIDEEVLALEEAGIKVIQVDEP
METE_STAHJ      SLTDKPVKGMLTGPVTILNWSFERVDVPRKVVQDQIALAIDEEVLALEEAGIKVIQVDEP
METE_STRA3      SLTKKPVKGMLTGPITITNWSFERDDISRSDLFNQIALAIKDEIQLLEQSGIAIIQVDEA
METE_STRA5      SLTKKPVKGMLTGPITITNWSFERDDISRSDLFNQIALAIKDEIQLLEQSGIAIIQVDEA
METE_STRA1      SLTKKPVKGMLTGPITITNWSFERDDISRSDLFNQIALAIKDEIQLLEQSGIAIIQVDEA
METE_STRMU      SLTDRPVKGMLTGPITITNWSFERTDIPRDQLFNQIGLAIKDEIKLLENAGIAIIQVDEA
METE_THEMA      SLTEKPVKGMLTGPVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEP
METE_THESQ      SLTEKPVKGMLTGPVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEP
METE_THEP1      SLTEKPVKGMLTGPITIMGWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEP
METE_AQUAE      SLTNKPVKGMLTGPVTILNWSYYREDVPKREIAYQIALALLDEVKDLENAGIKVIQIDEP
METE_THEYD      SLTPRPVKGIMTGAVTILQWSYPRKDISRREIAYQIALALKEEVLELEKRGIKIIQIDEP
                  :   :*.::*..:*:  *:: * *        *:.  :  *   *       :*:**.

METE_RHOPA      ALREGLPLRRSEWKG-YLDWAVECFRLCSSGVKDETQIHTHMCYSEFNDIIDAIAAMDAD
METE_RHOPT      ALREGLPLRRSEWKG-YLDWAVECFRLCSSGVKDETQIHTHMCYSEFNDIIDAIAAMDAD
METE_NITWN      ALREGLPLRRSEWKT-YLDWAVECFRLCASGVADATQIHTHMCYSEFNDIIDAIASMDAD
METE_BRADU      ALREGLPLRRSDWKA-YLDWAGDCFRICSSGVTDQTQIHTHMCYSEFNDIIGAIAAMDAD
METE_RHILO      ALREGLPLREADWQA-YLDWAVECFRLASTAVGDATQIHTHMCYSEFGDIVDAIAAMDAD
METE_CAUVC      ALREGLPLRRGDWDA-YLDWAVESFRLAASGVADATQIHTHMCYSEFNDIIAAIGAMDAD
METE_CHESB      ALREGLPLREAERPA-YLDWAVECFRLASSGVKPETQIHTHMCYAEFNDIIDAIAAMDAD
METE_ACICJ      AFREGLPLRTADREA-YLRWAVSCFRLATAVVRDDTAIHTHMCYAEFQDIMPAIATMDAD
METE_XYLF2      AIREGLPLRRGEWAD-YLNWAVESFRIASSNVHDTTQIHTHMCYSEFNDIIEAVAALDAD
METE_XYLFT      AIREGLPLRRGEWAD-YLNWAVESFRIASSNVHDTTQIHTHMCYSEFNDIIEAVAALDAD
METE_XYLFM      AIREGLPLRRGEWAD-YLNWAVESFRIASSNVHDTTQIHTHMCYSEFNDIIEAVAALDAD
METE_XYLFA      AIREGLPLRRGEWAD-YLNWAVESFRIASSNVRDTTQIHTHMCYSEFNDIIEAVAALDAD
METE_CYTH3      AIREGLPLRRENWET-YLNWAVECFRISASGVKDETQIHTHMCYSEFNDIIKNIAAMDAD
METE_FLAJ1      AIREGLPLRKEEWAK-YLDWAVKAFRISASGVNDDTQIHPHMCYSEFNDIIQNIADMDAD
METE_PARL1      ALREGLPLHRSEWDT-YLRWACECFRLSVCVARDETQIHTHMCYSEFNDIIEAIADLDAD
METE_SALRD      AFREGLPLREHQWDD-YLDWAVECFRLASSGVRDETQIHTHMCYSEFNDIIEAIADMDAD
METE_DESVH      ALREGLPLRRAAQEA-YLDAAVRAFRLATSGVADATQLHTHMCYCDFHDIIDRIAGMDAD
METE_DESVM      ALREGLPLRRAAHAA-YLDAAVGAFRLASSGVRDATQIHTHMCYCDFHDIIDHVAALDAD
METE_SYNC1      ALREGLPLRKSAWRE-YLGWAVDAFRLTASGVADSTQIHTHMCYSEFNHIAEWIAKMDAD
METE_ECODH      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOLI      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECO57      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECO5E      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SHIDS      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SHIB3      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SHIBS      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOL5      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ESCF3      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOSE      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SHISS      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOLC      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECO24      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SHIFL      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SHIF8      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECO8A      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOHS      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOLU      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOUT      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECO45      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOK1      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOL6      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECOSM      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ECO7I      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SALA4      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALNS      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALPA      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIVALDAD
METE_SALPK      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIVALDAD
METE_SALCH      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALPB      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALSV      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALEP      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALG2      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALHS      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALTY      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALDC      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALTI      ALREGLPLRRSDWDA-YLEWGVEAFRINAAVAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_SALAR      ALREGLPLRRSDWDA-YLAWGVEAFRINAAAAKDETQIHTHMCYCEFNDIMDSIAALDAD
METE_ENT38      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_CITK8      ALREGLPLRRSDWDA-YLQWGVEAFRINAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_KLEP3      ALREGLPLKRSDWDA-YLQWGVEAFRLNAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_KLEP7      ALREGLPLKRSDWDA-YLQWGVEAFRLNAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_CROS8      ALREGLPLKRSDWDA-YLAWGVEAFRLNAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_PECAS      ALREGLPLHRSDWDA-YLAWAVDAFRLNAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_ERWT9      ALREGLPLHQSDWGA-YLEWAVDAFRLNAAVAQDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_YERPA      ALREGLPLRRADWQA-YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_YERPN      ALREGLPLRRADWQA-YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_YERPE      ALREGLPLRRADWQA-YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_YERPP      ALREGLPLRRADWQA-YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_YERPS      ALREGLPLRRADWQA-YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_YERP3      ALREGLPLRRADWQA-YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_YERE8      ALREGLPLRRADWQA-YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDAD
METE_SERP5      ALREGLPLRQSDWAA-YLNWAVDAFKLNAAVAKDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_PHOLL      ALREGLPLRREEWQS-YLDWAVEAFKLNAAIAKDDTQIHTHMCYCEFNDIMPSIAALDAD
METE_PROMH      ALREGLPLRRDEWQA-YLDWAVDAFKLSAAIADDETQIHTHMCYCEFNDIMEAIAALDAD
METE_SODGM      ALREGLPLKHSAWQD-YLTWAVEAFRLNAAVAQDDTQIHTHMCYCEFNDIMDSIAALDAD
METE_BAUCH      ALREGLPLKYSAWKE-YLTWAVEAFRLNAAVAKNNTQIHTHMCYSEFNDIMDSIIAMDAD
METE_BLOFL      ALREGLPLKKSEQSY-YLKWAINTFKITVSSVKDNTQIHTHMCYSEFNEIIDDILKLDVD
METE_BLOPB      ALREGLPLKRSDQKQ-YLEWAINVFRITVSSVKDDTQIHTHMCYSEFSDIIYAILALDAD
METE_BUCAI      ALREGLPLRKSSWHE-YLSWAVDVFRLSASGVKNTTQIHTHMCYCEFNDIMDSIALLDAD
METE_BUCAP      ALREGLPLRKSLWNE-YLSWAVDAFRLSSSGVKNTTQIHTHMCYCEFHDIMHAISFLDAD
METE_BUCBP      ALREGLPLRLSLRNE-YLSWAVDSFKLSSSGVCDETQIHTHMCYCEFNDIMNAIVLLDAD
METE_BUCCC      ALREGLPLRTHEWNN-YLRWAVKSFKICSSGVKNSTQIHTHMCYCEFNDIMPAIVDLDAD
METE_VIBHA      AIREGLPLKKRDHKA-YLQWAVDAFKIAAASAKPETQIHTHMCYSEFNEIIDSVAALDAD
METE_VIBC1      AIREGLPLKKRDHDA-YLQWAVDAFKISAASAKPETQIHTHMCYSEFNEIIDSVAALDAD
METE_VIBPA      AIREGLPLKKRDHKA-YLEWAVNAFKISAASAKPETQIHTHMCYSEFNEIIDSVAALDAD
METE_VIBVU      AIREGLPLKKRDHQN-YLDWAVEAFRISAASARPETQIHTHMCYSEFNEIIESVAALDAD
METE_VIBVY      AIREGLPLKKRDHQN-YLDWALEAFRISAASARPETQIHTHMCYSEFNEIIESVAALDAD
METE_VIBCH      AIREGLPLKKRDHQT-YLDWAVQAFKISAGSARPETQIHTHMCYSEFNEIIESVAALDAD
METE_ALIF1      AIREGLPIKKSDQKA-YLDWAVEAFKISAASAKSETQIHTHMCYSEFNEIIESVAALDAD
METE_ALIFM      AIREGLPIKKSDQKA-YLDWAVEAFKISAASAKSETQIHTHMCYSEFNEIIESVAALDAD
METE_PHOPR      AIREGLPLKESQWQA-YLDWAVNAFKISAASAEPQTQIHTHMCYSEFNHIIKSVAALDAD
METE_AERS4      AIREGLPLRKQDHQA-YLDWAVRAFRLSASPVVDSTQIHTHMCYSDFNLIIEAVAALDAD
METE_SHEON      AFREGLPLKQSEWQA-YLDWAVNAFKLSAAGVVDETQIHTHMCYSEFNDTIAAIAAMDAD
METE_BORBR      AIREGLPLRRADWRA-YLDWAVDCFRLSTAGVGEATQIHTHMCYSEFNDIIESIAAMDAD
METE_BORPA      AIREGLPLRRADWRA-YLDWAVDCFRLSTAGVGEATQIHTHMCYSEFNDIIESIAAMDAD
METE_BORPE      AIREGLPLRRADWRA-YLDWAVDCFRLSTAGVGEATQIHTHMCYSEFNDIIESIAAMDAD
METE_BORPD      AIREGLPLRRADWQA-YLDWAVDCFRLSTAGVAADTQIHTHMCYSEFNDIIESIAAMDAD
METE_BORA1      AIREGLPLRRADWQA-YLDWAVDCFRLSTAGVADDTQIHTHMCYSEFNDIIESIAAMDAD
METE_ALCBS      ALREGLPLRQEEWTQ-YLDWAVDCFRLATVSVDDDTQIHTHMCYSEFNDIIEAIAALDAD
METE_ALKEH      ALREGLPLQQRQWPG-YLDWAVDCFRLTASVAQDATQIHTHMCYSEFNDIMGAIATLDAD
METE_CHRSD      ALREGLPLRQGEWQE-YLDWAVKSFKLSAAVARDETQIHTHMCYSEFNDIIAAIAALDAD
METE_PSEAE      AFREGLPLRRNAWPH-YLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSEAB      AFREGLPLRRNAWPH-YLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSEA8      AFREGLPLRRNAWPH-YLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSEE4      AFREGLPLRRSAWPH-YLEWATEAFRLCASDVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSEPW      AFREGLPLRRSAWPA-YLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSEF5      AFREGLPLRRAQWQH-YLDWATEVFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSEMY      AFREGLPLRQAAWQG-YLDWATEAFRLAASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSEA7      AFREGLPLRRADWPH-YLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_STUS1      AFREGLPLRREQWRH-YLDWAVEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDAD
METE_PSESM      AFREGLPLRKAQWQQ-YLDWAVAAFRLCASGVRDETQIHTHMCYSEFNDVIKSIAAMDAD
METE_ACIF2      AYREGLPLKRKDWGH-YLEWASRAFRISAQIAPDDVQIHTHMCYSEFNDILPAIAAMDAD
METE_ACIF5      AYREGLPLKRKDWGH-YLEWASRAFRISAQIAPDDVQIHTHMCYSEFNDILPAIAAMDAD
METE_ACTPJ      AIREGLPLKRADWDA-YLQWAGEAFRLSYMGVKDDTQIHTHMCYSEFNDILPAIAGLDAD
METE_ACTP7      AIREGLPLKRADWDA-YLQWAGEAFRLSYMGVKDDTQIHTHMCYSEFNDILPAIAGLDAD
METE_ACTP2      AIREGLPLKRADWDA-YLQWAGEAFRLSYMGVKDDTQIHTHMCYSEFNDILPAIAGLDAD
METE_HAEIE      AIREGLPLKRADWDA-YLQWAGEAFRLSSMGVQDDTQIHTHMCYSEFNDILPAIAALDAD
METE_HAEIG      AIREGLPLKRADWDA-YLQWAGEAFRLSSMGVQDDTQIHTHMCYSEFNDILPAIAALDAD
METE_HAEIN      AIREGLPLKRADWDA-YLQWAGEAFRLSSMGVQDDTQIHTHMCYSEFNDILPAIAALDAD
METE_HAES1      AIREGLPLKRADWDT-YLQWAGEAFRLSSMGVADDTQIHTHMCYSEFNDILPAIAALDAD
METE_HISS2      AIREGLPLKRADWDT-YLQWAGEAFRLSSMGVADDTQIHTHMCYSEFNDILPAIAALDAD
METE_PASMU      AIREGLPLKRADWDA-YLQWAGEAFRLSYMGVQDDTQIHTHMCYSEFNDILPAIAGLDAD
METE_NEIMA      AIREGLPLKRADWDA-YLNWAGESFRLSSTGCEDSTQIHTHMCYSEFNDILPAIAAMDAD
METE_NEIMF      AIREGLPLKRADWDA-YLNWAGESFRLSSAGCEDSTQIHTHMCYSEFNDILPAIAAMDAD
METE_NEIMB      AIREGLPLKRADWDA-YLNWAGESFRLSSAGCEDSTQIHTHMCYSEFNDILPAIAAMDAD
METE_NEIM0      AIREGLPLKRADWDA-YLNWAGESFRLSSAGCEDSTQIHTHMCYSEFNDILPAIAAMDAD
METE_NEIG1      AIREGLPLKRADWDA-YLNWAGESFRLSSAGCEDSTQIHTHMCYSEFNDILPAIAAMDAD
METE_CHRVO      AIREGLPLKRAGRDV-YLAWAGEAFRLSSRGVDDATQIHTHMCYSEFGDILPAIAALDAD
METE_BURMA      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURM9      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURM7      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURMS      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURP1      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURPS      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURP0      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURP6      ALREGLPLKARERAA-YLDWAVRAFGIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_BURTA      ALREGLPLKARDRAE-YLDWAVRAFRIAASGVADDTQIHTHMCYSEFGDILPSIAALDAD
METE_RALPJ      AFREGLPLRASDVPT-YLEWAARAFRVSASGVRNDTQIHTHMCYSEFNDILPAIASMDAD
METE_RALSO      AFREGLPLRAGDVAV-YLEWAARVFRVSASGVRNDTQIHTHMCYSEFNDILPAIASMDAD
METE_PARPJ      AFREGLPLRRGDWAA-YLEWATRVFRISAAGVADQTQIHTHMCYSEFNDILPSIAAMDAD
METE_PARXL      AFREGLPLRRADWAA-YLEWATRAFRISAAGVADQTQIHTHMCYSEFNDILPSIAAMDAD
METE_CUPNE      ALREGLPLRRADWDA-YLDWAVTAFRLSASGVQDQTQIHTHMCYAEFNDILPAIAAMDAD
METE_CUPNH      ALREGLPLRRADWDA-YLDWAVTAFRLSASGVQDQTQIHTHMCYAEFNDILPAIAAMDAD
METE_METCA      AFREGLPLKAADRAD-YLDWAVKAFRLASCGVADDTQIHTHMCYSEFGDILPAIAELDAD
METE_NITEU      AFREGLPLRKQDWKS-YLDWAVKAFRVASSGVKDETQIHTHMCYSEFHDILPAIAELDAD
METE_BURCM      ALREGLPLRRAQWGE-YLKWAVEAFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDAD
METE_BURA4      ALREGLPLRRAQWGE-YLKWAVEAFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDAD
METE_BURO1      ALREGLPLRRAQWSE-YLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDAD
METE_BURCH      ALREGLPLRRAQWSE-YLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDAD
METE_BURO0      ALREGLPLRRAQWSE-YLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDAD
METE_BURCJ      ALREGLPLRRAQWSE-YLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDAD
METE_BURL3      ALREGLPLRRAQWGE-YLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDAD
METE_BURVG      ALREGLPLRRAQWPA-YLKWAIDAFRIAANGVRDDTQIHTHMCYSEFNDIIASIAEMDAD
METE_PARP8      ALREGLPLRRSQWNE-YLQWAVESFRIAANGVQDETQIHTHMCYSEFNDIIASIAEMDAD
METE_THIDA      ALREGLPLRRSQWKT-YLGWAVESFRIAANGVADETQIHTHMCYSEFNDIIEAIAAMDAD
METE_HAHCH      ALREGLPLRRAQWRE-YLQWAVSSFRIAANGVADETQIHTHMCYSEFNDIIEAIAGMDAD
METE_MARN8      ALREGLPLRQSDWAT-YLEWAINSFRIAANGVDDSTQIHTHMCYSEFNDIIEAIARMDAD
METE_RUTMC      ALREGLPLRKSQWQT-YLDWAIRAYRVSANGVSDETQIHTHMCYSEFNDIIEAIAQMDAD
METE_PSYIN      ALREKLPLHRSQWQQ-YLNWAIAAFRLCANGVNDKTQIHTHMCYSEFNDIIAAIAQMDAD
METE_SACD2      ALREGLPLRKKDWQN-YLDWAVEAFKISTAGVGDTTQIHTHMCYAEFNDIIQAIADLDAD
METE_COXBU      AFRECLPLRKAAWQD-YLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDAD
METE_COXBN      AFRECLPLRKAAWQD-YLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDAD
METE_COXB1      AFRECLPLRKAAWQD-YLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDAD
METE_COXBR      AFRECLPLRKAAWQD-YLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDAD
METE_COXB2      AFRECLPLRKAAWQD-YLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDAD
METE_NITOC      AFREGLPLRRVEWES-YLAWAVRCFRVASSGVEDGTQIHTHMCYSEFNDIIHAIAALDAD
METE_BIFLO      ALREKLPLRKSDWHVKYLDWAVPAFRLVHSAVKPTTQIHTHMCYSEFNDIIRDIDAMDAD
METE_BIFLD      ALREKLPLRKSDWHVKYLDWAVPAFRLVHSAVKPTTQIHTHMCYSEFNDIIRDIDAMDAD
METE_BIFAA      ALREKLPLRKTDWHKKYLDWAIPAFRLVHSAVKPTTQIHTHMCYSEFNDIIKDIDAMDAD
METE_CAMJE      ALREKLPLRKSDWHSEYLDWAIPAFNLVHSGVKAKTQIHTHMCYSEFSDILKEIDAMDAD
METE_CAMJR      ALREKLPLRKSDWHSEYLDWAIPAFNLVHSGVKAKTQIHTHMCYSEFSDILKEIDAMDAD
METE_CAMJJ      ALREKLPLRKSDWHSEYLDWAIPAFNLVHSGVKAKTQIHTHMCYSEFGDILKEIDAMDAD
METE_CAMJ8      ALREKLPLRKSDWHSEYLDWAIPAFNLVHSGVKAKTQIHTHMCYSEFSDILKEIDAMDAD
METE_CAMJD      ALREKLPLRKSDWHSEYLDWAIPAFNLVHSGVKAKTQIHTHMCYSEFSDILKEIDAMDAD
METE_STRGC      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_STRSV      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_STRPN      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_STRP4      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVASDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_STRR6      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_STRP2      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_STRPI      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_STRTD      ALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNLDAD
METE_STRSY      ALREKLPLRRSDWYSEYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDIIPAIDNMDAD
METE_LACLM      ALREKLPLRRSDWYSEYLDWAIPAFRLVHSKVKAETQIHTHMCYSEFEDIIPSIDAMDAD
METE_LACLS      ALREKLPLRRSDWYSEYLDWSIPAFRLVHSKVKAETQIHTHMCYSEFEDIIPSIDAMDAD
METE_LACLA      ALREKLPLRKSDWYKEYLDWAIPAFRLVHSKVKPETQIHTHMCYSEFEDIIPSIDAMDAD
METE_DESRM      AFKEGYPLRK-EKVAYYENWAVKSFKLAVSSAAIETQIHTHMCYSDFNDIIHTIEKMDAD
METE_CORGL      AIRELLPLRDVDKPA-YLQWSVDSFRLATAGAPDDVQIHTHMCYSEFNEVISSVIALDAD
METE_CORGB      AIRELLPLRDVDKPA-YLQWSVDSFRLATAGAPDDVQIHTHMCYSEFNEVISSVIALDAD
METE_COREF      AIRELLPLRRAEQDA-YTRWAVGAFRLSTSTAPDHVQIHTHMCYSEFNELIRSIIDLDAD
METE_MYCA1      ALRELLPLRRADQEE-YLRWAVGAFRLATSGVADSTQIHTHLCYSEFGEVIGAIADLDAD
METE_MYCPA      ALRELLPLRRADQDE-YLRWAVGAFRLATSGVADSTQIHTHLCYSEFGEVIGAIADLDAD
METE_MYCLE      ALRELLPLRRADQDE-YLCWAVKAFRLATSGVADSTQIHTHLCYSEFGEVIGAIADLDAD
METE_MYCBO      ALRELLPLRRADQAE-YLRWAVGAFRLATSGVSDATQIHTHLCYSEFGEVIGAIADLDAD
METE_MYCBP      ALRELLPLRRADQAE-YLRWAVGAFRLATSGVSDATQIHTHLCYSEFGEVIGAIADLDAD
METE_MYCTU      ALRELLPLRRADQAE-YLRWAVGAFRLATSGVSDATQIHTHLCYSEFGEVIGAIADLDAD
METE_MYCTA      ALRELLPLRRADQAE-YLRWAVGAFRLATSGVSDATQIHTHLCYSEFGEVIGAIADLDAD
METE_RHOJR      ALRELLPLRAADQPG-YLDWSVGAFRLATSGVSDSTQIHTHLCYSEFGEVIEAIARLDAD
METE_STRAW      ALRETLPLRAADRPA-YLAWATEAFRLTTGGVRPDTQIHTHMCYAEFGDIVQAIDDLDAD
METE_STRCO      ALRETLPLRAADHTA-YLAWATEAFRLTTSGVRPDTQIHTHMCYAEFGDIVQAIDDLDAD
METE_STRGG      ALRETLPLRAAEHAA-YLEWATESFRIATSGVRPDTQIHTHMCYAEFGDIVQAIDDLDAD
METE_HERA2      AFREGLPLRRNDWQN-YLDWAVRAFRIATSDAKPSTQIHTHMCYSDFNDIIAAIAALDAD
METE_SYNJB      ALREGLPLKKERWPE-YLSWAVDAFRLATGGAKPETQIHTHMCYSEFGDIIEHIERLDAD
METE_THEVB      ALREGLPLKAERWNE-YLSWAVDAFRLAAGVAKPETQIHTHMCYSEFGDIIEHIERLDAD
METE_TRIEI      AMREGLPLKQQRWHE-YLNWAVDAFRLSTAIARPETQVHTHMCYSEFGDIMESIKQLDAD
METE_BACVZ      ALREGLPLKTQDWDE-YLTWAAEAFRLTTSSVQNETQIHTHMCYSNFEDIVDTINDLDAD
METE_BACSU      ALREGLPLKTRDWDE-YLTWAAEAFRLTTSSVKNETQIHTHMCYSNFEDIVDTINDLDAD
METE_BACLD      ALREGLPLKERDWDE-YLKWAAEAFRLSTSSVEDTTQIHTHMCYSNFEDIVDAIEDLDAD
METE_BACP2      ALREGLPLKESDWAD-YLNWAAESFRLSTSSVQNETQIHTHMCYSNFEDIVDTIEDLDAD
METE_BACAN      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACC0      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACHK      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACAH      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACCZ      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANVTQIHTHMCYSNFEDIVDAIRALDAD
METE_BACC7      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACC1      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACC2      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACCR      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACC4      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACMK      ALREGMPLKEKDWDA-YITWAVQSFLLATSSVENETQIHTHMCYSNFEDIVDAIRALDAD
METE_BACCN      ALREGMPLKEKDWDS-YIEWAVQSFRLATASVANETQIHTHMCYSNFEDIVDAIRALDAD
METE_HALH5      AIREGLPLKAEDQQE-YLDWAVSAFRASCAHVKATTQIHTHMCYSEFHEMIEAIDDLDAD
METE_LISMO      ALREGLPLKQARWEK-YLNDAVYSFKLTTASVQNDTQIHTHMCYSDFDDIIDTISALDAD
METE_LISMF      ALREGLPLKQARWQK-YLDDAVYSFKLTTASVQNDTQIHTHMCYSDFDDIIDTISALDAD
METE_LISIN      ALREGLPLKQARWQK-YLDDAVYSFKLTTASVQNDTQIHTHMCYSDFDDIIDTISALDAD
METE_LISW6      ALREGLPLKQARWEK-YLNDAVYSFKLTTASVQNDTQIHTHMCYSDFDDIIDTISALDAD
METE_LACPL      ALREGLPLKQRHWQA-YLDEAVYSFKITTTGVQNDTQIHTHMCYSNFADIINTIKALDAD
METE_STAAC      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAA8      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAE      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAT      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAA3      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAR      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAW      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAS      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAA1      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAN      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAM      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAA2      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAA9      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAAB      ALREGLPLRSEYHEQ-YLKDAVLSFKLATSSVRDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAES      ALREGLPLRSEYHEQ-YLEDAVHSFKLATSSVHDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAEQ      ALREGLPLRSEYHEQ-YLEDAVHSFKLATSSVHDETQIHTHMCYSQFGQIIHAIHDLDAD
METE_STAHJ      ALREGLPLRSEYHEQ-YLADAVNSFKLATSSVQDETQIHTHMCYSQFGQIIHAIHELDAD
METE_STRA3      ALREGLPLRQQKQQA-YLDDAVAAFKIATSSVKDETQIHTHMCYSKFDEIIDSIRALDAD
METE_STRA5      ALREGLPLRQQKQQA-YLDDAVAAFKIATSSVKDETQIHTHMCYSKFDEIIDSIRALDAD
METE_STRA1      ALREGLPLRQQKQQA-YLDDAVAAFKIATSSVKDETQIHTHMCYSKFDEIIDSIRALDAD
METE_STRMU      ALREGLPLRKSKQKA-YLDDAVHAFHIATSSVKDETQIHTHMCYSKFDEIIDAIRALDAD
METE_THEMA      AFREKAPIKKSKWPE-YFEWAINAFNLA-ANARPETQIHAHMCYSDFNEIIEYIHQLEFD
METE_THESQ      AFREKAPIKKSKWPE-YFEWAINAFNLA-ANARPETQIHAHMCYSDFNEIIEYIHQLEFD
METE_THEP1      AFREKAPVKKSKWPE-YFEWAINAFNLA-ANARPETQIHAHMCYSDFNEIIEYIHQLEFD
METE_AQUAE      AFREGAPLKKRDWPE-YFDWAVKAFRLA-SRAKPETQIHTHMCYSEFNEIIEYIYQMDFD
METE_THEYD      AFREGLPLKRNKQDE-YFDWTINSFRLTTADVSPFTQIHTHMCYSDFNEIIDRIYALDAD
                * :*  *::       *       :          . :*.*:**..*      :  :: *

METE_RHOPA      VISIETSRSKMELLDAFKTY---KYPNEIGPGVYDIHSPRVPSVEEMTTLLQLARQRLSD
METE_RHOPT      VISIETSRSKMELLDAFKTY---KYPNEIGPGVYDIHSPRVPSVEEMTTLLQLARQRLSD
METE_NITWN      VISIETSRSKMELLDAFKTY---KYPNEIGPGVYDIHSPRVPAVDEMTGLLKLARERLSD
METE_BRADU      VISIETSRSKMELLDAFRRY---EYPNQIGPGVYDIHSPRVPETDEMKELIVLARTRLQD
METE_RHILO      VISIETSRSQLELLDTLRTF---KYPNEIGPGVYDIHSPRVPEVGEISNLIMLARKRLSD
METE_CAUVC      VISIETARSKMELLDAFVGY---AYPAQIGPGVYDIHSPRVPAVEEMTTLLAAARQRLAG
METE_CHESB      VISIETSRSKMELLRAFRAF---RYPNDIGPGVFDIHSPRVPPADEMADLLRKAEDGLDP
METE_ACICJ      AISIETARSRMELLEAFAGHGPSAYPAEIGPGVWDIHSPRIPPEEEILALLRLARRKLAD
METE_XYLF2      VISIETSRSRMELLDAFVKF---RYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPP
METE_XYLFT      VISIETSRSRMELLDAFVKF---RYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPP
METE_XYLFM      VISIETSRSRMELLDAFVKF---RYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPP
METE_XYLFA      VISIETSRSRMELLDAFVKF---RYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPP
METE_CYTH3      VITIETSRSQMELLDAFVDF---NYPNEIGPGVYDIHSPRIPTTDEMADLLNKAMHVLPV
METE_FLAJ1      VITIECSRSQMELLDAFANF---KYPNEIGPGVYDIHSPRVPSSKEMVRLLEKASAVIPV
METE_PARL1      VISIETSRSRMELLDAFVDF---SYPNDIGPGVYDIHSPRVPARGEMLSLLRLAAERLPS
METE_SALRD      VISVEASRSKMELLDSFDAF---DYPNEIGPGVYDIHSPRVPSVEEMEELIRTALDALEP
METE_DESVH      VISLEASRSRMELLDVFATH---GYPNEVGPGVYDIHSPRVPSVDEMEALLLRAAAVLPV
METE_DESVM      VISLEASRSRMELLDVFATH---AYPNEVGPGVYDIHSPRVPSIDEMETLLRAASRVLPL
METE_SYNC1      VISIEASRSNMELLGVLESF---TYPNDIGPGVYDIHSPRVPSVAEMVELLRKASEVIPL
METE_ECODH      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOLI      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECO57      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECO5E      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_SHIDS      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_SHIB3      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_SHIBS      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOL5      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ESCF3      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOSE      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_SHISS      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOLC      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECO24      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_SHIFL      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_SHIF8      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECO8A      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOHS      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOLU      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOUT      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECO45      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOK1      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOL6      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECOSM      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_ECO7I      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAKRIPA
METE_SALA4      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALNS      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALPA      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALPK      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALCH      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALPB      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALSV      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALEP      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALG2      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALHS      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALTY      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALDC      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALTI      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_SALAR      VITIETSRSDMELLESFEAF---DYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPA
METE_ENT38      VITIETSRSDMELLESFEEF---DYPNEIGPGVYDIHSPNVPSVEWIEALLAKAAQRIPA
METE_CITK8      VITIETSRSDMELLESFEEF---EYPNEIGPGVYDIHSPNVPSVEWIEALLNKAAQRIPA
METE_KLEP3      VITIETSRSDMELLESFEAF---EYPNEIGPGVYDIHSPNVPSVEWIEALLAKAAQRIPA
METE_KLEP7      VITIETSRSDMELLESFEAF---EYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPV
METE_CROS8      VITIETSRSDMELLESFEEF---EYPNEIGPGVYDIHSPNVPDVAWIEALLKKAAQRIPQ
METE_PECAS      VITIETSRSDMELLESFEEF---EYPNEIGPGVYDIHSPNVPSVEWMEALLKKAAQRIPA
METE_ERWT9      VITIETSRSDMELLESFEEF---EYPNEIGPGVYDIHSPNVPSVEWVEALLLKAAQRIPT
METE_YERPA      VITIETSRSDMELLESFEDF---AYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPA
METE_YERPN      VITIETSRSDMELLESFEDF---AYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPA
METE_YERPE      VITIETSRSDMELLESFEDF---AYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPA
METE_YERPP      VITIETSRSDMELLESFEDF---AYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPA
METE_YERPS      VITIETSRSDMELLESFEDF---AYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPA
METE_YERP3      VITIETSRSDMELLESFEDF---AYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPA
METE_YERE8      VITIETSRSDMELLESFEDF---AYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPA
METE_SERP5      VITIETSRSDMDLLEAFKEF---EYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQNIPA
METE_PHOLL      VITIETSRSDMELLDSFENF---SYPNEIGPGVYDIHSPNVPSVEWIEALLRKAADRIPV
METE_PROMH      VITIETSRSDMELLEAFEHF---DYPNEIGPGVYDIHSPNVPNVEWIVGLLRKAQSRIPA
METE_SODGM      VITIETSRSDMELLETFKEF---DYPNEIGPGVYDIHSPNVPSEEWIVELLRKAAQRIPA
METE_BAUCH      VITIETSRSNMKLLDTFKQY---QYPNDIGPGVYDIHSPNIPSEDDIIQLLRKAAQVIPI
METE_BLOFL      VISIESSRSDLQLLQFIKTAG--KKLNEIGPGIYDIHSIHQPSINEIMDKLKKLLQYIPK
METE_BLOPB      VISIEAARSDEKILKSIRHVI--KNLNEIGPGIYDIHSPNKPTQNDLIRRINQLLKYIPE
METE_BUCAI      VITIEAARSDMELLESFKKF---KYPNEVGPGAYDIHSSNIPSVQSIISLLNKAMKYIPL
METE_BUCAP      VITIETARSDMELLKSFKTF---KYPNEIGPGVYDIHSSNIPSITSIKFLLNKAIAYIPV
METE_BUCBP      VITIETSRSDMELLEFFKEF---KYPNDIGPGVYDIHSPNIPSIEWIMTLLRQAMHYIPV
METE_BUCCC      VITIETSRSDMELLEFFKTF---KYPNAIGPGVYDIHSPNIPSVQSIEKLLKKALKYISI
METE_VIBHA      VITIETSRSNMELLKAFEDF---NYPNEIGPGVYDIHSPNIPSEEWIEELIKKAAEKIPA
METE_VIBC1      VITIETSRSNMELLKAFEAF---NYPNEIGPGVYDIHSPNIPTQEWIEALLKKAAEKVPV
METE_VIBPA      VITIETSRSNMELLKAFEEF---NYPNEIGPGVYDIHSPNIPTEEWIEGLIKKAAEKIPV
METE_VIBVU      VITIETSRSNMELLKAFEEF---NYPNEIGPGVYDIHSPNIPSEEWIVDLVKKAAQKIPV
METE_VIBVY      VITIETSRSNMELLKAFEEF---NYPNEIGPGVYDIHSPNIPSEEWIVDLVKKAAQKIPV
METE_VIBCH      VITIETSRSNMELLKAFEEF---NYPNEIGPGVYDIHSPNIPAQAWIEDLLRKAAEKIPA
METE_ALIF1      VITIETSRSNMELLKAFEDF---NYPNEIGPGVYDIHSPNIPSQEWIVDLIETAAARVPV
METE_ALIFM      VITIETSRSNMELLKAFEDF---NYPNEIGPGVYDIHSPNIPSQEWIVDLIETAAARVPV
METE_PHOPR      VITIETSRSDMELLKAFEEF---DYPNEIGPGVYDIHSPNIPSIEQIVHLVEKAETLIPI
METE_AERS4      VITIETSRSQMQLLEAFERF---NYPNEIGPGVYDIHSPNVPSQGWIEDLIRKAAKQIPA
METE_SHEON      VITIETSRSRMELLNAFEDF---EYPNEIGPGVYDIHSPNTPSVEAMVHLIEKAAQKVPV
METE_BORBR      VITIETSRSNMELLKAFEDF---HYPNDIGPGVYDIHSPNVPEVDWMVELMRKAAARLPK
METE_BORPA      VITIETSRSNMELLKAFEDF---HYPNDIGPGVYDIHSPNVPEVDWMVELMRKAAARLPK
METE_BORPE      VITIETSRSNMELLKAFEDF---HYPNDIGPGVYDIHSPNVPEVDWMVELMRKAAARLPK
METE_BORPD      VITIETSRSNMELLKAFEDF---RYPNDIGPGVYDIHSPNVPDVDWMVGLMRKAAGRLPS
METE_BORA1      VITIETSRSNMELLKAFEDF---HYPNDIGPGVYDIHSPNVPDVDWMVGLMQKAGANLSK
METE_ALCBS      VITIETSRSNMELLDAFRDF---HYPNDIGPGVYDIHSPNEPDVAWMVQLMEKAAERLPK
METE_ALKEH      VITIETSRSDMELLEVFEGF---EYPNEIGPGVYDIHSPNTPSVDWMVRLMEKAARRIPV
METE_CHRSD      VITIETSRSDMELLDAFQDF---AYPNEIGPGVYDIHSPNIPEVEWMVSLMEKAAEKIPA
METE_PSEAE      VITIETSRSDMELLEAFEQF---DYPNEIGPGVYDIHSPRVPSREEIVALLRKAARRIPA
METE_PSEAB      VITIETSRSDMELLEAFEQF---DYPNEIGPGVYDIHSPRVPSREEIVALLRKAARRIPA
METE_PSEA8      VITIETSRSDMELLEAFEQF---DYPNEIGPGVYDIHSPRVPSREEIVALLRKAARRIPA
METE_PSEE4      VITIETSRSDMELLEAFERF---DYPNEIGPGVYDIHSPRVPTKEEMVKLLRKAAQRIPA
METE_PSEPW      VITIETSRSDMELLEAFEKF---DYPNEIGPGVYDIHSPRVPSREEMVKLLRKAALRIPA
METE_PSEF5      VITIETSRSDMELLDAFKAF---AYPNEIGPGVYDIHSPRVPDASEMANLLRKAAQRIPA
METE_PSEMY      VITIETSRSDMELLEAFERF---AYPNEIGPGVYDIHSPRVPDSAEMAGLLRKAARRIPL
METE_PSEA7      VITIETSRSDMELLEAFEAF---AYPNEIGPGVYDIHSPRVPAVEDMVKLLSKAAERIPA
METE_STUS1      VITIETSRSQMELLEAFRAF---DYPNDIGPGVYDIHSPRVPDTAEMVQLLEKAAECIPA
METE_PSESM      VITIETSRSDMELLDAFEAF---DYPNDIGPGVYDIHSPRVPETAEMVSLIAKAARRIPA
METE_ACIF2      VITIETSRSQMELLDAFATF---NYPNEIGPGVYDIHSPRVPSVEEMVGLMEKAVKVVPA
METE_ACIF5      VITIETSRSQMELLDAFATF---NYPNEIGPGVYDIHSPRVPSVEEMVGLMEKAVKVVPA
METE_ACTPJ      VITIETSRSDMELLTAFADF---KYPNDIGPGVYDIHSPRVPTAGEIEHLLRKALKVIPK
METE_ACTP7      VITIETSRSDMELLTAFADF---KYPNDIGPGVYDIHSPRVPTAGEIEHLLRKALKVIPK
METE_ACTP2      VITIETSRSDMELLTAFADF---KYPNDIGPGVYDIHSPRVPTAGEIEHLLRKALKVIPK
METE_HAEIE      VITIETSRSDMELLTAFADF---KYPNDIGPGVYDIHSPRVPTAAEVEHLLRKALNVIPK
METE_HAEIG      VITIETSRSDMELLTAFADF---KYPNDIGPGVYDIHSPRVPTATEVEHLLRKALNVIPK
METE_HAEIN      VITIETSRSDMELLTAFADF---KYPNDIGPGVYDIHSPRVPTATEVEHLLRKALNVIPK
METE_HAES1      VITIETSRSDMELLTAFGDF---KYPNDIGPGVYDIHSPRVPTAEEIEHLLRKALNVVPK
METE_HISS2      VITIETSRSDMELLTAFGDF---KYPNDIGPGVYDIHSPRVPTAEEIEHLLRKALNVVPK
METE_PASMU      VITIETSRSDMELLTAFGDF---KYPNDIGPGVYDIHSPRVPKAEEIERLLRKALNVVPK
METE_NEIMA      VITIETSRSDMELLTAFGEF---KYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPV
METE_NEIMF      VITIETSRSDMELLTAFGEF---KYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPV
METE_NEIMB      VITIETSRSDMELLTAFGEF---QYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPV
METE_NEIM0      VITIETSRSDMELLTAFGKF---KYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPV
METE_NEIG1      VITIETSRSDMELLAAFGEF---KYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPV
METE_CHRVO      VITIETSRSDMALLADFGRF---RYPNAIGPGVYDIHSPRVPSAAEIRALLDKALRVIPA
METE_BURMA      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURM9      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURM7      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURMS      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURP1      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURPS      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURP0      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURP6      VISIETTRSNMELLDAFETF---DYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_BURTA      VISIETTRSNMELLDAFETF---EYPNEIGPGVYDIHSPRVPDADEIERLILLALERIPA
METE_RALPJ      VITIETSRSNMELLDAFAEF---AYPNEIGPGVYDIHSPRVPRVDEMESLLDKAAQVVPV
METE_RALSO      VITIETSRSNMELLDAFGEF---AYPNEIGPGVYDIHSPRVPRVEEMEALLDKAAQVVPV
METE_PARPJ      VITIETSRSAMELLDGFGAF---AYPNEIGPGVYDIHSPRVPDAQAMQRLLERACEVIPA
METE_PARXL      VITIETSRSAMELLDGFGAF---AYPNEIGPGVYDIHSPRVPGADAMQRLLERACEVIPA
METE_CUPNE      VITIETSRSAMELLEGFGDF---DYPNEIGPGVYDIHSPRVPSVQAMERLLDRACEVVPP
METE_CUPNH      VITIETSRSAMELLEGFGDF---DYPNEIGPGVYDIHSPRVPSVQAMERLLDRACEVVPP
METE_METCA      VITIETCRSAMDLLEAFGAF---GYPNDIGPGVYDIHSPRVPAGAEIRALLEKAAAAVDP
METE_NITEU      VITIETSRSRMELLDAFVKF---SYPNEIGPGVYDIHSPRVPDASEMFELLKKASRYIDP
METE_BURCM      VITIETSRSDMELLDAFDSF---RYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPA
METE_BURA4      VITIETSRSDMELLDAFDSF---RYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPA
METE_BURO1      VITIETSRSDMELLDAFDTF---KYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPA
METE_BURCH      VITIETSRSDMELLDAFDTF---KYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPA
METE_BURO0      VITIETSRSDMELLDAFDTF---KYPNEIGPGVYDIHSPNIPTQDHIVGLMRKAAERIPA
METE_BURCJ      VITIETSRSDMELLDAFDDF---KYPNEIGPGVYDIHSPNIPTQDHIVGLMRKAAERIPA
METE_BURL3      VITIETSRSDMELLDAFDNF---KYPNEIGPGVYDIHSPNIPTQEHIVGLMKKAAERIPA
METE_BURVG      VITIETSRSDMELLDAFDGF---RYPNEIGPGVYDIHSPNIPTQEHIVGLMRKAAERIPA
METE_PARP8      VITIETSRSDMELLDAFDDF---HYPNQIGPGVYDIHSPNIPDQAHVVDLMKKAAERIPA
METE_THIDA      VITIETSRSDMELLDAFDHF---SYPNEIGPGVYDIHSPNIPTPQHIVNLIKKAAERIPA
METE_HAHCH      VITIETSRSDMELLDAFDNF---KYPNEIGPGVYDIHSPNIPSETHIVQLMRKAAERIPA
METE_MARN8      VITIETSRSDMELLDAFRSF---EYPNDIGPGVYDIHSPNIPDKEHIINLMTLAAERIPA
METE_RUTMC      VITIETSRSDMELLDIFDEF---DYPNEIGPGVYDIHSPNIPSVDSIVELMQKAAKYIPI
METE_PSYIN      VITIETSRSDMVLLDVFEAF---SYPNGIGPGVYDIHSPNIPDVEQMVSLMKKAALRIPA
METE_SACD2      VITIETSRSNMELLSAFEQF---NYPNDIGPGVYDIHSPNIPATEQVVGLIKKAAENLPL
METE_COXBU      VITIESSRSEMEILKSFEKF---AYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPI
METE_COXBN      VITIESSRSEMEILKSFEKF---AYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPI
METE_COXB1      VITIESSRSETEILKSFEKF---AYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPI
METE_COXBR      VITIESSRSEMEILKSFEKF---AYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPI
METE_COXB2      VITIESSRSEMEILKSFEKF---AYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPI
METE_NITOC      VITIETSRSDGELLAAFAAF---EYPNEIGPGVYDIHSPVVPTEAQIVGLIKKAAEYIPA
METE_BIFLO      VISFEASRGDLVVLDAIHDA---HFETEAGPGVYDIHSPRIPSEKEIEDRIYEILDKMDV
METE_BIFLD      VISFEASRGDLVVLDAIHDA---HFETEAGPGVYDIHSPRIPSEKEIEDRIYEILDKMDV
METE_BIFAA      VISFEASRGDLVVLDAIHDA---NFETEAGPGVYDIHSPRIPSEQEIEDRIYEILKKMDV
METE_CAMJE      VISFEASRSNLSLLDTLKAI---RFKTEVGPGVYDIHSPRVPSVEELSLTIEKILNKLPK
METE_CAMJR      VISFEASRSNLSLLDTLKAI---RFKTEVGPGVYDIHSPRVPSVEELSLTIEKILNKLPK
METE_CAMJJ      VISFEASRSNLSLLDTLKAI---RFKTEVGPGVYDIHSPRVPSVEELSLTIEKILNKLPK
METE_CAMJ8      VISFEASRSNLSLLDTLKAI---RFKTEVGPGVYDIHSPRVPSVEELSLTIEKILNKLPK
METE_CAMJD      VISFEASRSNLSLLDTLKAV---HFKTEVGPGVYDIHSPRVPSVEELSLTIEKILNKLPK
METE_STRGC      VISFEASRSNLEILDELKAK---NFQTEVGPGVYDIHSPRVPNEGEIDHTIEAILAKVPS
METE_STRSV      VISFEASRSNLEILDELKAK---NFQTEVGPGVYDIHSPRVPNEGEIDHTIEAILAKVPS
METE_STRPN      VISFEANRSNLEILDELKAK---NFQTEVGPGVYDIHSPRVPNEGEIDNTIEAILAKVPS
METE_STRP4      VISFEASRSNLEILDELKAK---NFQTEVGPGVYDIHSPRVPNEGEIDNTIEAILAKVPS
METE_STRR6      VISFEASRSNLEILDELKAK---NFQTEVGPGVYDIHSPRVPNEGEIDNTIEAILAKVPS
METE_STRP2      VISFEASRSNLEILDELKAK---NFQTEVGPGVYDIHSPRVPNEGEIDNTIEAILAKVPS
METE_STRPI      VISFEASRSNLEILDELKAK---NFQTEVGPGVYDIHSPRVPNEGEIDNTIEAILAKVPS
METE_STRTD      VISFEASRSNLEILDELKAQ---NFQTEVGPGVYDIHSPRVPQDGEIDHTIEAILAKVPS
METE_STRSY      VISFEASRSNLVILDELKAK---NFQTQVGPGVYDIHSPRVPAVDEIAHTIQAILAKVPK
METE_LACLM      VISFEASRSQLSIIDALKAH---HFQTLVGPGVYDIHSPRIPSSQEIKIQLEKILNKLPI
METE_LACLS      VISFEASRSQLSIIDALKAH---HFQTLVGPGVYDIHSPRIPSSQEIKIQLEKILNKLPI
METE_LACLA      VISFEASRSELSIIDALKAH---HFKTLVGPGVYDIHSPRIPSVKEIQNQLEKILDKLPI
METE_DESRM      VITIETSRSGNKLLTVFATR---GYKNEIGPGIYDIHSPRVPSVEELEEKIRNLMLVLPP
METE_CORGL      VTTIEAARSDMQVLAALKSS---GFELGVGPGVWDIHSPRVPSAQEVDGLLEAALQSVDP
METE_CORGB      VTTIEAARSDMQVLAALKSS---GFELGVGPGVWDIHSPRVPSAQEVDGLLEAALQSVDP
METE_COREF      VTTIEAARSDMQVLAALKSS---GFHLGVGPGVWDIHSPRVPELAEVSQLLSSALESVDP
METE_MYCA1      VTSLEAARSHMEVLDDLNAV---GFSNSVGPGVYDIHSPRVPSTAEIAESLRAALRAVPA
METE_MYCPA      VTSLEAARSHMEVLDDLNAV---GFSNSVGPGVYDIHSPRVPSTAEIAESLRAALRAVPA
METE_MYCLE      VTSIEAARSHMEVLDDLNAV---GFANSIGPGVYDIHSPRVPSTDEIAKSLRAALKAIPM
METE_MYCBO      VTSIEAARSHMEVLDDLNAI---GFANGVGPGVYDIHSPRVPSAEEMADSLRAALRAVPA
METE_MYCBP      VTSIEAARSHMEVLDDLNAI---GFANGVGPGVYDIHSPRVPSAEEMADSLRAALRAVPA
METE_MYCTU      VTSIEAARSHMEVLDDLNAI---GFANGVGPGVYDIHSPRVPSAEEMADSLRAALRAVPA
METE_MYCTA      VTSIEAARSHMEVLDDLNAI---GFANGVGPGVYDIHSPRVPSAEEMADSLRAALRAVPA
METE_RHOJR      VTSIEAARSHMEVLDDLSAV---GFDLGVGPGVYDIHSPRVPGVEEIAASLREALKAVPV
METE_STRAW      VISLEAARSHMQVARELAEH---AYPREAGPGVYDIHSPRVPGVDETAALLRKGLEAIPA
METE_STRCO      VISLEAARSHMQVAHELATH---GYPREAGPGVYDIHSPRVPSAEEAAALLRTGLKAIPA
METE_STRGG      VISLEAARSHMQVARELAAH---GYPREAGPGVYDIHSPRIPGAEEAAALLRKGLEAIPA
METE_HERA2      VISIEDARSAGSLLAGLEGR----YTQQIGPGVYDIHSPNIPTVEQLVARMRQLLNYLPA
METE_SYNJB      VLSIENSRSNNKTLLQIAQA---GYRHQVGNGVYDVHSPAVPSVEQILQQLRTGLAHLPV
METE_THEVB      VLSIENSRSNNETLFQITDA---GYRHQVGVGVYDVHSPAVPSVEQLVQQLRTSVANLAP
METE_TRIEI      VISIEDSRSNNETLMQLTDA---DYPAQVGPGVYDVHSPSIPTTEYLRESLYKCIQYLPV
METE_BACVZ      VITIEHSRSHGGFLEYLKEH---PYVKGLGLGVYDIHSPRVPATEEIYQIIDDALEVCPT
METE_BACSU      VITIEHSRSHGGFLDYLKNH---PYLKGLGLGVYDIHSPRVPSTEEMYNIIVDALAVCPT
METE_BACLD      VITIEHSRSHGGFLDYLEQH---PYLKGLGLGVYDIHSPRVPSSDEMLTIIEDALKVCPA
METE_BACP2      VITIEHSRSHGGFLDYLEKH---PYLKGLGLGVYDIHSPRVPSVEEMSQIIDDALNVCPT
METE_BACAN      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLQVCDP
METE_BACC0      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLQVCDP
METE_BACHK      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLQVCDP
METE_BACAH      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYEIVEQSLQVCDP
METE_BACCZ      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLEVCDP
METE_BACC7      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLKVCDP
METE_BACC1      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLKVCDP
METE_BACC2      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLEVCDP
METE_BACCR      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYKIVEQSLEVCDP
METE_BACC4      VISIETSRSHGEFIDTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMYTIVEQSLEVCDP
METE_BACMK      VISIETSRSHGEFINTLKHT---TYEKGIGLGVYDIHSPRVPSKDEMFTIVEQSLQVCDP
METE_BACCN      VISIETSRSHGEFIHTLEQT---TYEKGIGLGVYDIHSPRVPSKEEMYTIVEQSLKVCNP
METE_HALH5      VISIETSRSHGEMISAFEKT---TYEKGIGLGVYDIHSPRVPSEEEMLNVIRRALTVLPA
METE_LISMO      VISIETSRSHGEIISTFEEV---TYDKEIGLGVYDIHSPRVPTVTEIQDNIRRALRAIDA
METE_LISMF      VISIETSRSHGEIISTFEEV---TYDKEIGLGVYDIHSPRVPTVTEIQDNIRRALRAIDA
METE_LISIN      VISIETSRSHGEIISTFEEV---TYDKEIGLGVYDIHSPRVPTVSEIQDNIRRALRAIDA
METE_LISW6      VISIETSRSHGEIISTFEEV---TYDKEIGLGVYDIHSPRVPTVTEIQDNIRRALRAIDA
METE_LACPL      VISIETSRSHGEIISAFEQT---GYDQEIGLGVYDIHSPRVPSVAEIEANIQRALRVIDA
METE_STAAC      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAA8      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAE      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAT      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAA3      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAR      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAW      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAS      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAA1      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAN      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAM      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAA2      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAA9      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAAB      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTKEEITTAINRSLQQIDR
METE_STAES      VISIETSRSHGDLIQDFEDI---NYDLGIGLGVYDIHSPRIPTEEEITTAINRSLQQIDR
METE_STAEQ      VISIETSRSHGDLIQDFEDI---NYDLGIGLGVYDIHSPRIPTEEEITTAINRSLQQIDR
METE_STAHJ      VISIETSRSHGDLIKDFEDI---NYDLGIGLGVYDIHSPRIPTEDEIATAIDRSLQQIDR
METE_STRA3      VISIETSRSHGDIIESFETA---VYPLGIGLGVYDIHSPRIPTKEEIIVNIQRSLKCLSK
METE_STRA5      VISIETSRSHGDIIESFETA---VYPLGIGLGVYDIHSPRIPTKEEIIVNIQRSLKCLSK
METE_STRA1      VISIETSRSHGDIIESFETA---VYPLGIGLGVYDIHSPRIPTKEEIIVNIQRSLKCLSK
METE_STRMU      VISIETSRSHGDIIESFETA---VYPLGIGLGVYDIHSPRVPTKEEVVANIERPLRQLSP
METE_THEMA      VISIEASRSKGEIISAFENFKG--WIKQIGVGVWDIHSPAVPSINEMREIVERVLRVLPK
METE_THESQ      VISIEASRSKGEIISAFENFKG--WIKQIGVGVWDIHSPAVPSINEMREIVERVLRVLPK
METE_THEP1      VISIEASRSKGEIISAFENFKG--WIKQIGVGVWDIHSPAVPSVDEMKSIIERVLRILPK
METE_AQUAE      VISIEASRSKGEIIEVFEKFKG--WDRQIGIGVYDIHSPAIPTKEEMKAIMLRAMKVLPK
METE_THEYD      VISIEASRSKGEILSAFENFR---YDHGIGLGVYDIHSPRVPSVEEMIEIIERSVSLIDK
                . :.*  *.       :            * * :*:**   *                  

METE_RHOPA      GQLWVNPDCGLKTRGWDEVQGALVNMVEAARQIRQVSAG---------------------
METE_RHOPT      GQLWVNPDCGLKTRGWDEVQGALVNMVEAARQIRQVSAG---------------------
METE_NITWN      RQIWINPDCGLKTRKWEEVRPALVNMVEAAKLMR--------------------------
METE_BRADU      SQLWVNPDCGLKTRKWEEVRPALANMVAAARELRAASDPQIR------------------
METE_RHILO      GQLWVNPDCGLKTRRWEEVRPALVNMVAAARAIRQKAQTA--------------------
METE_CAUVC      EQLWVNPDCGLKTRKWPETQAAIVNMVEAARRARAS------------------------
METE_CHESB      RQIWVNPDCGLKTRKWEEVRFALANMVEAARQMRAG------------------------
METE_ACICJ      DQLWVNPDCGLKTRNWREVIPALENLVGAARRLRAEAIPA--------------------
METE_XYLF2      EQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE------------------------
METE_XYLFT      EQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE------------------------
METE_XYLFM      EQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE------------------------
METE_XYLFA      EQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE------------------------
METE_CYTH3      RNIWVNPDCGLKTRRWPETEAALINMVAAAQKIRKEITTVV-------------------
METE_FLAJ1      DQLWVNPDCGLKTRHWNETKKALIEMVAAAQEMRKAVENPVTE-----------------
METE_PARL1      ERIWVNPDCGLKTRGWPETEAALVEMVEAARELRNAIGA---------------------
METE_SALRD      SQMWVNPDCGLKTRRWVEVQPSLENMVQAAENVRERATA---------------------
METE_DESVH      DRLWVNPDCGLKTREWPETRAALANMVEAARRVRARLDA---------------------
METE_DESVM      DRLWANPDCGLKTRDWPETRASLAHLVAAATRVREGG-----------------------
METE_SYNC1      ERLWVNPDCGLKTRAWPETLASLRNMVAAAQKLRFFARG---------------------
METE_ECODH      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOLI      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECO57      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECO5E      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_SHIDS      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_SHIB3      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_SHIBS      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOL5      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ESCF3      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOSE      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_SHISS      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOLC      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECO24      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_SHIFL      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_SHIF8      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECO8A      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOHS      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOLU      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOUT      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECO45      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOK1      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOL6      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECOSM      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_ECO7I      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG------------------------
METE_SALA4      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALNS      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALPA      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALPK      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALCH      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALPB      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALSV      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALEP      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALG2      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALHS      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALTY      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALDC      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALTI      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAK-----------------------
METE_SALAR      QRLWVNPDCGLKTRGWPETRAALANMVKAAHNLRQAE-----------------------
METE_ENT38      ERLWVNPDCGLKTRGWPETRAALANMVKAAQNLRQG------------------------
METE_CITK8      ERLWVNPDCGLKTRGWPETRAALANMVKAAQNLRQA------------------------
METE_KLEP3      ERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRQA------------------------
METE_KLEP7      ERLWVNPDCGLKTRGWPETRAALANMVQAARNLRQSA-----------------------
METE_CROS8      ERLWVNPDCGLKTRGWPETRAALANMVKAAQNLRQA------------------------
METE_PECAS      ERLWVNPDCGLKTRGWPETRQALANMVQAAQRLRETQ-----------------------
METE_ERWT9      ERLWVNPDCGLKTRGWTETRQALANMVKAAQNLRQAQKA---------------------
METE_YERPA      ERLWVNPDCGLKTRGWPETRQALANMVLAAQRLREEQV----------------------
METE_YERPN      ERLWVNPDCGLKTRGWPETRQALANMVLAAQRLREEQV----------------------
METE_YERPE      ERLWVNPDCGLKTRGWPETRQALANMVLAAQRLREEQV----------------------
METE_YERPP      ERLWVNPDCGLKTRGWPETRQALANMVLAAQRLREEQV----------------------
METE_YERPS      ERLWVNPDCGLKTRGWPETRQALANMVLAAQRLREEQI----------------------
METE_YERP3      ERLWVNPDCGLKTRGWPETRQALANMVLAAQRLREEQI----------------------
METE_YERE8      ERLWVNPDCGLKTRGWPETRQALANMVLAAQRLREEQV----------------------
METE_SERP5      ERLWVNPDCGLKTRGWPETRQSLANMVLAAQRLREQQA----------------------
METE_PHOLL      ERLWVNPDCGLKTRGWTETRQSLANMVQAAKRLRESVK----------------------
METE_PROMH      ERLWVNPDCGLKTRGWSETRAALANMVEAAKYLRQNV-----------------------
METE_SODGM      ERLWVNPDCGLKTRAWPETRQSLANMVTAARKLREEQP----------------------
METE_BAUCH      KRLWVNPDCGLKTRTWLETRKALSNMVNAAHKLRREEEYNRS------------------
METE_BLOFL      DRLWINPDCGLKTRSWNEIRESLNNMVIAAKTLRINNGLNN-------------------
METE_BLOPB      QRLWINPDCGLKTRSWPEIKHSLNNMVSAAKLLRKQFYSS--------------------
METE_BUCAI      KRIWVNPDCGLKTRNWNETILSLKNMVEATKILREKMKDSECD-----------------
METE_BUCAP      ERIWVNPDCGLKTRNWNETILALKNMVCAAKEMRDKIKKIT-------------------
METE_BUCBP      KRLWVNPDCGLKTRTWDETYYSLENMVRAAKILRKKL-----------------------
METE_BUCCC      QQLWVNPDCGLKTRNWTETSLALQNMLQATLNIRKEYFKK--------------------
METE_VIBHA      QRLWVNPDCGLKTRNWSETEAALANLVSAAKKLRAELV----------------------
METE_VIBC1      QRLWVNPDCGLKTRNWDETEAALANLVSAAKKLRTELA----------------------
METE_VIBPA      QRLWVNPDCGLKTRNWAETEAALANLVSAAKKLRAELA----------------------
METE_VIBVU      ERLWVNPDCGLKTRNWPETEAALANLVSAAKRLRKEFAKETTAVNSEAVADVETEA----
METE_VIBVY      ERLWVNPDCGLKTRNWPETEAALANLVSAAKRLRKEFAKETTAVNSDALAKVETEA----
METE_VIBCH      QRLWVNPDCGLKTRNWPEVEAALTNMVNAAKALRAEWQA---------------------
METE_ALIF1      ERLWVNPDCGLKTRNWKETEAALENMVKAAKALRKKWQSNAA------------------
METE_ALIFM      ERLWVNPDCGLKTRNWKETEAALENMVKAAKALRKKWQSNAA------------------
METE_PHOPR      ERLWINPDCGLKTRNWEETEAALRSMVEATKKLREQWQEKAV------------------
METE_AERS4      DRLWVNPDCGLKTRGWEETEAALKVMVNATKALRTELA----------------------
METE_SHEON      RQLWVNPDCGLKTRTWDEVEPALKNMVDATRELRRRLG----------------------
METE_BORBR      ERLWVNPDCGLKTRAWPETEAALIGMVQAARTLRAA------------------------
METE_BORPA      ERLWVNPDCGLKTRAWPETEAALIGMVQAARTLRAA------------------------
METE_BORPE      ERLWVNPDCGLKTRAWPETEAALIGMVQAARTLRAA------------------------
METE_BORPD      ERLWVNPDCGLKTRAWPETEAALVGMVEAARALRAG------------------------
METE_BORA1      ERLWVNPDCGLKTRAWPETEAALISMVQAARTLRQATS----------------------
METE_ALCBS      ERLWVNPDCGLKTRKWDETRAALANMVNAAKQLRQAS-----------------------
METE_ALKEH      ERLWVNPDCGLKTRAWAEVEPALQNMVAAAEILRERYGQAQTRVATQGKR----------
METE_CHRSD      ERLWVNPDCGLKTRGWAEVEPALANMVEAARELRRRYG----------------------
METE_PSEAE      ERLWVNPDCGLKTRAWPETEAALVNMVAAARELRGDLARG--------------------
METE_PSEAB      ERLWVNPDCGLKTRAWPETEAALVNMVAAARELRGDLARG--------------------
METE_PSEA8      ERLWVNPDCGLKTRAWPETEAALVNMVAAARELRGDLARG--------------------
METE_PSEE4      ERLWVNPDCGLKTRAWPETEAALVNMVAAARELRATA-----------------------
METE_PSEPW      ERLWVNPDCGLKTRAWPETEAALVNMVAAARELRATA-----------------------
METE_PSEF5      ERLWVNPDCGLKTRGWPETEAALVHMVTAARQLRKELA----------------------
METE_PSEMY      ERLWVNPDCGLKTRAWPETEAALVNMVAAARQLRAELA----------------------
METE_PSEA7      ARLWVNPDCGLKTRAWAETEAALANMVAAARQLRQANLA---------------------
METE_STUS1      ERLWVNPDCGLKTRGWPETEAALVNMVAAARQLRAARSAKVA------------------
METE_PSESM      ERLWVNPDCGLKTRGWPETEAALINMVAAARQLRL-------------------------
METE_ACIF2      ERLWINPDCGLKTRKWAEVTPALENMVEAARQVRARHG----------------------
METE_ACIF5      ERLWINPDCGLKTRKWAEVTPALENMVEAARQVRARHG----------------------
METE_ACTPJ      ERLWVNPDCGLKTRGWKETIEQLQVMVEVTKKLRAELAE---------------------
METE_ACTP7      ERLWVNPDCGLKTRGWKETIEQLQVMVEVTKKLRAELAE---------------------
METE_ACTP2      ERLWVNPDCGLKTRGWKETIEQLQVMVEVTKKLRAELAE---------------------
METE_HAEIE      ERLWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRAELA----------------------
METE_HAEIG      ERLWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRAELA----------------------
METE_HAEIN      ERLWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRAELA----------------------
METE_HAES1      ERLWVNPDCGLKTRGWSETIAQLEVMMSVTKKLRAELA----------------------
METE_HISS2      ERLWVNPDCGLKTRGWSETIAQLEVMMSVTKKLRAELA----------------------
METE_PASMU      ERLWVNPDCGLKTRGWPETIAQLEVMMEVTKKLRAELN----------------------
METE_NEIMA      ERLWVNPDCGLKTRGWKETLEQLQVMMNVTHKLRAELAK---------------------
METE_NEIMF      ERLWVNPDCGLKTRGWKETLEQLQVMMNVTHKLRAELAK---------------------
METE_NEIMB      ERLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELAK---------------------
METE_NEIM0      ERLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELAK---------------------
METE_NEIG1      ERLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELAK---------------------
METE_CHRVO      ERLWVNPDCGLKTRGWPEVEAALAAMVAVGRELREKLAQAA-------------------
METE_BURMA      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEAAPA-----------------
METE_BURM9      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEAAPA-----------------
METE_BURM7      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEAAPA-----------------
METE_BURMS      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEAAPA-----------------
METE_BURP1      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEAAPA-----------------
METE_BURPS      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEEAPA-----------------
METE_BURP0      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEAVPA-----------------
METE_BURP6      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQKVEEAVPA-----------------
METE_BURTA      QRLWVNPDCGLKTREWRQVDAALAAMVDAAKRVRQTVEQAVPA-----------------
METE_RALPJ      QRLWVNPDCGLKTRGWPEVEAALQGIVEATHRLRAKHANAKRAGS---KAAHVEGEMA--
METE_RALSO      QRLWVNPDCGLKTRGWPEVEAALRGMVEATRRLRARHAGAVHAGTPATRAEHAESALA--
METE_PARPJ      ERLWVNPDCGLKTRGWPETEAALTNMVRAAKALRAKLAAK---------QPDEVTA----
METE_PARXL      ERLWVNPDCGLKTRGWPETEAALANMVRAAKALRAKLAAR---------QADELTA----
METE_CUPNE      QRLWVNPDCGLKTRGWEETEAALANMVSAARALRARLSARGATTWKRLSKPAAATAAAVP
METE_CUPNH      QRLWVNPDCGLKTRGWEETEAALANMVSAARALRARLSARGATTWKRLSKPAAATAAAVP
METE_METCA      ERLWVNPDCGLKTRQWPEAEQALANMVEAARAMRRAESLAGSAA----------------
METE_NITEU      TLLWVNPDCGLKTRNWPETQTALQKMVDCAKTLRSALQA---------------------
METE_BURCM      ERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQVQ----------------------
METE_BURA4      ERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQVQ----------------------
METE_BURO1      ERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQVQ----------------------
METE_BURCH      ERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQVQ----------------------
METE_BURO0      ERLWVNPDCGLKTRQWAEVIPALTNMVAAAKMLRNQVQ----------------------
METE_BURCJ      ERLWVNPDCGLKTRQWGEVIPALTNMVAAAKTLRNQVR----------------------
METE_BURL3      ERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQVQ----------------------
METE_BURVG      QRLWVNPDCGLKTRRWAEVLPALTNMVAAAKTLRSELRNGL-------------------
METE_PARP8      ERLWVNPDCGLKTRAWEEVIPALKNMVAAARTLRQAV-----------------------
METE_THIDA      ERLWINPDCGLKTRQWNEVIPALGNMVAAARTLRAGWQETGRAG----------------
METE_HAHCH      HRLWVNPDCGLKTRNWEEVRPALQNMVNAAKQLRADVVAA--------------------
METE_MARN8      ERLWINPDCGLKTRKWEEVTPALETMVAAARELRS-------------------------
METE_RUTMC      KRLWVNPDCGLKTRHWDEVNLALTNMVLASQQLRKN------------------------
METE_PSYIN      EQLWVNPDCGLKTRRWEEVKPALLNMVAAAKKLRAS------------------------
METE_SACD2      QRLWINPDCGLKTRKWEDVIPALENMVNAAKQLRAEVA----------------------
METE_COXBU      ERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEKTPTIDLELQPAST------
METE_COXBN      ERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEKTPTIDLELQPAST------
METE_COXB1      ERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEKTPTIDLELQPAST------
METE_COXBR      ERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEKTPTIDLELQPAST------
METE_COXB2      ERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEKTPTIDLELQPAST------
METE_NITOC      ERLWVNPDCGLKTRAWPEVETALRTMVAAAHGLRSA------------------------
METE_BIFLO      KKVWINPDCGLKTRGNAETWPSLENLVAAAKAVRAKLDK---------------------
METE_BIFLD      KKVWINPDCGLKTRGNAETWPSLENLVAAAKAVRAKLDK---------------------
METE_BIFAA      EKVWINPDCGLKTRGNAETWPSLENLVAAAKAVRAKLAK---------------------
METE_CAMJE      EQIWINPDCGLKTRAYEEVITSLKNLVTATQKIREQL-----------------------
METE_CAMJR      EQIWINPDCGLKTRAYEEVIASLKNLVTATQKIREQL-----------------------
METE_CAMJJ      EQIWINPDCGLKTRAYEEVIASLKNLVTATQKIREQL-----------------------
METE_CAMJ8      EQIWINPDCGLKTRAYEEVIASLKNLVTATQKIREQL-----------------------
METE_CAMJD      EQIWINPDCGLKTRAYEEVIASLKNLVTATQKIRKQL-----------------------
METE_STRGC      KKVWINPDCGLKTRGIPETKASLVRLVEAAKAARQHLK----------------------
METE_STRSV      KKVWINPDCGLKTRGIPETKASLVRLVEAAKAARQHLK----------------------
METE_STRPN      KKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL-----------------------
METE_STRP4      KKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL-----------------------
METE_STRR6      KKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL-----------------------
METE_STRP2      KKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL-----------------------
METE_STRPI      KKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL-----------------------
METE_STRTD      SKVWINPDCGLKTRGIKETKESLTKLLEAAKAARKNL-----------------------
METE_STRSY      EKVWINPDCGLKTRGESETKASLIHLTQAAKAARKEL-----------------------
METE_LACLM      EQVWVNPDCGLKTRGNKETIPSLTHLVEATKEVRKGKITYDK------------------
METE_LACLS      EQVWVNPDCGLKTRGNKETIPSLTHLVEATKEVRKEKITYDK------------------
METE_LACLA      EQVWVNPDCGLKTRGNAETIPSLRHLVEATRVLRKEKVVYDK------------------
METE_DESRM      SKLWINPDCGLKTRKWDEIRWSLSNMVKAAQHIRLGLQRVMFV-----------------
METE_CORGL      RQLWVNPDCGLKTRGWPEVEASLKVLVESAKQAREKIGATI-------------------
METE_CORGB      RQLWVNPDCGLKTRGWPEVEASLKVLVESAKQAREKIGATI-------------------
METE_COREF      RRLWVNPDCGLKTRGWEETTASLKVLVAAAEQARTDLLQRASTSA---------------
METE_MYCA1      ERLWVNPDCGLKTRNPDEVSASLKNMVAAAHEVRAGV-----------------------
METE_MYCPA      ERLWVNPDCGLKTRNPDEVSASLKNMVAAAHEVRAGV-----------------------
METE_MYCLE      QRLWVNPDCGLKTRSVDEVSASLQNMVAAARQVRAGA-----------------------
METE_MYCBO      ERLWVNPDCGLKTRNVDEVTASLHNMVAAAREVRAG------------------------
METE_MYCBP      ERLWVNPDCGLKTRNVDEVTASLHNMVAAAREVRAG------------------------
METE_MYCTU      ERLWVNPDCGLKTRNVDEVTASLHNMVAAAREVRAG------------------------
METE_MYCTA      ERLWVNPDCGLKTRNVDEVTASLHNMVAAAREVRAG------------------------
METE_RHOJR      ERLWVNPDCGLKTRGPAEVEASLRNLVDAAKLVRAEL-----------------------
METE_STRAW      ERLWVNPDCGLKTRGWPETRASLENLVAAARTVRAEHAGS--------------------
METE_STRCO      ERLWVNPDCGLKTRGWPETRASLENLVATARTLRGELSAS--------------------
METE_STRGG      ERLWVNPDCGLKTRGWPETRASLENLVAAARQIRAELPTGAA------------------
METE_HERA2      EQLWINPDCGLKTRTYAEVAAALQAMVTATKQVRNQIS----------------------
METE_SYNJB      EQTWVNPDCGLKTRRWEEVIPALKNMVAAAHQLGEELLETQPEGLRE-------------
METE_THEVB      EQIWVNPDCGLKTRHWEEVIPSLKNMVEATKTIRQEVMQSKNNA----------------
METE_TRIEI      TQIWVNPDCGLKTRRWEEAIPATRNMVQAAISLRQE------------------------
METE_BACVZ      DRFWVNPDCGLKTRQQEETVAALKNMVDAAKQARKKQAQLV-------------------
METE_BACSU      DRFWVNPDCGLKTRQQEETVAALKNMVEAAKQARAQQTQLV-------------------
METE_BACLD      DRFWVNPDCGLKTRQPEETIAALKNMVEAAKQARGKLAQTV-------------------
METE_BACP2      DRFWVNPDCGLKTRQEPETIAALKNMVTAAEVARKKLAQHA-------------------
METE_BACAN      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACC0      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACHK      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACAH      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACCZ      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACC7      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACC1      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACC2      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACCR      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACC4      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACMK      KYFWINPDCGLKTRRTEEVIPALEHMVQAAKDARSLLKTNA-------------------
METE_BACCN      KYFWINPDCGLKTRRTEEVLPALEHMVEAAKEARTLLKTNA-------------------
METE_HALH5      SLFWVNPDCGLKTRAEKETVAALKNMVAAARAAREELKTKA-------------------
METE_LISMO      KQFWINPDCGLKTRKEPETIAALQDMIKATKEVRAEYQVLEK------------------
METE_LISMF      KQFWINPDCGLKTRKEPETIAALQDMIKATKEVRAEYQVLEK------------------
METE_LISIN      KQFWINPDCGLKTRKEPETIAALQDMIKATKEVRAEYQVLEK------------------
METE_LISW6      KQFWINPDCGLKTRQEPETIAALQDMIKATKEVRAEYQVLEK------------------
METE_LACPL      RQFWINPDCGLKTRQESETLAALKNMIAARNAIQAQLTTSIH------------------
METE_STAAC      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAA8      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAE      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAT      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAA3      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAR      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAW      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAS      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAA1      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAN      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAM      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAA2      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAA9      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAAB      SLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE------------------------
METE_STAES      SLFWVNPDCGLKTRKENEVKDALTVLVNAVKKKRQESESTTA------------------
METE_STAEQ      SLFWVNPDCGLKTRKENEVKDALTVLVNAVKKKRQESESTTA------------------
METE_STAHJ      SLFWVNPDCGLKTRKEDEVKDALTVLVNTVRKKRASNNQNKPA-----------------
METE_STRA3      EQFWVNPDCGLKTRREAETIAALEVLVSATKEVRQQLDN---------------------
METE_STRA5      EQFWVNPDCGLKTRREAETIAALEVLVSATKEVRQQLDN---------------------
METE_STRA1      EQFWVNPDCGLKTRREAETIAALEVLVSATKEVRQQLDN---------------------
METE_STRMU      TQFWVNPDCGLKTRQEPETIAALKVLVAATKEVRQKLGN---------------------
METE_THEMA      ELIWINPDCGLKTRNWDEVIPSLRNMVALAKEMREKFES---------------------
METE_THESQ      ELIWINPDCGLKTRNWDEVIPSLRNMVALAKEMREKFES---------------------
METE_THEP1      ELIWVNPDCGLKTRNWEEVVPSLKNMVDLAKKLRKEYNNT--------------------
METE_AQUAE      ELLWVNPDCGLKTRRWEEVIPALRNMVDMAKELREEVGVKV-------------------
METE_THEYD      SLFWINPDCGLKTRGWQETVASLKNMVLAAKAMRKREV----------------------
                   * *********   :       :                                  

METE_RHOPA      --------------
METE_RHOPT      --------------
METE_NITWN      --------------
METE_BRADU      --------------
METE_RHILO      --------------
METE_CAUVC      --------------
METE_CHESB      --------------
METE_ACICJ      --------------
METE_XYLF2      --------------
METE_XYLFT      --------------
METE_XYLFM      --------------
METE_XYLFA      --------------
METE_CYTH3      --------------
METE_FLAJ1      --------------
METE_PARL1      --------------
METE_SALRD      --------------
METE_DESVH      --------------
METE_DESVM      --------------
METE_SYNC1      --------------
METE_ECODH      --------------
METE_ECOLI      --------------
METE_ECO57      --------------
METE_ECO5E      --------------
METE_SHIDS      --------------
METE_SHIB3      --------------
METE_SHIBS      --------------
METE_ECOL5      --------------
METE_ESCF3      --------------
METE_ECOSE      --------------
METE_SHISS      --------------
METE_ECOLC      --------------
METE_ECO24      --------------
METE_SHIFL      --------------
METE_SHIF8      --------------
METE_ECO8A      --------------
METE_ECOHS      --------------
METE_ECOLU      --------------
METE_ECOUT      --------------
METE_ECO45      --------------
METE_ECOK1      --------------
METE_ECOL6      --------------
METE_ECOSM      --------------
METE_ECO7I      --------------
METE_SALA4      --------------
METE_SALNS      --------------
METE_SALPA      --------------
METE_SALPK      --------------
METE_SALCH      --------------
METE_SALPB      --------------
METE_SALSV      --------------
METE_SALEP      --------------
METE_SALG2      --------------
METE_SALHS      --------------
METE_SALTY      --------------
METE_SALDC      --------------
METE_SALTI      --------------
METE_SALAR      --------------
METE_ENT38      --------------
METE_CITK8      --------------
METE_KLEP3      --------------
METE_KLEP7      --------------
METE_CROS8      --------------
METE_PECAS      --------------
METE_ERWT9      --------------
METE_YERPA      --------------
METE_YERPN      --------------
METE_YERPE      --------------
METE_YERPP      --------------
METE_YERPS      --------------
METE_YERP3      --------------
METE_YERE8      --------------
METE_SERP5      --------------
METE_PHOLL      --------------
METE_PROMH      --------------
METE_SODGM      --------------
METE_BAUCH      --------------
METE_BLOFL      --------------
METE_BLOPB      --------------
METE_BUCAI      --------------
METE_BUCAP      --------------
METE_BUCBP      --------------
METE_BUCCC      --------------
METE_VIBHA      --------------
METE_VIBC1      --------------
METE_VIBPA      --------------
METE_VIBVU      --------------
METE_VIBVY      --------------
METE_VIBCH      --------------
METE_ALIF1      --------------
METE_ALIFM      --------------
METE_PHOPR      --------------
METE_AERS4      --------------
METE_SHEON      --------------
METE_BORBR      --------------
METE_BORPA      --------------
METE_BORPE      --------------
METE_BORPD      --------------
METE_BORA1      --------------
METE_ALCBS      --------------
METE_ALKEH      --------------
METE_CHRSD      --------------
METE_PSEAE      --------------
METE_PSEAB      --------------
METE_PSEA8      --------------
METE_PSEE4      --------------
METE_PSEPW      --------------
METE_PSEF5      --------------
METE_PSEMY      --------------
METE_PSEA7      --------------
METE_STUS1      --------------
METE_PSESM      --------------
METE_ACIF2      --------------
METE_ACIF5      --------------
METE_ACTPJ      --------------
METE_ACTP7      --------------
METE_ACTP2      --------------
METE_HAEIE      --------------
METE_HAEIG      --------------
METE_HAEIN      --------------
METE_HAES1      --------------
METE_HISS2      --------------
METE_PASMU      --------------
METE_NEIMA      --------------
METE_NEIMF      --------------
METE_NEIMB      --------------
METE_NEIM0      --------------
METE_NEIG1      --------------
METE_CHRVO      --------------
METE_BURMA      --------------
METE_BURM9      --------------
METE_BURM7      --------------
METE_BURMS      --------------
METE_BURP1      --------------
METE_BURPS      --------------
METE_BURP0      --------------
METE_BURP6      --------------
METE_BURTA      --------------
METE_RALPJ      --------------
METE_RALSO      --------------
METE_PARPJ      --------------
METE_PARXL      --------------
METE_CUPNE      HAGNACTACATHAN
METE_CUPNH      HAGNACTACATHAN
METE_METCA      --------------
METE_NITEU      --------------
METE_BURCM      --------------
METE_BURA4      --------------
METE_BURO1      --------------
METE_BURCH      --------------
METE_BURO0      --------------
METE_BURCJ      --------------
METE_BURL3      --------------
METE_BURVG      --------------
METE_PARP8      --------------
METE_THIDA      --------------
METE_HAHCH      --------------
METE_MARN8      --------------
METE_RUTMC      --------------
METE_PSYIN      --------------
METE_SACD2      --------------
METE_COXBU      --------------
METE_COXBN      --------------
METE_COXB1      --------------
METE_COXBR      --------------
METE_COXB2      --------------
METE_NITOC      --------------
METE_BIFLO      --------------
METE_BIFLD      --------------
METE_BIFAA      --------------
METE_CAMJE      --------------
METE_CAMJR      --------------
METE_CAMJJ      --------------
METE_CAMJ8      --------------
METE_CAMJD      --------------
METE_STRGC      --------------
METE_STRSV      --------------
METE_STRPN      --------------
METE_STRP4      --------------
METE_STRR6      --------------
METE_STRP2      --------------
METE_STRPI      --------------
METE_STRTD      --------------
METE_STRSY      --------------
METE_LACLM      --------------
METE_LACLS      --------------
METE_LACLA      --------------
METE_DESRM      --------------
METE_CORGL      --------------
METE_CORGB      --------------
METE_COREF      --------------
METE_MYCA1      --------------
METE_MYCPA      --------------
METE_MYCLE      --------------
METE_MYCBO      --------------
METE_MYCBP      --------------
METE_MYCTU      --------------
METE_MYCTA      --------------
METE_RHOJR      --------------
METE_STRAW      --------------
METE_STRCO      --------------
METE_STRGG      --------------
METE_HERA2      --------------
METE_SYNJB      --------------
METE_THEVB      --------------
METE_TRIEI      --------------
METE_BACVZ      --------------
METE_BACSU      --------------
METE_BACLD      --------------
METE_BACP2      --------------
METE_BACAN      --------------
METE_BACC0      --------------
METE_BACHK      --------------
METE_BACAH      --------------
METE_BACCZ      --------------
METE_BACC7      --------------
METE_BACC1      --------------
METE_BACC2      --------------
METE_BACCR      --------------
METE_BACC4      --------------
METE_BACMK      --------------
METE_BACCN      --------------
METE_HALH5      --------------
METE_LISMO      --------------
METE_LISMF      --------------
METE_LISIN      --------------
METE_LISW6      --------------
METE_LACPL      --------------
METE_STAAC      --------------
METE_STAA8      --------------
METE_STAAE      --------------
METE_STAAT      --------------
METE_STAA3      --------------
METE_STAAR      --------------
METE_STAAW      --------------
METE_STAAS      --------------
METE_STAA1      --------------
METE_STAAN      --------------
METE_STAAM      --------------
METE_STAA2      --------------
METE_STAA9      --------------
METE_STAAB      --------------
METE_STAES      --------------
METE_STAEQ      --------------
METE_STAHJ      --------------
METE_STRA3      --------------
METE_STRA5      --------------
METE_STRA1      --------------
METE_STRMU      --------------
METE_THEMA      --------------
METE_THESQ      --------------
METE_THEP1      --------------
METE_AQUAE      --------------
METE_THEYD      --------------