CLUSTAL format seed alignment for MF_00173

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGR_BACAN       ---------------MNK-GQRHIKIREIIANKEIETQDELVDILRNEG-FNVTQATVSR
ARGR2_BACCR      ---------------MNK-GQRHIKIREIIANKEIETQDELVDILRNEG-FNVTQATVSR
ARGR_GEOSE       ---------------MNK-GQRHIKIREIIMSNDIETQDELVDRLREAG-FNVTQATVSR
ARGR_ALKHC       ---------------MNK-GQRHIKIREIIANNDVETQDELVEQLKAAG-YNVTQATVSR
ARGR_BACLD       ---------------MNK-GQRHIKIREIITANEIETQDELVDILKKDG-YNVTQATVSR
ARGR_BACSU       ---------------MNK-GQRHIKIREIITSNEIETQDELVDMLKQDG-YKVTQATVSR
ARGR_OCEIH       ---------------MSK-LQRHIKIRELITENIIETQDELVDSLKALD-FNVTQATVSR
ARGR_LISIN       ---------------MNK-GHRHIIIRELITSNEIDTQEDLVELLLERD-VKVTQATVSR
ARGR_LISMO       ---------------MNK-GHRHIIIRELITSNEIDTQEDLVELLLERD-VKVTQATVSR
ARGR_STAAM       ---------------MPKKSVRHIKIREIISNEQIETQDELVKRLNDYD-LNVTQATVSR
ARGR_STAES       ---------------MPKKSVRHIKIREIISNEQIETQDELVKRLNEYD-LNVTQATVSR
ARGR_CLOAB       ---------------MKV--SRHTKILEIINLKDIETQEELAEELRRSG-MEVTQATVSR
ARGR_CLOTE       ---------------MKV--TRHEKILELIERKDIETQEELAEELRKSG-IEITQATVSR
ARGR2_CLOPE      ---------------MKS--KRHSKIIEIIKSTAIETQEELAEELKKAG-FDVTQATVSR
ARGR_CALS4       --------------MMKL--ARHAKILEIISEKEIETQEELAAELQKRG-IDVTQATVSR
ARGR_ENTFA       ---------------MKK-AERQRLIKQLIMQQEIETQDELITRLEEIG-VRATQATVSR
ARGR1_LACPL      ---------------MKK-SERQAVIEQLISEYPIATQEELMAKLKAEG-IAATQATISR
ARGR_STRPN       ---------------MRK-RDRHQLIKKMITEEKLSTQKEIQDRLEAHN-VCVTQTTLSR
ARGR1_CLOPE      ------------MSNLEK-SLRHEVILDIIESKCICKQEELIIELKECG-INVTQATLSR
ARGR_THEMA       -------------MKISK-KRRQELIRKIIHEKKISNQFQIVEELKKYG-IKAVQPTVAR
ARGR_DEIRA       ----------MLGKEIGK-DQRQKRIQDIILRESVSTQAELVKLLAKEG-VQVTQATVSR
ARGR_COREF       -MTMDD--GRASTSTPVTRTARQALIVQILNRQRVTSQVQLSELLLDEG-IDITQATLSR
ARGR_CORGL       -MSLGSTPSTPENLNPVTRTARQALILQILDKQKVTSQVQLSELLLDEG-IDITQATLSR
ARGR_MYCLE       ---MTHGASKTTPE--TTRAGRQARIVAILSSTSVRSQSELATLLADDG-IDVTQATLSR
ARGR_MYCTU       -MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEG-IEVTQATLSR
ARGR_STRAW       MSQAQENE-HAGPAVPQTRTARHRRIVDILNRQPVRSQSQLAKLLADDG-LSVTQATLSR
ARGR_STRCO       MSHAQEHEQPAGPALPQTRTARHRRIVDILNRQAVRSQSQLAKLLADDG-LTVTQATLSR
ARGR_STRCL       MTEAHATD-AGGPAVPQTRMARHRRIVDILNRQPVRSQSQLAKLLADNG-LSVTQATLSR
ARGR_ECOLI       ------------MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSR
ARGR_ECOL6       ------------MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSR
ARGR_SALTY       ------------MRSSAKQEELVRAFKALLKEEKFSSQGEIVLALQDQGFENINQSKVSR
ARGR_YERPE       ------------MRNPAKQEDLIKAFKALLKEEKFSSQGEIVLALQEEGFENINQSKVSR
ARGR_PHOLL       ------------MRTPSKQEDLVKAFKALLKEEKFSSQGEIVTALLEEGFENINQSKVSR
ARGR_VIBVU       ------------MRPSEKQDNLVRAFKALLKEERFGSQGEIVEALKQEGFENINQSKVSR
ARGR_VIBVY       ------------MRPSEKQDNLVRAFKALLKEERFGSQGEIVEALKQEGFENINQSKVSR
ARGR_VIBPA       ------------MRNSEKQDNLVRAFKALLKEESFGSQGEIVDALKQQGFESINQSKVSR
ARGR_VIBCH       ------------MRNVDKQDNLVRAFKALLKEERFGSQGDIVEALKNEGFDNINQSKVSR
ARGR_HAEIN       -----------------MTENLTRAFKELLNQERFGSQSEIVDALKKQGFTGINQSKISR
ARGR_PASMU       -------------MNYEKQDNLLNAFKELLAQERFGSQSEIVQALQELGFTQINQSKVSR
ARGR_SHEON       ------------MQTTKNQDDLVRIFKAILKEERFGSQSEIVTALQAEGFTNINQSKVSR
ARGR_CHLPN       ---------------MKKKVTIDEALKEILRLEGAATQEELCAKLLAQGFATT-QSSVSR
                                          :  ::      .* ::   *   .     *..::*

ARGR_BACAN       DIKELHLVKVPLHDG-RYKYSLPADQ---------RFNPLQKLKRNLVDSFVKLDTAGHM
ARGR2_BACCR      DIKELHLVKVPLHDG-RYKYSLPADQ---------RFNPLQKLKRNLVDSFVKLDTAGHM
ARGR_GEOSE       DIKEMQLVKVPMANG-RYKYSLPSDQ---------RFNPLQKLKRALVDVFIKLDGTGNL
ARGR_ALKHC       DIKELHLVKVPMMDG-RYKYSLPADQ---------RFNPLQKLKRGLVDSFVSIDRTDNL
ARGR_BACLD       DIKELHLVKVPTNNG-SYKYSLPADQ---------RFNPLSKLKRSLMDAFVKIDSASHL
ARGR_BACSU       DIKELHLVKVPTNNG-SYKYSLPADQ---------RFNPLSKLKRALMDAFVKIDSASHM
ARGR_OCEIH       DIKELQLVKVPTTTG-QYKYSLPADQ---------RFNPLQKLKRLIVDTFVKIEHASHF
ARGR_LISIN       DIKELHLVKVPTQTG-GYKYSLPADN---------SFNPHQKLKRALIDCFICIDTVQFM
ARGR_LISMO       DIKELHLVKVPTQTG-GYKYSLPADN---------SFNPHQKLKRALIDCFIGIDNVQFM
ARGR_STAAM       DIKELQLIKVPIPSG-QYVYSLPNDR---------KFHPLEKLGRYLMDSFVNIDGTDNL
ARGR_STAES       DIKELQLIKVPAPTG-QYVYSLPNDR---------RYHPLEKLGRYLMDSFVNIEGTGNL
ARGR_CLOAB       DIKELKLIKVLSSKG-RYKYATISPT---------ESFLSNKLVTIFAQTVLNVDRVNNM
ARGR_CLOTE       DIKELKLIKVLGEQG-KYKYAAIVKN---------ENDLSDKLANIFSHSVVSVENINNF
ARGR2_CLOPE      DIKNLKLVKKQDNKG-HYRYTIIEEE---------KNEMVDRLSNILANTVTSVENVDKM
ARGR_CALS4       DIKELRLIKVLTEDGKRYKYAPMTKV---------DTNISERLMTLLSESIVNVDYAGNI
ARGR_ENTFA       DIREMSIVKTHGADGRVKYAIFSQAQ---------GTSSEEKLRESVKDSVVRMERVQFI
ARGR1_LACPL      DIREMQIVKTPDEHGQTRYAIFKTTN---------KNE-QDRLFETLHDVVTSIDRVEFM
ARGR_STRPN       DLREIGLTKVKKNDMVYYVLVNETE--------------KIDLVEFLSHHLEGVARAEFT
ARGR1_CLOPE      DLHEMNIIRKSFENHEHRYIVTKEDK---------FI---KKFKNIFKSSVRSISMQEYF
ARGR_THEMA       DLKEIGAVKIMDESGNYVYKLLDETP---------VIDPWKELKRNFKSFVESIDRAGNL
ARGR_DEIRA       DINELRLVRVPIGKGRHRYALAQYGG---------DSDIEEQLARLFQSFVQDVDRGENI
ARGR_COREF       DLDELGARKVRPDRGRAFYAIGPVD----TTIGEDLRGPQEKLRRMLDELLVSTDHSGNI
ARGR_CORGL       DLDELGARKVRPDGGRAYYAVGPVD----SIAREDLRGPSEKLRRMLDELLVSTDHSGNI
ARGR_MYCLE       DLEELGAVKLRGADGGVGVYVVPED----GSPVRGVSGGTARLSRLLSELLVSADSSANL
ARGR_MYCTU       DLEELGAVKLRGADGGTGIYVVPED----GSPVRGVSGGTDRMARLLGELLVSTDDSGNL
ARGR_STRAW       DLDELNAVKIRNNDGDLIYAVPSEGGFRTPRVPLGESAKEERMRRLSAELLISAEASANL
ARGR_STRCO       DLDELNAVKIRNTDGDLIYAVPSEGGFRTPRAPLGESAKEERMRRLSAELLISAEASANL
ARGR_STRCL       DLDELGAVKIRNTMARLIYAVPARG-VPHSAGALGESAKEERMRRLAGELLISAEASANL
ARGR_ECOLI       MLTKFGAVRTRNAKMEMVYCLPAELG-------------VPTTSSPLKNLVLDIDYNDAV
ARGR_ECOL6       MLTKFGAVRTRNAKMEMVYCLPAELG-------------VPTTSSPLKNLVLDIDYNDAV
ARGR_SALTY       MLTKFGAVRTRNAKMEMVYCLPAELG-------------VPTTSSPLKNLVLDIDYNDAV
ARGR_YERPE       MLTKFGAVRTRNAKMEMVYCLPAELG-------------VPTTSSPLKNLVLDVDYNDSV
ARGR_PHOLL       MLTKFGAVRTRNAKMEMVYCLPAELG-------------VPTATSPLKNLVLDVDYNHPI
ARGR_VIBVU       MLTKFGAVRTRNAKMEMVYCLPTELG-------------VPTVSSSLRELVLDVDHNQAL
ARGR_VIBVY       MLTKFGAVRTRNAKMEMVYCLPTELG-------------VPTVSSSLRELVLDVDHNQAL
ARGR_VIBPA       MLTKFGAVRTRNAKMEMVYCLPAELG-------------VPTVSSSLRELVLDIDHNAAL
ARGR_VIBCH       MLTKFGAVRTRNAKMEMVYCLPAELG-------------VPTASSSLRELVLDVDYNNAL
ARGR_HAEIN       MLSKFGAVRTRNTKMEMVYCLPNELS-------------VPNTSSPLKNLVLDVDHNAML
ARGR_PASMU       MLTKFGAVRTRNTRMEMVYCLPNELS-------------VPNTKSPLKNLVLDIDHNHFV
ARGR_SHEON       MLSKFGAVRTRNAKQEMVYCLPAELG-------------VPTAGSPLKNLVLDVDHNQAM
ARGR_CHLPN       WLRKIQAVKVAGER-----GARYSLP-------------SSTEKTTTRHLVLSIRHNASL
                  : ::   :                                         .         

ARGR_BACAN       LVLKTLPGNAHSLGALIDHL-EWDEIIGTICGDDTCLIICRTPEDTGVVSDRFLNML---
ARGR2_BACCR      LVLKTLPGNAHSLGALIDHL-EWDEIIGTICGDDTCLIICRTPDDTGVVSDRFLNML---
ARGR_GEOSE       LVLRTLPGNAHAIGVLLDNL-DWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML---
ARGR_ALKHC       IVMKTLPGNAHAIGALIDNL-DWTEIMGTICGDDTILIICKDKQDGPVVTERFLNML---
ARGR_BACLD       IVLKTMPGNAQAIGALMDNL-DWEEIMGTICGDDTILIICRTHDDTKVVQKKILELL---
ARGR_BACSU       IVLKTMPGNAQAIGALMDNL-DWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL---
ARGR_OCEIH       IILHTLPGNAHAVGVLIDNL-DWEEIMGTICGDDTCLIICRTPEQAEMIKNRFIEML---
ARGR_LISIN       IILKVMPGNGNSVGALIDNL-DWPEKAGTLCGDDTCLIICRSEENAKTLTDRFIDML---
ARGR_LISMO       IILKVMPGNGNSVGALIDNL-DWPEKAGTICGDDTCLIICRSEENAKTLTDRFIDML---
ARGR_STAAM       LVLKTLPGNAQSIGAILDQI-NWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL---
ARGR_STAES       LVLKTLPGNAQSIGAILDQI-DWDEVLGTICGDDTCLLICRDEEASEEIKTRIFNLL---
ARGR_CLOAB       VVVKTISGSANAAAEAIDSL-NLDGIAGSIAGDNTIFILSRSEETAFNIVQKLKKMINE-
ARGR_CLOTE       VVVKTLSGSGNAAAEAIDSL-NFKEIAGTIAGDNTIFIMARTSEQAFEIVKKMKRVIRER
ARGR2_CLOPE      VVVKTISGSASAAAEAIDTL-HLGEIAGTIAGGNTIFILVRSLEKAETLVSRILEMIEG-
ARGR_CALS4       IVIKTLSGSASAAAEAIDTL-NWKNIVGTIAGDNTIFVLVRNQEDIQELVEKFRKLMK--
ARGR_ENTFA       VILHTEMGNADVVSNFLDEV-AYPEVAGTVAGADTIIVITRSEEDAEHFIERIENMIF--
ARGR1_LACPL      NIIHTLPSNGNLLAAIIDDL-NLPEVSGTLAGHDTIFVVSPNTTVAKQLYESFASHISNE
ARGR_STRPN       LVLHTKLGEASVLANIVDVN-KDEWILGTVAGANTLLVICRDQHVAKLMEDRLLDLMKDK
ARGR1_CLOPE      ISVNTLDGMASLIGEFIDRL-GDGRIAGTVAKKNHILVLCRSVNATQQIFKELDSLRV--
ARGR_THEMA       IVIKTIPGTASGIARVIDRL-DIDEIVGTLAGDDTIFVAVRDPESCEKIVEKLSSIL---
ARGR_DEIRA       LVIRTADGHASGVALLLDRW-KRDDIVGTLAGEDTIMVVARSTHDGESLMEEFNALMLG-
ARGR_COREF       AMLRTPPGAAQYLASFIDRV-GLKEVVGTIAGDDTVFVLAREPLTGRDLGELLGGRAGAR
ARGR_CORGL       AMLRTPPGAAQYLASFIDRV-GLKEVVGTIAGDDTVFVLARDPLTGKELGELLSGRTT--
ARGR_MYCLE       AVLRTPPGAADYLASAIDRA-ALPYVVGTIAGDDTVFVAAREPMTGSELATVLESLNR--
ARGR_MYCTU       AVLRTPPGAAHYLASAIDRA-ALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR---
ARGR_STRAW       VVLRTPPGAAQFLASAIDQA-ELHDILGTIAGDDTLLLISREPTGGQALADHLLRLAQNH
ARGR_STRCO       VVLRTPPGAAQFLASAIDQA-ELHDILGTIAGDDTLMLISREPTGGQALADHLLRLAQNG
ARGR_STRCL       VVLRTPPGAAQFLASAIDQA-ELHDILGTIAGDDTLMLISRSPTGGQALADHLLRLAQND
ARGR_ECOLI       VVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQE
ARGR_ECOL6       VVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKELYEAILELFDQE
ARGR_SALTY       VVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPASGFSVRDLYEAILELFEQE
ARGR_YERPE       VVINTSPGAAQLIARLLDSLGKAEGILGSIAGDDTIFTTPARGFTVKQLHEAILRLFEQE
ARGR_PHOLL       VVIRTSPGAAQLIARLLDSLGKSEGILGSIAGDDTIFVTLTRDSTTEQLRGAILGLFEQE
ARGR_VIBVU       VVIHTGPGAAQLIARMLDSLGKSEGILGVVAGDDTIFITPTLTITTEQLFKSVCELFEYA
ARGR_VIBVY       VVIHTGPGAAQLIARMLDSLGKSEGILGVVAGDDTIFITPTLTITTEQLFKSVCELFEYA
ARGR_VIBPA       VVIHTGPGAAQLIARLLDSLGKSEGILGVVAGDDTIFITPTMPVSTEQLFKSVCELFEYT
ARGR_VIBCH       VVIRTGPGAAQLIARLLDSLGKSEGILGVVAGDDTIFITPTLDVPVKELFHSVCELFEYA
ARGR_HAEIN       IVIKTTPGAAQLIARLLDSIGKSEGILGTIAGDDTIFVTPTNNKPIDELLQNIQRLFENT
ARGR_PASMU       VVIRTTPGAAQLIARLLDSIGKADGILGTIAGDDTIFVTPTLDANIADLIKSIRNLFETS
ARGR_SHEON       IVVRTSPGAAQLIARLLDSIGKPEGILGTIAGDDTIFICPSSIQDIADTLETIKSLFNYA
ARGR_CHLPN       IVIRTVPGSASWIAALLDQGLKDE-ILGTLAGDDTIFVTPIDEGRLPLLMVSIANLLQVF
                   :..  . .   .  :*         * :.  :  :               .       

ARGR_BACAN       ------
ARGR2_BACCR      ------
ARGR_GEOSE       ------
ARGR_ALKHC       ------
ARGR_BACLD       ------
ARGR_BACSU       ------
ARGR_OCEIH       ------
ARGR_LISIN       ------
ARGR_LISMO       ------
ARGR_STAAM       ------
ARGR_STAES       ------
ARGR_CLOAB       ------
ARGR_CLOTE       GV----
ARGR2_CLOPE      ------
ARGR_CALS4       ------
ARGR_ENTFA       ------
ARGR1_LACPL      D-----
ARGR_STRPN       ------
ARGR1_CLOPE      ------
ARGR_THEMA       ------
ARGR_DEIRA       ------
ARGR_COREF       GPEGKV
ARGR_CORGL       ------
ARGR_MYCLE       ------
ARGR_MYCTU       ------
ARGR_STRAW       H-----
ARGR_STRCO       G-----
ARGR_STRCL       RA----
ARGR_ECOLI       L-----
ARGR_ECOL6       L-----
ARGR_SALTY       L-----
ARGR_YERPE       L-----
ARGR_PHOLL       L-----
ARGR_VIBVU       G-----
ARGR_VIBVY       G-----
ARGR_VIBPA       G-----
ARGR_VIBCH       G-----
ARGR_HAEIN       L-----
ARGR_PASMU       I-----
ARGR_SHEON       E-----
ARGR_CHLPN       LD----