CLUSTAL format seed alignment for MF_00174

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EPMA_ACTSZ      ----MFEQEQWQPTANVETLFARAKIINNIRRFFTDRGVLEVETPILSEFGVTDVHLSTF
EPMA_PASMU      ----MFEQENWQPSASIENLLARAKIIAEIRRFFTDRGLLEVETPVLSEFGVTDVHLSTF
EPMA_MANSM      ----MFEQEAWQPSAPIKTLFTRAKIIREIRKFFTERGLLEVETPVLSEFGVTDVHLSTF
EPMA_HAEIE      ----MTALNHWQPSADIKNLLKRAKIIAEIRQFFTERGLLEVETPVLSEFGVTDLHLSTF
EPMA_HAEIG      ----MTALNHWQPSADIKNLLKRAKIIAEIRQFFTERGLLEVETPVLSEFGVTDLHLSTF
EPMA_HAEIN      ----MTALNHWQPSADIKNHLKRAKIIAKIRQFFTERGLLEVETPVLSEFGVTDLHLSTF
EPMA_HAES1      ----MSLNEQWQPSASIQNLLARAKIIADIRRFFTERGLLEVETPVLSEFGVTDVHLSTF
EPMA_HISS2      ----MSLNEQWQPSASIQNLLARAKIIADIRRFFTERGLLEVETPVLSEFGVTDVHLSTF
EPMA_AVIPA      -----MSEHQWKPTASIQTLLSRAKIIAEIRQFFSERGLLEVETPILSEFGVTDVHLSTF
EPMA_HAEDU      MSDASLTKINWQPTASIQTLLKRSKIMAEIRQFFTDRGVLEVETPALSEYSVTDVHLSTF
EPMA_SALA4      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALHS      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALEP      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALTY      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALG2      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALDC      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALTI      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALCH      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALNS      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALPB      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALPC      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALSV      ----MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALPA      ----MSETATWQPSASIPNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALPK      ----MSETATWQPSASIPNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_KLEP3      ----MSETATWQPSAPIPNLLKRAAVMAEIRRFFTDRGVLEVETPCMSQATVTDIHLFPF
EPMA_KLEP7      ----MSETATWQPSAPIPNLLKRAAVMAEIRRFFTDRGVLEVETPCMSQATVTDIHLFPF
EPMA_SALAR      ----MSETATWQPSASVPNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_CITK8      ----MSETATWQPSASIPNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPF
EPMA_ECO81      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOHS      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO8A      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO7I      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOL5      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOL6      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO45      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOLU      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO5E      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO57      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO24      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO27      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOUT      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOSM      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOSE      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECODH      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOBW      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOLI      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECO55      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_SHIF8      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_SHIB3      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_SHIFL      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ECOLC      ----MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ESCF3      ----MSETATWQPSASIPNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_ENT38      ----MSETATWQPSASIPNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLVPF
EPMA_EDWI9      ----MSDMASWQPSAPVANLLKRASILSTIRRFFSDRGVLEVDTPSMSQATVTDVHLVPF
EPMA_ERWT9      ----MSDTASWQPSASIANLLKRAAIMAEIRRFFADRGVLEVETPAMSQATVTDVHLFPF
EPMA_YERPE      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERPP      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERPG      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERPA      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERPN      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERPS      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERPB      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERP3      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERPY      ----MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_YERE8      ----MSETASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQATVTDIHLVPF
EPMA_SERP5      ----MSETASWQPSAPIANLLKRAAILTEIRRFFADRGVLEVETPTMSQATVTDIHLFPF
EPMA_PHOLL      ----MSETANWQPSAAIANLLKRATILAEIRRFFADRGVLEVETPAMGQFTVTDIQLFSF
EPMA_PROMH      ----MSEIADWQPSASIANLLKKAKIVSNIRRFFADRGVLEVETPMMSQATVTDIHLCPF
EPMA_PECAS      ----MSETTSWQPSASVANLLKRASIVAAVRRFFTDRGVLEVETPAMSQATVTDVFLYPF
EPMA_PECCP      ----MSETTSWQPSASVANLLKRASIIAAIRRFFTDRGVLEVETPAMSQATVTDIFLYPF
EPMA_SODGM      ----MSDSASWQPSAPIANLLKRAAIVGQIRRFFSDRGLLEVETPAMSQATVTDIHLVPF
EPMA_HAMD5      ----MSEAANWQPSAPISNLLKRADMIKKIRQFFTDRGVLEVDTPCMSQATVTDVHLSTF
EPMA_VIBCB      ------MQTTWQPTASMEQLRQRAALITAIRQFFAERQVMEVDTPAMSHATVTDIHLHTF
EPMA_VIBPA      ------MQTNWQPTASIEQLRQRATLIAAIRQFFAERQVMEVDTPAMSHATVTDIHLHTF
EPMA_VIBVU      ------MQADWKPTASIEQLRQRAVLIANIRQFFAQRGVLEVDTPAMSHATVTDIHLHTF
EPMA_VIBVY      ------MQADWKPTASIEQLRQRAVLIANIRQFFAQRGVLEVDTPAMSHATVTDIHLHTF
EPMA_VIBCH      -----MTNSDWMPTASISQLKQRATLLRQIREFFAERNVLEVETPAMSHATVTDIHLHTF
EPMA_VIBA3      ------MHSTWQPAATIKQLKQRADILNQIRQFFVERNVMEVDTPAMSHATVTDVHLHTF
EPMA_PHOPR      ------MSQPWQPTASIKQLKQRAAVLSSIRDFFAGKEVIEVDTPAMSQATVTDVHLHTF
EPMA_PSET1      -----MSVNLWAPSASIATLKQRAVILRSIREFFYARNVMEVETPSLSGASVTDIHLVSF
EPMA_BAUCH      ----MNKLISWKPRASIHNLFIRAKIINNIRIFFINRGLLEVETPVMSHTTVPDIYLFPF
EPMA_BUCA5      -----MKKKIWKSSASIEDLIKRSNIISNIRLFFSKKNILEVETPILSRSTVTDVHLTSF
EPMA_BUCAT      -----MKKKIWKSSASIEDLIKRSNIISNIRLFFSKKNILEVETPILSRSTVTDVHLTSF
EPMA_BUCAI      -----MKKKIWKSSASIEDLIKRSNIISNIRLFFSKKNILEVETPILSRSTVTDVHLTSF
EPMA_BUCAP      ------MKKKWKPSASIKDLMKRSKIIADIRSFFLKKNIMEVETPILSQSGVTDVNLMPF
EPMA_BUCBP      ----MNCNYLWKSSALLKNLHRRAKIIFEIRNYFFNLGILEVETPILSNYSVTDVNFIPF
                          * . * :     :: ::  :* :*    ::**:** :.   *.*: : .*

EPMA_ACTSZ      STE--FVAPQAERSKTLWLNTSPEYHMKRLLAAGTGAIFQLCHVFRNEEAG-SRHNPEFT
EPMA_PASMU      NTT--FISPTAEKSKALWLSTSPEYHMKRLLAAGSGPIFQLCHVFRNEEAG-QRHNPEFT
EPMA_MANSM      NTE--FIAPIGENSKTLWLMTSPEYHMKRLLAAGSGAIFQICRVFRNEEAG-SRHNPEFT
EPMA_HAEIE      STE--FLAPFGEQSKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEAG-NRHNPEFT
EPMA_HAEIG      STE--FLAPFGEQSKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEAG-NRHNPEFT
EPMA_HAEIN      STE--FLAPFGEQSKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEAG-NRHNPEFT
EPMA_HAES1      STA--FTSPFMEKSKTLWLTTSPEYHMKRLLAAGSGAIFQLCKVFRNEESG-KKHNPEFT
EPMA_HISS2      STA--FTSPFMEKSKTLWLTTSPEYHMKRLLAAGSGAIFQLCKVFRNEESG-KKHNPEFT
EPMA_AVIPA      STK--LISPFQKKEKTLWLSTSPEYPMKRLLSAGSGAIFQLCKVFRNEEAG-KKHSPEFT
EPMA_HAEDU      STE--FLSPFAKQAKTLHLITSPEYHMKRLLAAGSSSIFQLCRVFRNEESG-KRHNPEFT
EPMA_SALA4      ETR--FVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALHS      ETR--FVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALEP      ETR--FVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALTY      ETR--FVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALG2      ETR--FVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALDC      ETR--FVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALTI      ETR--FVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALCH      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALNS      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALPB      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALPC      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALSV      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALPA      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALPK      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_KLEP3      ETR--FVGPGHSQGLNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_KLEP7      ETR--FVGPGHSQGLNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_SALAR      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_CITK8      ETR--FVGPGHSQGMNLYLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RHHNPEFT
EPMA_ECO81      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOHS      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO8A      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO7I      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOL5      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOL6      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO45      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOLU      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO5E      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO57      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO24      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO27      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOUT      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOSM      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOSE      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECODH      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOBW      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOLI      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECO55      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_SHIF8      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_SHIB3      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_SHIFL      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ECOLC      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMG-RYHNPEFT
EPMA_ESCF3      ETR--FVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPIFQLCRSFRNEEMG-RHHNPEFT
EPMA_ENT38      ETR--FVGPGHSQGMNLYMMTSPEYHMKRLLAAGCGPVYQLCRSFRNEEMG-RHHNPEFT
EPMA_EDWI9      QTH--FVGPGVAQGMMLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEESG-RYHNPEFT
EPMA_ERWT9      QTR--FVGPGAAAGIDLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEEMG-RHHNPEFT
EPMA_YERPE      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERPP      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERPG      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERPA      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERPN      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERPS      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERPB      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERP3      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERPY      ETR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAG-RYHNPEFT
EPMA_YERE8      QTR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGSIYQLGRSFRNEEAG-RHHNPEFT
EPMA_SERP5      QTR--FVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQMGRSFRNEEAG-RHHNPEFT
EPMA_PHOLL      QTE--FVGPGAADGMTLYLMTSPEYHMKRLLAAGSGPIYQLGRCFRNEEAG-RYHNPEFT
EPMA_PROMH      ETQ--FVGPGASQGLKLYLMTSPEYHMKRLLAANSGPIYQMGRCFRNEEAG-RYHNPEFT
EPMA_PECAS      QTR--FVGPGAADGMTLYLMTSPEYHMKRLLAAGSGPIFQLCRSFRNEESG-RHHNPEFT
EPMA_PECCP      QTR--FVGPGAADGMTMYLMTSPEYHMKRLLAAGSGPIFQLCRSFRNEESG-RHHNPEFT
EPMA_SODGM      QTC--FIGPGAAGGMPLYLMTSPEYHMKRLLAAGSGPLFQLCRSFRNEEAG-RYHNPEFT
EPMA_HAMD5      ETR--FLAPTMAKSLSLYMTTSPEYHMKRLLAAGSGPIYQMGRCFRNEEMG-RYHNPEFT
EPMA_VIBCB      QTE--FVGPGYADGSKLFFMTSPEFHMKRLLAAGSGCIYQINKAFRNEENG-RHHNPEFT
EPMA_VIBPA      QTE--FVGPGYADGSKLFFMTSPEFHMKRLLAAGSGCIYQINKAFRNEENG-RYHNPEFT
EPMA_VIBVU      QTE--FVGPGYAQGRHLHLMTSPEFHMKRLLAAGSGCIYQMAKAFRNEENG-RHHNPEFT
EPMA_VIBVY      QTE--FVGPGYAQGRHLHLMTSPEFHMKRLLAAGSGCIYQMAKAFRNEENG-RHHNPEFT
EPMA_VIBCH      KTE--FVGPGYAKGSALHLMTSPEFHMKRLLAAGSGCIYQLGKAFRNEENG-RYHNPEFT
EPMA_VIBA3      KTE--FVGPGYAHGQPLFFMTSPEFHMKRLLAAGSGCIYQICKSFRNEENG-RYHNPEFT
EPMA_PHOPR      QTE--FVGPGYAGGQTLYMMTSPEFHMKRLLSAGSGPIYQICKSFRNEESG-RYHNPEFT
EPMA_PSET1      NTR--FVGPGHASGLELYLQTSPEFAMKRLLAAGSGPIFQLCKAFRNEEAG-SHHNPEFT
EPMA_BAUCH      QTNLYFLEKVPEKGVPMYLITSPEYHMKRLLAAGSGPIFQICHSFRNQEYG-NYHNPEFT
EPMA_BUCA5      ETN-YIS-SDNIDELKLWLTTSPEYHMKRLLASESGSIYQICHSFRNKELG-RYHNPEFT
EPMA_BUCAT      ETN-YIS-SDNIDELKLWLTTSPEYHMKRLLASESGSIYQICHSFRNKELG-RYHNPEFT
EPMA_BUCAI      ETN-YIS-SDNIDELKLWLTTSPEYHMKRLLASESGSIYQICHSFRNKEIG-RYHNPEFT
EPMA_BUCAP      ITN-YFSFNDNIKKKNLWLITSPEYHMKRLLSAGSGSIYQICRSFRNQEFG-QYHNPEFT
EPMA_BUCBP      KT------KLQITKKRMWLVPSPEYHMKRLLVQNIGAIYQISRSFRNNEFGGPYHNPEFT
                 *              : : .***: *****    . ::*: : ***:* *   *.****

EPMA_ACTSZ      MLEWYRPHFDMYRLINEVDDLLQQILDCEPAESMSYQFAFQEFVGVDPLSAERPILVELA
EPMA_PASMU      MLEWYRPHFDMYRLINEVDDLLQQILDCKPTESLSYQFVFQEYVGLDPLSAEKAELVAKA
EPMA_MANSM      MLEWYRPHFDMYRLINEVDDLLQQILDCEPAESFSYQFVFQQYVGLDPLSAPRAELVAKA
EPMA_HAEIE      MLEWYRPHFHMHRLINEVDDLLQQILDCPPAESLSYQFVFQEYVGLDPLSAERSELIEAA
EPMA_HAEIG      MLEWYRPHFHMHRLINEVDDLLQQILDCPPAESLSYQFVFQEYVGLDPLSAERSELIEAA
EPMA_HAEIN      MLEWYRPHFHMHRLINEVDDLLQQILDCPPAESLSYQFVFQEYVGLDPLSAERSELIEAA
EPMA_HAES1      MLEWYRPHFDMHRLINEVDDLLQQTLDCEPAEMASYQFVFQEHVGIDPLSAPINELIEKA
EPMA_HISS2      MLEWYRPHFDMHRLINEVDDLLQQTLDCEPAEMASYQFVFQEHVGIDPLSAPINELIEKA
EPMA_AVIPA      MLEWYRPYFDMYRLINEVDDLLQYILDCEPAESMSYQFAFQEYVGIDPLSASQDKLIEKA
EPMA_HAEDU      MLEWYRPHFDMYRLINEVDDLLQQILDCEPIESYSYQFVFQTYVGLDPLSASRAQLVEKA
EPMA_SALA4      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALHS      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALEP      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALTY      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALG2      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQGHLEIDPLSADKTQLREAV
EPMA_SALDC      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALTI      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFLRHLEIDPLSADKTQLREAA
EPMA_SALCH      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALNS      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALPB      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALPC      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALSV      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALPA      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_SALPK      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_KLEP3      MLEWYRPCYDMYRLINEVDDLLQQVLECQPAESLSYQQAFQRHLDIDPLSADKTQLREVA
EPMA_KLEP7      MLEWYRPCYDMYRLINEVDDLLQQVLECQPAESLSYQQAFQRHLEIDPLSADKAQLREVA
EPMA_SALAR      MLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAA
EPMA_CITK8      MLEWYRPHYDMYRLMNEVDDLLQQVLECQPAESLSYQQVFQRHLEIDPLSADKTQLREAA
EPMA_ECO81      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOHS      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO8A      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO7I      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOL5      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOL6      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO45      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOLU      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO5E      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO57      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO24      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO27      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOUT      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOSM      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOSE      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECODH      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOBW      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOLI      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECO55      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_SHIF8      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_SHIB3      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_SHIFL      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ECOLC      MLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVA
EPMA_ESCF3      MLEWYRPHYDMYRLMNEVDDLLQQVLDCAPAESLSYQQAFQRYLEIDPLSADKAQLREAA
EPMA_ENT38      MLEWYRPHYDMYRLMNEVDDLLQQVLDCAGAETLSYQQVFQRHLEIDPLSADKTQLREAA
EPMA_EDWI9      MLEWYRPHYDMYRLMNEVDDLLQQVLECESAETLSYQQAFIRHLDVDPLSADKTQLREVA
EPMA_ERWT9      MLEWYRPHYDMYRLINEVDDLLQQVLECAPAETLSYQQAFQRHLEIDPLSADKAQLREVA
EPMA_YERPE      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERPP      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERPG      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERPA      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERPN      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERPS      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERPB      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERP3      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERPY      MLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLSAEKAQLREVA
EPMA_YERE8      MLEWYRPHYDMYRLMDEVEDLLQQILDCDSSERLSYQQAFLRHLDIDPLSADKAQLREAA
EPMA_SERP5      MLEWYRPHYDMYRLMNEVDDLLQQVLDCDSAETLSYQQAFLRHLDIDPLSAEKAQLREAA
EPMA_PHOLL      MLEWYRPHYDMYRLMNEVDDLLQQILDCESAESLSYQQAFLRYLDIDPLSAEKEKLREIA
EPMA_PROMH      MLEWYRPCFDMYRLMNEVDDLLQEVLDCEASESLSYQQAFLRYLDIDPLSADKEKLREVA
EPMA_PECAS      MLEWYRPHYDMYRLMNEVDDLLQQVLDCESAEMLSYQQAFLRHLEIDPLSVDKAQLREAA
EPMA_PECCP      MLEWYRPHYDMYRLMNEVDDLLQQVLDCESAEMLSYQQAFLRHLELDPLSVDKAQLREAA
EPMA_SODGM      MLEWYRPHYDMYRLMNEVDDLLQQILDCDSAETLSYQQVFTRHVGIDPLSADKAQLYDAA
EPMA_HAMD5      LLEWYRPHYDMYRLMDEVDDLLQQILTCHSAETLSYQQAFLRHLNIDPLSADETQIKEAA
EPMA_VIBCB      MLEWYRIGFDHHKLMDEMDDLLQLVLKCGAAERMTYQQAFIDVLGVCPLEGSMQELKVVA
EPMA_VIBPA      MLEWYRVGFDHHKLMDEMDDLLQLVLKCGAAQRMTYQQAFIDVLGVCPLEGSMTELKAAA
EPMA_VIBVU      MLEWYRVGFDHHQLMDEMDDLLQLILKCGTAERMTYQQAFLTVLGVCPLEGSMAELKSVA
EPMA_VIBVY      MLEWYRVGFDHHQLMDEMDDLLQLILKCGTAERMTYQQAFLTVLGVCPLEGSMAELKSVA
EPMA_VIBCH      MLEWYRIGFDHHALMDEMDALLQLVLRCGSAERMTYQEAFLNVLGVCPLEEEMRELKQVA
EPMA_VIBA3      MLEWYRVGFDHHDLMDEMDLLLQQVLKSGTAERMTYQQAFIDVLGVCPLEDSMDTLKQAA
EPMA_PHOPR      MLEWYRPDFDHHDLMNEMDELLQLVLQCDKAERMSYQQAFIQELGVCPLEGTMEQLKGVA
EPMA_PSET1      MLEWYRPGFDEFALMAEIDELMQLILDVAPSERLTYQHAFEQVLGLDPLTASLEQLQQLA
EPMA_BAUCH      LLEWYRPYYNMVDIMDEVNIFLQTIIHCDSAEMLSYQQVFRLHVGIDPLLAELDELNQVL
EPMA_BUCA5      MLEWYQPFCSMKKFIKEIDIFLQIILKCNKSDKVSYQDLFIDFLKIDPLCANLLELHQIS
EPMA_BUCAT      MLEWYQPFCSMKKFIKEIDIFLQIILKCNKSDKVSYQDLFIDFLKIDPLCANLLELHQIS
EPMA_BUCAI      MLEWYQPFCSMKKFIKEIDIFLQIILKCNKSDKVSYQDLFIDFLKIDPLCTNLLELHQIS
EPMA_BUCAP      MLEWYQLSCSMEKMIEEIDFFFQKILNFNKADKISYQEVFMKFLKIDPLSTSLSELFQCY
EPMA_BUCBP      MLEWYSPYCNMFDFMKKVEKFLVFCLKVVQVKYISYQRAFIKYLNIDPLLAKKRELLDLI
                :****        :: ::: ::   :     .  :**  *   : : **      :    

EPMA_ACTSZ      RKYNFMCDLD--EDRDTLLQFLFSTVVEPKIGQERPVAVYHFPATQAALAQISSEDHRVA
EPMA_PASMU      KQYHLQQAEQ--EDRDTLLQFLFSTVVEPNIGKENPVAVYHFPATQAALAQISSEDHRVA
EPMA_MANSM      REHHFMCDEN--EERDTLLEFLFSTVVEPQIGQTRPAVIYHFPASQAALAQISSEDHRVA
EPMA_HAEIE      RKHNFMAEDN--EDRDTLLQFLFSEVVEPQIGKERPIAVYHFPSTQAALAQVSPEDQRVA
EPMA_HAEIG      RKHNFMAEDN--EDRDTLLQFLFSEVVEPQIGKERPIAVYHFPSTQAALAQVSPEDQRVA
EPMA_HAEIN      RKHNFMAEDN--EDRDTLLQFLFSEVVEPQIGKERPIAVYHFPSTQAALAQVSPEDQRVA
EPMA_HAES1      RECHLDGAEN--EDRDTLLQFLFSTLVEPNIGQNKPIAVYHFPATQAALAQISSEDHRVA
EPMA_HISS2      RECHLDGAEN--EDRDTLLQFLFSTLVEPNIGQNKPIAVYHFPATQAALAQISSEDHRVA
EPMA_AVIPA      KEYCLENAER--EDRDTLLQFLFNVAVESQIGKDKPVAIYHFPATQAALAQISSEDHRVA
EPMA_HAEDU      RKHGFACEED--ENRDTLLQFLFSEIVEANIGQERPTTVYHFPSSQAALAQISSEDHRVA
EPMA_SALA4      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALHS      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALEP      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALTY      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALG2      AKLDLSNIADTEEDRDTLLQLLLTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALDC      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALTI      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALCH      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALNS      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALPB      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALPC      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALSV      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALPA      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_SALPK      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_KLEP3      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKDRPTFIYHFPATQASLAQISPEDHRVA
EPMA_KLEP7      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKDRPTFIYHFPATQASLAQISPEDHRVA
EPMA_SALAR      AKLDVSNIADTEEDRDTLLQLLFTVGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVA
EPMA_CITK8      AKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO81      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOHS      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO8A      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO7I      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOL5      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOL6      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO45      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOLU      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO5E      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO57      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO24      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO27      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOUT      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOSM      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOSE      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECODH      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOBW      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOLI      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECO55      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_SHIF8      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_SHIB3      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_SHIFL      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ECOLC      AKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ESCF3      AKLDLSNVADEEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVA
EPMA_ENT38      AKLDLSNVADTEEDRDTLLQLLFAFGVEPHIGKDRPTFVYHFPASQASLAQISTEDHRVA
EPMA_EDWI9      AKLDLSNVADNEEDRDTLLQLLFAFGVEPHIGKERPVFVYHFPASQASLAQISTEDHRVA
EPMA_ERWT9      QKLGAGDLANREEDRDTLLQLLFVLGVEPEIGKEKPAFVYHFPATQAALAEISPEDHRVA
EPMA_YERPE      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERPP      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERPG      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERPA      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERPN      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERPS      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERPB      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERP3      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERPY      AKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASLAEISTEDHRVA
EPMA_YERE8      AKLDLSNIADTEEDRDTLLQLLFTVGVEPHIGRDKPAFVYHFPASQASLAVISTEDHRVA
EPMA_SERP5      AKLDLSNIADTEEDRDTLLQLLFTVGVEPHIGRDKPAFVYHFPASQASLAEISTEDHRVA
EPMA_PHOLL      AKLDLSNIADIEEDRDTLLQLLFAVGVEPHIGTEKPTFIYHFPASQASLAEISKEDHRVA
EPMA_PROMH      AKLDLSNIADTEENRDTLLQLLFVSGVEPHIGLEKPTFIYHFPASQASLAEISSEDHRVA
EPMA_PECAS      EKLGLGDIACREDDRDSLVQMLFTFGVEPNIGRDKPAFVYHFPATQASLAEISSEDHRVA
EPMA_PECCP      EKLGLGDIACREDDRDSLVQMLFTFGVEPHIGRDKPAFVYHFPATQASLAEISSEDHRVA
EPMA_SODGM      VKWDLGEAASVEDDRDTLLQLLFAMVVEPNIGHDKPAFVYHFPASQAALAEISTEDHRVA
EPMA_HAMD5      VRLNLASITDNEKDRDTFLQLLFMAGVEPYIGRDKPVFIYHFPASQAALASISTEDYRVA
EPMA_VIBCB      AKLGLSDIAEPEEDRDTLLQLLSSIGVEAKIGQQVPAFVYDFPASQAALAKINPQDIRVA
EPMA_VIBPA      SKLGLSDIAEPEEDRDTLLQLLFSVGVENKIGQDVPAFVYDFPASQAALAKINPQDHRVA
EPMA_VIBVU      ARLGLSDIAEPEEDRDTLLQLLFSIGVEAKIGQQVPAFVYDFPASQAALAKINPNDPRVA
EPMA_VIBVY      ARLGLSDIAEPEEDRDTLLQLLFSIGVEAKIGQQVPAFVYDFPASQAALAKINPNDPRVA
EPMA_VIBCH      ATLGLSDIAEPEEDRDTLLQLLFSIGIEPKIGQITPAFVYDFPASQAALAKINPADPRVA
EPMA_VIBA3      AKLGLSDIADPEQDRDTLLQLLFSIGVEAKIGQQVPAFVYDFPASQAALAKINPNDSRVA
EPMA_PHOPR      RTLGLADIADPEQDRDTLLQLLFSMGVENKIGQQVPAFVYDFPASQAALAQINPTDNRVA
EPMA_PSET1      CEQGFADIAKNETHRDTLLQLLFCMKVEPTIGQHKPCFVYHFPASQAALAQICDHDSRVA
EPMA_BAUCH      VKFNLSSTISLYNDRDKLLDFLFLMLVRPHLGNNKPVFIYNFPASQSLLAELNSDDHRVA
EPMA_BUCA5      KKLKLDHLTHSENNLNKLIQLLFTLKIEPNIGKEKPLFVYHFPAEQASLAAINLKDPRIS
EPMA_BUCAT      KKLKLDHLTHSENNLNKLIQLLFTLKIEPNIGKEKPLFVYHFPAEQASLAAINLKDPRIS
EPMA_BUCAI      KKLKLDHLTHSENNLNKLIQLLFTLKIEPNIGKEKPLFVYHFPAEQASLAAINLKDPRIS
EPMA_BUCAP      KKFNLKNLIYLENDLNQLIENIFTLQIQPFLGKEKPLFVYHFPSEQACLASINKKDSRVS
EPMA_BUCBP      NKFKFNHLISDCDSISTLLEILFTLKIEPNLNNKKLIFVYHYPADQAILAAINDNDSRVS
                               . ::: :    :.  :.      :*.:*: *: ** :   * *::

EPMA_ACTSZ      ERFEFYYKGLELANGFHELTDHREQLHRFEQDNVQRAKLALPQREIDRRLLGALQAGVPN
EPMA_PASMU      ERFEFYYKGLELANGFHELTDVNEQLHRFEQDNVQRQKMGLPQRQIDKRLLGALQAGVPN
EPMA_MANSM      ERFEFYFKGLELANGFNELTDANEQLIRFERDNRQREKMGLPQRAIDKRLLAALEAGMPN
EPMA_HAEIE      ERFEFYYKGLELANGFHELADAQEQRHRFELDNQQRQKCELPTREIDERFLAALEAGMPD
EPMA_HAEIG      ERFEFYYKGLELANGFHELADAQEQRHRFELDNQQRQKCELPTREIDERFLAALEAGMPD
EPMA_HAEIN      ERFEFYYKGLELANGFHELADAQEQRHRFELDNQQRQKCELPTREIDERFLAALEAGMPD
EPMA_HAES1      ERFEFYYKGIELANGFNELTDAQEQEHRFNQDNRLREQLGLPQHEIDHRFLGALQAGLPN
EPMA_HISS2      ERFEFYYKGIELANGFNELTDAQEQEHRFNQDNRLREQLGLPQHEIDHRFLGALQAGLPN
EPMA_AVIPA      ERFEFYYKGLELANGFCELTDANEQRHRFEQDNKQRERLGLPIHQIDERFLAALKAGVPN
EPMA_HAEDU      ERFEIYYKGLELANGFHELNDAKEQIRRFERDNQLREQMNLPPQPLDMRFLAALKAGIPN
EPMA_SALA4      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALHS      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALEP      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALTY      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALG2      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALDC      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALTI      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALCH      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALNS      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALPB      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALPC      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALSV      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALPA      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_SALPK      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPD
EPMA_KLEP3      ERFEVYYKGIELANGFHELTDAREQRLRFEQDNRKRAARGLPQQPIDNNLLAALEAGLPD
EPMA_KLEP7      ERFEVYYKGIELANGFHELTDAHEQRLRFEQDNRKRAARGLPQQPIDNNLLAALEAGLPD
EPMA_SALAR      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDNHLLDALKAGMPD
EPMA_CITK8      ERFEVYFKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDNNLLEALKVGMPD
EPMA_ECO81      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOHS      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO8A      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO7I      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOL5      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOL6      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO45      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOLU      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO5E      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO57      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO24      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO27      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOUT      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOSM      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOSE      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECODH      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOBW      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOLI      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECO55      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_SHIF8      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_SHIB3      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_SHIFL      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPD
EPMA_ECOLC      ERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIDALKVGMPD
EPMA_ESCF3      ERFEVYYKGIELANGFHELTDAREQEQRFEQDNRKRAARGLPQHPIDHNLIEALKVGMPD
EPMA_ENT38      ERFEVYYKGIELANGFHELTDAREQQQRFDQDNRKRAARGLPQQPIDTNLLEALKAGLPD
EPMA_EDWI9      ERFEVYYRGVELANGFHELTDAAEQRQRFEQDNRKRAAAGLPQQPIDEHLLAALEHGMPD
EPMA_ERWT9      ERFEVYFKGIELANGFRELTDSREQRQRFEQDNRKRAAAGLPQQPIDTYLLDALSAGMPE
EPMA_YERPE      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERPP      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERPG      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERPA      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERPN      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERPS      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERPB      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERP3      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERPY      ERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPD
EPMA_YERE8      ERFEVYFKGIELANGFHELTDGDEQLKRFEQDNRSREKRGLPQHPIDMNLIDALKHGLPD
EPMA_SERP5      ERFEVYFKGIELANGFRELTDSREQGQRFAQDNRKRAERGLPQHPIDNNLLDALQHGMPE
EPMA_PHOLL      ERFEVYFKGVELANGFRELTDSHEQCQRFERDNRKRAALGLPVRPIDENLIGALKQGMPE
EPMA_PROMH      ERFEVYFKGVELANGFRELTDAKEQRLRFERDNRQRVAMGLPEQPIDERFLAALEAGLPE
EPMA_PECAS      ERFEVYFKGIELANGFRELTDADEQRQRFEQDNRKRAARGLSQQPIDENLLAALKNGLPE
EPMA_PECCP      ERFEVYFKGIELANGFRELTDADEQRQRFEQDNRKRAARDLPQQPIDENLLAALKHGLPE
EPMA_SODGM      DRFEAYFKGIELANGFCELTDAREQRQRFEQDNRKRVAMKLSEQPIDENLLAALAQGMPE
EPMA_HAMD5      ERFEVYFKGIELANGFYELTDSAEQQQRFEQDNRQRAALGLPKRSIDERFIAALKHGLPP
EPMA_VIBCB      DRFEVYFKGIELANGFHELDNPKEQLARFEQDNAKRLDMGLKPQPIDYHLIGALEAGLPD
EPMA_VIBPA      DRFEVYFKGIELANGFHELDNPKEQLARFEQDNAKRIEMGLKPQPIDYHLISALEAGLPD
EPMA_VIBVU      DRFEVYFKGIELANGFHELDNPQEQLTRFEQDNAKRIDMGLTPQPIDYHLIAALESGLPA
EPMA_VIBVY      DRFEVYFKGIELANGFHELDNPQEQLTRFEQDNAKRIDMGLTPQPIDYHLIAALESGLPA
EPMA_VIBCH      DRFEVYFKGIELANGFHELDNPAEQLARFKADNAKRLEMGLTEQPIDYHLIAALEAGLPE
EPMA_VIBA3      DRFEVYFKGIELANGFHELDKPQEQLKRFEDDNTKRIEMGLSPQPIDHHLIEALKAGLPD
EPMA_PHOPR      ERFEVYFKGIELANGFHELANGDEQLVRFEQDNMKRISMGLKPQPIDLHLIEALRAGFPD
EPMA_PSET1      GRFELYYKNMELANGFNELTNATEQAKRFNDDNEYRKQNGLKQVPMDKHLIAALEHGLAP
EPMA_BAUCH      ERFEVYFHGIELANGSRELTDADLQRERFMQENNKQVAMNRPPRLIDEQLLAALECGLPS
EPMA_BUCA5      ERFEIFFKGIELGNGFYELIDVNEQKKRFIRDNKERRSMNLPIRKIDNFFLSALSYGLPP
EPMA_BUCAT      ERFEIFFKGIELGNGFYELIDVNEQKKRFIRDNKERRSMNLPIRKIDNFFLSALSYGLPP
EPMA_BUCAI      ERFEIFFKGIELGNGFYELIDVNEQKKRFIRDNKERRSMNLPTRKIDNFFLSALSYGLPP
EPMA_BUCAP      ERFEIFFKGIELGNGFHELTDYFEQRKRFIKDNRKRCDMNLPEQKIDDYFLDAIHHGLPT
EPMA_BUCBP      DRFEVFFKGVELGNGFYELTDQAEHIRRFKLNNIQRRHKGICSVEVDQFFLKSLSRGLPP
                 *** :::.:**.**  ** .   :  **  :*  :         :*  :: ::  *.. 

EPMA_ACTSZ      TSGVALGVDRLVMIALDKKRIEEVMAFAINNA
EPMA_PASMU      CSGIALGVDRLLMIALGANAIHEVMAFGIENA
EPMA_MANSM      CAGVALGVDRLLMAALNANRIEEVMAFGVNNA
EPMA_HAEIE      ASGVALGIDRLMMIALDCEKINDVISFAMDNA
EPMA_HAEIG      ASGVALGIDRLMMIALDCEKINDVISFAVDNA
EPMA_HAEIN      ASGVALGIDRLMMIALDCEKINDVISFAVDNA
EPMA_HAES1      TAGVALGVDRLIMLALGAENISEVISFNIDCA
EPMA_HISS2      TAGVALGVDRLIMLALGAENISEVISFNIDCA
EPMA_AVIPA      CSGVALGVDRLIMIALGLENINEVIAFSIENA
EPMA_HAEDU      CSGVALGVDRLIMLALNANHIQEVMAFGVERA
EPMA_SALA4      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALHS      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALEP      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALTY      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALG2      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALDC      CSGVALGIDRLVMLALGAESLADVIAFTVDRA
EPMA_SALTI      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALCH      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALNS      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALPB      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALPC      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALSV      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALPA      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_SALPK      CSGVALGVDRLVMLALGAESLADVIAFTVDRA
EPMA_KLEP3      CSGVALGVDRVVMLALGAESIGEVIAFTVDRA
EPMA_KLEP7      CSGVALGVDRVVMLALGAESIGEVIAFTVDRA
EPMA_SALAR      CSGVALGVDRLVMLALGAERLADVIAFTVDRA
EPMA_CITK8      CSGVALGVDRLVMLALGAESLAEVIAFTVDRA
EPMA_ECO81      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOHS      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO8A      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO7I      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOL5      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOL6      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO45      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOLU      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO5E      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO57      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO24      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO27      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOUT      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOSM      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOSE      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECODH      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOBW      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOLI      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECO55      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_SHIF8      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_SHIB3      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_SHIFL      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ECOLC      CSGVALGVDRLVMLALGAETLAEVIAFSVDRA
EPMA_ESCF3      CSGVALGVDRLVMLALGAERLSDVIAFSVDRA
EPMA_ENT38      SSGVALGVDRLVMLALGAEQLADVIAFTVDRA
EPMA_EDWI9      SSGVALGVDRLIMLALSAERLSEVIAFSVDRA
EPMA_ERWT9      SSGVALGVDRLVMLALKAEQLSDVIAFTVDRC
EPMA_YERPE      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERPP      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERPG      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERPA      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERPN      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERPS      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERPB      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERP3      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERPY      CSGVALGVDRLVMLALNAERLSDVIAFPVNIA
EPMA_YERE8      CSGVALGVDRLVMLALGAEKLSDVIAFPVGRA
EPMA_SERP5      CSGVALGVDRLVMLALGAESLSEVLAFPVDRA
EPMA_PHOLL      CAGVALGVDRLVMLALGAEKLSDVMAFSITKA
EPMA_PROMH      CSGVALGVDRLIMLALGVERISDVIAFPVYRA
EPMA_PECAS      CSGVALGVDRLIMLALKAEKLSDVIAFSVERA
EPMA_PECCP      CAGVALGVDRLIMLALNAEKLSDVIAFSVERA
EPMA_SODGM      CSGVALGVDRLVMLALKADRLSDVIAFAVERA
EPMA_HAMD5      CSGVALGIDRLVMLSVNAENLSEVMAFPVERA
EPMA_VIBCB      CAGVALGVDRLIMLALGCDHIDQVTAFPFPIA
EPMA_VIBPA      CAGVALGIDRLIMLALGCDHIDQVTAFPFPIA
EPMA_VIBVU      CAGVALGVDRLIMLSLGCTHIDEITAFPFPIA
EPMA_VIBVY      CAGVALGVDRLIMLSLGCTHIDEITAFPFPIA
EPMA_VIBCH      CAGVALGIDRLIMLALGEDHIDKVTAFPFPRA
EPMA_VIBA3      CAGVALGIDRLIMLALGYDHIDDVTAFPFPRS
EPMA_PHOPR      CAGVALGIDRLIMLALKLDHIDQVTAFPIDIA
EPMA_PSET1      CAGVALGIDRLVMLATQKSNIKEVIAFDVTRA
EPMA_BAUCH      CSGVALGIDRLLMLTLKAKHISEVMAFSVTDA
EPMA_BUCA5      CSGVAIGLDRLIMLILNKKSIHEVIAFPVDRC
EPMA_BUCAT      CSGVAIGLDRLIMLILNKKSIHEVIAFPVDRC
EPMA_BUCAI      CSGVAIGLDRLIMLILNKKSIHEVIAFPVDRC
EPMA_BUCAP      CSGVAIGLDRLIMIALNKNSIDQVMSFSFERS
EPMA_BUCBP      CSGIAIGLDRLIMLSLNLKTINEVIAFPIERC
                 :*:*:*:**::*       : .: :* .  .