CLUSTAL format seed alignment for MF_00175

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CLPX_RICCN       -----MVVEAD-------KKALICSFCSKKQHEVKKLIA-----GPA--VFICDECIDLC
CLPX_RICPR       -----MVVDAD-------KKELICSFCSKKQHEVKKLIA-----GPA--VFICDECIDLC
CLPX_BRUME       ------MSKVS-NGGGDSKNTLYCSFCGKSQHEVRKLIA-----GPT--VFICDECVELC
CLPX_RHIME       ------MSKVSGSNGGDSKNTLYCSFCGKSQHEVRKLIA-----GPT--VFICDECVELC
CLPX_RHILO       ------MSKVG-NNSGDSKNTLYCSFCGKSQHEVRKLIA-----GPT--VFICDECVELC
CLPX_CAUVC       ------MTKAA---SGDTKSTLYCSFCGKSQHEVRKLIA-----GPT--VFICDECVELC
CLPX_SALTI       ------MTDKR--KDG-SGKLLYCSFCGKSQHEVRKLIA-----GPS--VYICDECVDLC
CLPX_SALTY       ------MTDKR--KDG-SGKLLYCSFCGKSQHEVRKLIA-----GPS--VYICDECVDLC
CLPX_ECOLI       ------MTDKR--KDG-SGKLLYCSFCGKSQHEVRKLIA-----GPS--VYICDECVDLC
CLPX_YEREN       ------MTDKR--KDG-SGKLLYCSFCGKSQHEVRKLIA-----GPS--VYICDECVDLC
CLPX_YERPE       ------MTDKR--KDG-SGKLLYCSFCGKSQHEVRKLIA-----GPS--VYICDECVDLC
CLPX_VIBCH       ------MTDKS--KEGGSSKLLYCSFCGKSQHEVRKLIA-----GPS--VYICDECVDLC
CLPX_PSEAE       ------MTDTR--NGEDNGKLLYCSFCGKSQHEVRKLIA-----GPS--VFICDECVDLC
CLPX_XYLFA       ------MSEDRPSRSGDGNKILYCSFCGKSQREVRKLIA-----GPS--VFICDECVELC
CLPX_RALSO       ------MADKK---GSTGEKLLYCSFCGKSQHEVKKLIA-----GPS--VFICDECIDLC
CLPX_NEIMA       ------MSNEN----------RTCSFCGKSKSHVKHLIE-----GEN--AFICDECVSNC
CLPX_NEIMB       ------MSNEN----------RTCSFCGKSKSHVKHLIE-----GEN--AFICDECVSNC
CLPX_HAEIN       ------MTDKD---KD-----LHCSFCGKEKGEVDRLIA-----GTD--GYICNECIELC
CLPX_PASMU       -------MEKD---TE-----LHCSFCGKEQKHVSKLIA-----GTS--GYICNECIELC
CLPX_BUCAI       ------MTDKS---KDNSKSLLYCSFCGKNQKEVQKLIA-----GPK--VYICDECIRLC
CLPX_MYXXA       ------MAGKNVEKRD--NQTLCCSFCGKSQKEVKKLIA-----GPT--VYICDECIGLC
CLPX_NOSS1       ------MSKYD-----SH---LKCSFCGKSQEQVRKLIA-----GPG--VYICDECVDLC
CLPX_SYNY3       ------MPKYD-----SH---LKCSFCGKSQEQVRKLIA-----GPG--VYICDECVELC
CLPX_SYNE7       ------MSRYD-----SH---LKCSFCGKSQEQVRKLIA-----GPG--VYICDECVDLC
CLPX_ALKHC       ------MFKFN-----DEKGQLKCSFCGKTQDQVRKLVA-----GPG--VYICDECIELC
CLPX_BACSU       ------MFKFN-----EEKGQLKCSFCGKTQDQVRKLVA-----GPG--VYICDECIELC
CLPX_LISIN       ------MFKFN-----DEKGQLKCSFCGKTQDQVRKLVA-----GPG--VYICDECIELC
CLPX_LISMO       ------MFKFN-----DEKGQLKCSFCGKTQDQVRKLVA-----GPG--VYICDECIELC
CLPX_STAAM       ------MFKFN-----EDEENLKCSFCGKDQDQVKKLVA-----GSG--VYICNECIELC
CLPX_STRPN       ------MSTNR-----KNDMMVYCSFCGKNQEEVQKIIA-----GNN--AFICNECVELA
CLPX_STRP1       ------MAGSR-----TNDIKVYCSFCGKSQDDVKKIIA-----GNN--VFICNECVALS
CLPX_LACLA       ------MSNTQ-----NP--NIHCSFCGKSQDDVKKLIA-----GSD--VYICNECIELS
CLPX_CLOAB       ------MAKYD-----NK-KQLRCSFCGKSQDQVKRLIA-----GPG--VYICDECIELC
CLPX_CLOPE       ------MGKFE-----DK-KQLRCSFCGKNQEQVKRLIA-----GPG--VYICDECIELC
CLPX_MYCLE       ------MARIG-----DSGDLLKCSFCGKSQTQVKKLIA-----GPG--VYICDECIDLC
CLPX_MYCTU       ------MARIG-----DGGDLLKCSFCGKSQKQVKKLIA-----GPG--VYICDECIDLC
CLPX_CHLMU       ------MTKKN---------LAICSFCGRSEKDVEKLIA-----GPS--VYICDYCIKLC
CLPX_CHLTR       ------MTKKN---------LAVCSFCGRSEKDVEKLIA-----GPS--VYICDYCIKLC
CLPX_CHLPN       ------MNKKN---------LTICSFCGRSEKDVEKLIA-----GPS--VYICDYCIKLC
CLPX_AQUAE       -----MAVKVN---------KEFCSFCGKRQDEVLILIA-----GPNN-TYICDECVEKC
CLPX_THEMA       ---------MA---------GKFCSFCGRDIQQVERLIA-----GPNN-VYICNECIDLF
CLPX_BORBU       ------MARVK------GQKVKECSFCGLSVAELGGNVV-----ISNG-VAICPECSKIC
CLPX_TREPA       ------MLRSK------GDLVLGCSFCGKKEDE-RRRIV-----TGHG-VSICNYCVERC
CLPX_HELPY       --------MNE---------TLYCSFCKKPESRDPKKRRIIFASNLNKDVCVCEYCIDVM
CLPX_HELPJ       --------MNE---------TLYCSFCKKPESRDPKKRRIIFASNLNKDVCVCEYCIDVM
CLPX_CAMJE       MEFLSIGVKIM---------PRKCSFCNEVE--NPQRR---ILANENDDAFICEYCVEGA
CLPX_DEIRA       ------MTRAT---------ADRCSFCGRQH---PQIAQ--LIEAPGRAAFICNECAERA
CLPX2_WOLSU      ------MKNLQ------------CSYCGKKEPLVKRIFG-----GSHQ-AFICNECIVEF
CLPX3_METCA      ------MSSDP------PAKTQHCSFCGIEQGRDTPLIA-----GIE--GQICEACVRLA
CLPX_AZOVI       ---------MD------KTDKPCCSFCGAEKSPTVPLIA-----GND--GRICEACVKLA
                                        **:*                        :*  *    

CLPX_RICCN       TDIMKEENKVALKQIT----------------------------SSIPTPQKICGILNDY
CLPX_RICPR       TDIMKEESKVALKQIT----------------------------ASIPTPQKICKILNDY
CLPX_BRUME       MDIIREENKSSMVKSR----------------------------EGVPTPQEIMAVLDDY
CLPX_RHIME       MDIIREENKTSMVKSR----------------------------DGVPTPQEIIKVLDEY
CLPX_RHILO       MDIIREENKTSMVKSR----------------------------EGVPTPQEILKVLDDY
CLPX_CAUVC       MDIIREEHKIAFVKSK----------------------------DGVPTPREICEVLDDY
CLPX_SALTI       NDIIREEIKEVAPHRE---------------------------RSALPTPHEIRTHLDDY
CLPX_SALTY       NDIIREEIKEVAPHRE---------------------------RSALPTPHEIRTHLDDY
CLPX_ECOLI       NDIIREEIKEVAPHRE---------------------------RSALPTPHEIRNHLDDY
CLPX_YEREN       NDIIREEIKEVAPHRE---------------------------RSSLPTPHEIRRHLDDY
CLPX_YERPE       NDIIREEIKEVSPHRD---------------------------RSSLPTPHEIRHHLDDY
CLPX_VIBCH       NDIIREEIKDVLPKKE---------------------------SAALPTPRKIREHLDDY
CLPX_PSEAE       NDIIREEVQEAQAESS---------------------------GHKLPAPKEIRTILDQY
CLPX_XYLFA       NDIIREELEE-KSQSA---------------------------RSSLPKPKEILEVLDQY
CLPX_RALSO       NEIIRDEAAISEKEGGLA------------------------VKSDLPTPHEIRQSLDQY
CLPX_NEIMA       IEILHEDGNDGTPSESAGGEP--------------------EESGKLPTPAEIVANLNDH
CLPX_NEIMB       IEILHEDGNDGTPSESAGGEP--------------------EESGKLPTPAEIVANLNDH
CLPX_HAEIN       HSMLEESHDKNLEESAVEN------------------------EEKLPTPHEIRAHLDDY
CLPX_PASMU       HDMLLSDAVETPEVESTE-------------------------QQKLPTPHEIRAHLDDY
CLPX_BUCAI       NDIITEETIKQNNITDTENK-----------------------INYLPKPHEIKKHLDNY
CLPX_MYXXA       NDIIAEEIDREETKDT---------------------------KLRIPRPSEIKAVLDEY
CLPX_NOSS1       NEILDEELLD------TSGAAAQPAPKSEPPQKRRARSSN-LSLSQIPKPREIKKYLDEH
CLPX_SYNY3       NDILDEELLD------VPPASTGERDGTGQKQKKSGQPRRRLTLEELPKPTAIKQYLDEY
CLPX_SYNE7       NEILDEELFDGNANPAPPPGSPKPATAATTSHQGPRKPKRSLTLSQIPKPHDIKRYLDHH
CLPX_ALKHC       TEIVEEELG----------------------------TEEEVEFQEVPKPHEIREILDDY
CLPX_BACSU       TEIVEEELG----------------------------TEEEVEFKDVPKPQEIREILNEY
CLPX_LISIN       NEIIEEELG----------------------------ISEFVDFGEVPKPQEIRHILSDY
CLPX_LISMO       NEIIEEELG----------------------------ISEFVDFGEVPKPQEIRHILSDY
CLPX_STAAM       SEIVEEELA----------------------------QNTSEAMTELPTPKEIMDHLNEY
CLPX_STRPN       QEIIREELV----------------------------EEVLADLSEVPKPIELLHILNHY
CLPX_STRP1       QEIIKEELA----------------------------EEVLADLTEVPKPKELLDVLNQY
CLPX_LACLA       TRILEEELR----------------------------EEQDSEMLEVKTPKEMFDHLNEY
CLPX_CLOAB       SEIIADEFE----------------------------ETPQINVGSLPKPSEIKDYLDQY
CLPX_CLOPE       SEIIEDEFEG-------------------------NTESSPLEASNLPKPQEIKDYLDQY
CLPX_MYCLE       NEIIEEELA----------------------------DADDVQLDELPKPVEIREFLEGY
CLPX_MYCTU       NEIIEEELA----------------------------DADDVKLDELPKPAEIREFLEGY
CLPX_CHLMU       SGILDKTPTPAAQEVSTSQTA------------------PQTS-LKVLTPKEIKRHIDSY
CLPX_CHLTR       SGILDKTPAPATQEIATSSTS------------------SPTS-LRVLTPKEIKRHIDSY
CLPX_CHLPN       SGILDKKPSSTISSAPVSETP------------------SQPSDLRVLTPKEIKKHIDEY
CLPX_AQUAE       YQIVRENKKTSYNFEL----------------------------KDIPKPEQIKKILDEY
CLPX_THEMA       HDLLRSDRKVRIKNEI----------------------------KEIPTPAEIKAELDKY
CLPX_BORBU       HNLFKEKLCKPLDSK---------------------------SNG-LPTPKQLKDHLDMY
CLPX_TREPA       AEYLRDRKPSALALM---------------------------TKEEIPTPLELKAYLDQY
CLPX_HELPY       HGELHKYD------NSLLALKRDRL-----RRMESSAYEEEFLLSYIPAPKELKAVLDNY
CLPX_HELPJ       HGELHKYDSKYDRMDSLLALKRDRL-----RRMESSAYEEEFLLSRIPAPKELKAVLDNY
CLPX_CAMJE       YSIIYGEE---------KEFKEP-------KQSHNTEFKDI-------TPKELKAYLDRY
CLPX_DEIRA       FDLVKQQR----------------------KEAGSEFSLDE-----LPSAKEIKAYLDEF
CLPX2_WOLSU      FNLLEREEENRKQKD---------------------------VRSHLPKPQEIAQFLDQY
CLPX3_METCA      EQVVANWGRKRSMAE---------------------------LHGNVPKPEDIKRHLDQY
CLPX_AZOVI       HQVVSSWGQRRKNQQ---------------------------LAPQLRTPVEYKKHLDES
                    .                                             .      :.  

CLPX_RICCN       VVGQDQAKKILAVAVYNHYKRLEYVQSGNN--------------DVELNKSNILLIGPTG
CLPX_RICPR       VVGQDQAKKILAVAVYNHYKRLEYVQSGNN--------------DVELNKSNILLIGPTG
CLPX_BRUME       VIGQKDAKRVLSVAVHNHYKRLAHQS-KNS--------------DIELAKSNILLVGPTG
CLPX_RHIME       VIGQQQAKRILSVAVHNHYKRLAHAA-KSS--------------DVELAKSNIMLVGPTG
CLPX_RHILO       VIGQPYAKRVLSVAVHNHYKRLAHAG-KNN--------------DVELAKSNILLIGPTG
CLPX_CAUVC       VIGQGHAKKVLAVAVHNHYKRLNHAS-KNN--------------DVELAKSNILLVGPTG
CLPX_SALTI       VIGQEQAKKVLAVAVYNHYKRLRNGD-TSN--------------GVELGKSNILLTGPTG
CLPX_SALTY       VIGQEQAKKVLAVAVYNHYKRLRNGD-TSN--------------GVELGKSNILLIGPTG
CLPX_ECOLI       VIGQEQAKKVLAVAVYNHYKRLRNGD-TSN--------------GVELGKSNILLIGPTG
CLPX_YEREN       VIGQEPAKKVLAVAVYNHYKRLRNGD-TSN--------------GIELGKSNILLIGPTG
CLPX_YERPE       VIGQEPAKKVLAVAVYNHYKRLRNGD-TSN--------------GIELGKSNILLIGPTG
CLPX_VIBCH       VIGQEHAKKVLAVAVYNHYKRLRNGDTTSE--------------GVELGKSNILLIGPTG
CLPX_PSEAE       VIGQERAKKVLAVAVYNHYKRLNQRD-KKD--------------DIELGKSNILMIGPTG
CLPX_XYLFA       VIGQQRAKRTLAVAVYNHYKRIESRH-KND--------------DIELAKSNILLVGPTG
CLPX_RALSO       VIGQEQAKKILAVAVYNHYKRLKHLG-KKD--------------DVELSKSNILLIGPTG
CLPX_NEIMA       VIGQEQAKKALAVSVYNHYKRLRHPK-ARA--------------NVELSKSNILLIGPTG
CLPX_NEIMB       VIGQEQAKKALAVSVYNHYKRLRHPK-AGA--------------NVELSKSNILLIGPTG
CLPX_HAEIN       VIGQDYAKKVLSVAVYNHYKRLRT-NYESN--------------DVELGKSNILLIGPTG
CLPX_PASMU       VIGQDYAKKVLSVAVYNHYKRLRS-DKQIT--------------DVELGKSNILLIGPTG
CLPX_BUCAI       VIGQNYTKKVLSVAVYNHYKRLYNFNKKTD--------------SVELGKSNILLIGPTG
CLPX_MYXXA       VIGQERAKKTLSVAVHNHYKRIESKV-AME--------------DVELQKSNILLLGPTG
CLPX_NOSS1       VIGQDEAKKVLSVAVYNHYKRLAILQSKGSGKNGD--------DAVELQKSNILLIGPTG
CLPX_SYNY3       VIGQDEAKKVLSVAVYNHYKRLNLLE-RNQEIDPG--------DAVELQKSNILLVGPTG
CLPX_SYNE7       VIGQNEAKKMLSVAVYNHYKRLAYQQ---SAEEAG--------ETIEIQKSNILLIGPTG
CLPX_ALKHC       VIGQDLAKKSLSVAVYNHYKRINSM-SKSE--------------EVELSKSNICMIGPTG
CLPX_BACSU       VIGQDQAKKSLAVAVYNHYKRINSN-SKVD--------------DVELSKSNISLIGPTG
CLPX_LISIN       VIGQERAKKALAVAVYNHYKRINSNETKED--------------EVELSKSNICLIGPTG
CLPX_LISMO       VIGQERAKKALAVAVYNHYKRINSNETKED--------------EVELSKSNICLIGPTG
CLPX_STAAM       VIGQEKAKKSLAVAVYNHYKRIQQLGPKED--------------DVELQKSNIALIGPTG
CLPX_STRPN       VIGQDRAKRALAVAVYNHYKRINFHDTREES------------EDVDLQKSNILMIGPTG
CLPX_STRP1       VVGQDRAKRALSVAVYNHYKRVSFTESRDD-------------DDVDLQKSNILMIGPTG
CLPX_LACLA       VIGQEKAKRALAVAVYNHYKRINFAASKIA-------------EDIELQKSNILLIGPTG
CLPX_CLOAB       VVGQEDAKKSLSVAVYNHYKRINSNLSNN--------------DDIELQKSNILLLGPTG
CLPX_CLOPE       VVGQDRAKKSLAVAVYNHYKRINANKAE---------------DDVELQKSNILLLGPTG
CLPX_MYCLE       VIGQDTAKRTLAVAVYNHYKRIQAGEKGRDSKR----------EPVELAKSNILMLGPTG
CLPX_MYCTU       VIGQDTAKRTLAVAVYNHYKRIQAGEKGRDSRC----------EPVELTKSNILMLGPTG
CLPX_CHLMU       VVGQERAKKTISVAVYNHYKRIRALMQDKQ---------------VSYGKSNVLLLGPTG
CLPX_CHLTR       VIGQERAKKTISVAVYNHYKRIRALMQDKQ---------------VSYGKSNVLLLGPTG
CLPX_CHLPN       VIGQERAKKTIAVAVYNHYKRIRALLHNKQ---------------VSYGKSNVLLLGPTG
CLPX_AQUAE       VIGQERAKKILSVAVYNHYKRIKAKEAGLSLD------------DVELEKSNILLIGPTG
CLPX_THEMA       IIGQERAKKVLSVAVYNHYKRVFSN---LDSN------------DVEIEKSNVLLIGPTG
CLPX_BORBU       VVGQEDAKKVLSVAVYNHYKRILKNNKYDN--------------GIEIEKSNILLVGPTG
CLPX_TREPA       VIGQDLAKRVLSVAVYNHYKRVAGRSLDID--------------SVLIEKSNVLLIGPTG
CLPX_HELPY       VIGQEQAKKVFSVAVYNHYKRLSFKEKLKKQDNQDSNVELEHLEEVELSKSNILLIGPTG
CLPX_HELPJ       VIGQEQAKKVFSVAVYNHYKRLSFKEKLKKQDNQDSDLELEHLEEVELSKSNILLIGPTG
CLPX_CAMJE       VIGQDRAKKVFSVGVYNHYKRL-FKAELQDDD-------------TELFKSNILLVGPTG
CLPX_DEIRA       VIGQDEAKKALAVAVVSHYHRL------SNPD-------------AGLQKSNILLIGPTG
CLPX2_WOLSU      VISQEKAKMALSVALYNHYKRISYPKHHH----------------IELEKSNILLLGPSG
CLPX3_METCA      VIGQELAKEILSVAVYNHYKRLRHESREILGLAGSD-------TEVQVGKSNILMIGPTG
CLPX_AZOVI       VIGQEAAKETLSVAVYNHYLRLLNCDREPVCQLGEQ-------VELE--KSNILMAGPSG
                 ::.*  :*  ::*.: .** *:                           :**: : **:*

CLPX_RICCN       SGKTLLAQTLAKILDVPFTMADATSLTEAGYVGEDVENILLRLLIASEFNIAKAQKGIIY
CLPX_RICPR       SGKTLLAQTLAKILDVPFTMADATSLTEAGYVGEDVENILLRLLISAEFNIAKAQKGIIY
CLPX_BRUME       CGKTYLAQTLARIIDVPFIMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVY
CLPX_RHIME       CGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVY
CLPX_RHILO       CGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQSADYNVERAQRGIVY
CLPX_CAUVC       TGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIVLKLLQAADYNVERAQRGIVY
CLPX_SALTI       SGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVY
CLPX_SALTY       SGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVY
CLPX_ECOLI       SGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVY
CLPX_YEREN       SGKTLLAETLARFLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVY
CLPX_YERPE       SGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVY
CLPX_VIBCH       SGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVAKAERGIVY
CLPX_PSEAE       SGKTLLAETLARLLNVPFTIADATTLTEAGYVGEDVENIIQKLLQKCDYDVEKAQMGIVY
CLPX_XYLFA       SGKTLLAETLARLLNVPFTIADATTLTEAGYVGEDVENIIQKLLQKCDYDVERAQHGIVY
CLPX_RALSO       SGKTLLAQTLARLLNVPFVIADATTLTEAGYVGEDVENIIQKLLQNCNYEVDKAQRGIVY
CLPX_NEIMA       SGKTLLAQSLARKLDVPFVMADATTLTEAGYVGEDVEQIITKLLGKCDFDVEKAQRGIVY
CLPX_NEIMB       SGKTLLAQSLARKLDVPFVMADATTLTEAGYVGEDVEQIITKLLGKCDFDVEKAQRGIVY
CLPX_HAEIN       SGKTLLAQTLARRLNVPFAMADATTLTEAGYVGEDVENVLQKLLQNCEYDTEKAEKGIIY
CLPX_PASMU       SGKTLLAETMARMLNVPFAMADATTLTEAGYVGEDVENVLQKLVQSCDYDVERAEQGIIY
CLPX_BUCAI       SGKTLLAQTLAKLLDVPFTITDATTLTEAGYVGEDVENVIQKLLQKCKYNVKKAELGIVY
CLPX_MYXXA       SGKTLLAQTLARILNVPFTIADATCLTEAGYVGEDVENIIVNLLQAADHDIERAQRGIVY
CLPX_NOSS1       CGKTLLAQTLAKILDVPFAVADATTLTEAGYVGEDVENILLRLLQVADLDVEEAQRGIIY
CLPX_SYNY3       SGKTLLAQTLAKILEVPFAVADATTLTEAGYVGEDVENILLRLLQVADLDVEEAQRGIIY
CLPX_SYNE7       CGKTLLAQTLAKLLDVPFAVADATTLTEAGYVGEDVENILLRLLQVADLDIEEAQRGIIY
CLPX_ALKHC       SGKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKLIQAADYDVEKAEKGIIY
CLPX_BACSU       SGKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKLIQAADYDVEKAEKGIIY
CLPX_LISIN       SGKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKLIQSADYDVEKAEKGIIY
CLPX_LISMO       SGKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKLIQSADYDVEKAEKGIIY
CLPX_STAAM       SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
CLPX_STRPN       SGKTFLAQTLAKSLNVPFAIADATALTEAGYVGEDVENILLKLLQVADFNIERAERGIIY
CLPX_STRP1       SGKTFLAQTLAKSLNVPFAIADATSLTEAGYVGEDVENILLKLIQAADYNVERAERGIIY
CLPX_LACLA       SGKTFLAQTLAKSLNVPFAIADATSLTEAGYVGEDVENILLKLLQASDFNIERAERGIIY
CLPX_CLOAB       CGKTFLAQTLAKFLNVPFAIADATTLTEAGYVGEDVENILLKLIQNADYDVERAEKGIIY
CLPX_CLOPE       SGKTLLAQTLAKMLNVPFAIADATTLTEAGYVGEDVENILLKLIQNADYDVERAEKGIIY
CLPX_MYCLE       CGKTYLAQTLAKMLNVPFAIADATALTEAGYVGEDVENILLKLIQAADYDVKRAETGIIY
CLPX_MYCTU       CGKTYLAQTLAKMLNVPFAIADATALTEAGYVGEDVENILLKLIQAADYDVKRAETGIIY
CLPX_CHLMU       SGKTLIAKTLAKILDVPFTIADATTLTEAGYVGEDVENIVLRLLQAADYDVARAERGIIY
CLPX_CHLTR       SGKTLIAKTLAKILDVPFTIADATTLTEAGYVGEDVENIVLRLLQAADYDVARAERGIIY
CLPX_CHLPN       SGKTLIAKTLAKILDVPFTIADATTLTEAGYVGEDVENIVLRLLQAADYDVARAERGIIY
CLPX_AQUAE       SGKTLLARTLAKILNVPFAIADATSLTEAGYVGEDVENVLVRLLQACDYDVKAAQKGIVY
CLPX_THEMA       TGKTYLARILAKILNVPFAIADATPLTEAGYVGEDVENVVLRLLEAANFDVERAQYGIIY
CLPX_BORBU       SGKTLLAKTLAAEMNVPFAIADATTLTEAGYVGEDVENILLKLIHAAHGDVSLAEKGIIY
CLPX_TREPA       SGKTLLAKTLSQKMKVPFAIADATTLTEAGYVGEDVENILLKLVQNANGDVALAERGIIF
CLPX_HELPY       SGKTLMAQTLAKHLDIPIAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQKGIVF
CLPX_HELPJ       SGKTLMAQTLAKHLDIPIAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQKGIVF
CLPX_CAMJE       SGKTLLAQTLAKFLDVPIAICDATSLTEAGYVGEDVENILTRLLQAADGDVQRAQKGIVF
CLPX_DEIRA       TGKTLLAQSLAEMLEVPFAIADATTLTEAGYVGDDVENVIVRLLQAAEYDVAAAERGIIY
CLPX2_WOLSU      SGKTLLAKTLARVLNIPFAMSDATALTEAGYVGEDVESILSRLLHAASFDIEKAQKGIVY
CLPX3_METCA      TGKTLLASTLARIVGVPFVVADATTLTQAGYVGDDVENILVRLLEAADGSVERAEWGIVY
CLPX_AZOVI       TGKTLLVRTLARILGVPFAMADATTLTQAGYVGDDVDSIITRLLDAAGGDVQQAQWGIVY
                  *** :.  ::  : :*: : *** **:*****:**:.:: .*:  .  .   :  **::

CLPX_RICCN       IDEVDKIARKS-ENPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQ--DFVQLD
CLPX_RICPR       IDEVDKIARKS-DNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQ--DFVQLD
CLPX_BRUME       IDEVDKISRKS-DNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQ--EFLQVD
CLPX_RHIME       IDEVDKISRKS-DNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQ--EFLQVD
CLPX_RHILO       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQ--EFLQVD
CLPX_CAUVC       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQ--EFLQVD
CLPX_SALTI       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQ--EFLQVD
CLPX_SALTY       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQ--EFLQVD
CLPX_ECOLI       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQ--EFLQVD
CLPX_YEREN       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTIAAVPPQGGRKHPQQ--EFLQVD
CLPX_YERPE       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTIAAVPPQGGRKHPQQ--EFLQVD
CLPX_VIBCH       IDEIDKISRKS-ENPSITRDVSGEGVQQALLKLIEGTVASVPPQGGRKHPQQ--EFLQVD
CLPX_PSEAE       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTVASVPPQGGRKHPQQ--EFLQVD
CLPX_XYLFA       IDEIDKISRKS-ENPSITRDVSGEGVQQALLKLIEGTVASVPPQGGRKHPQQ--EFLQVD
CLPX_RALSO       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTMASVPPQGGRKHPNQ--DFLQVD
CLPX_NEIMA       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTVASVPPQGGRKHPNQ--EFINVD
CLPX_NEIMB       IDEIDKISRKS-DNPSITRDVSGEGVQQALLKLIEGTVASVPPQGGRKHPNQ--EFINVD
CLPX_HAEIN       IDEIDKISRKS-EGASITRDVSGEGVQQALLKLIEGTIASIPPQGGRKHPQQ--EMVKLD
CLPX_PASMU       IDEIDKITRKS-ENPSITRDVSGEGVQQALLKLIEGTVASIPPQGGRKHPQQ--EMLRVD
CLPX_BUCAI       IDEIDKIARKS-DNPSITRDVSGEGVQQALLKLIEGTLASIPPQGGRKHPQQ--EFLQVN
CLPX_MYXXA       IDEIDKIARKS-ENPSITRDVSGEGVQQALLKLIEGTVANVPPKGGRKHPQQ--EFLQVD
CLPX_NOSS1       IDEIDKIARKS-ENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQ--DCIQID
CLPX_SYNY3       IDEIDKIARKS-ENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQ--DCIQID
CLPX_SYNE7       IDEIDKIARKS-ENPSITRDVSGEGVQQALLKMLEGTIANVPPQGGRKHPYQ--DCIQID
CLPX_ALKHC       IDEIDKVARKS-ENPSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPHQ--EFIQID
CLPX_BACSU       IDEIDKVARKS-ENPSITRDVSGEGVQQALLKILEGTVASVPPQGGRKHPHQ--EFIQID
CLPX_LISIN       IDEIDKVARKS-ENPSITRDVSGEGVQQALLKILEGTVASVPPQGGRKHPHQ--ELIQID
CLPX_LISMO       IDEIDKVARKS-ENPSITRDVSGEGVQQALLKILEGTVASVPPQGGRKHPHQ--ELIQID
CLPX_STAAM       VDEIDKIARKS-ENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQ--EMIQID
CLPX_STRPN       VDEIDKIAKKS-ENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQ--EMIQVD
CLPX_STRP1       VDEIDKIAKKG-ENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPNQ--EMIQID
CLPX_LACLA       IDEIDKIAKKS-ENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPNQ--EMIQID
CLPX_CLOAB       IDEIDKIARKS-ENPSITRDVSGEGVQQALLKILEGTVASVPPQGGRKHPHQ--EFIQIN
CLPX_CLOPE       IDEIDKIARKS-ENPSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPHQ--EFIQIN
CLPX_MYCLE       IDEVDKIARKS-ENPSITRDVSGEGVQQALLKILEGTQASVPPQGGRKHPHQ--EFIQID
CLPX_MYCTU       IDEVDKIARKS-ENPSITRDVSGEGVQQALLKILEGTQASVPPQGGRKHPHQ--EFIQID
CLPX_CHLMU       IDEIDKIGRTT-ANVSITRDVSGEGVQQALLKIIEGTVANIPPKGGRKHPNQ--EYIRVN
CLPX_CHLTR       IDEIDKIGRTT-ANVSITRDVSGEGVQQALLKIIEGTVANIPPKGGRKHPNQ--EYIRVN
CLPX_CHLPN       IDEIDKIGRTT-ANVSITRDVSGEGVQQALLKIVEGTTANVPPKGGRKHPNQ--EYIRVN
CLPX_AQUAE       IDEIDKIAKKSGINPSITRDVSGEGVQQALLKIVEGSVVNVPPQGGRKHPHQ--EFIQVD
CLPX_THEMA       IDEIDKIAKKS-PNPSITRDVSGEGVQQALLKILEGTIANVPPQGGRKHPYQ--EFIKVD
CLPX_BORBU       IDEIDKIAKKN-ENVSITRDVSGEGVQQALLKIIEGTVANVPPRGGRKHPYE--DTIEIN
CLPX_TREPA       IDEIDKISRKS-ENVSITRDVSGEGVQQALLKIIEGTIASVPPQGGRKHPNQ--DMLRVD
CLPX_HELPY       IDEIDKISRLS-ENRSITRDVSGEGVQQALLKIVEGSLVNIPPKGGRKHPEG--NFIQID
CLPX_HELPJ       IDEIDKISRLS-EHRSITRDVSGEGVQQALLKIVEGSLVNIPPKGGRKHPEG--NFIQID
CLPX_CAMJE       IDEIDKIARMS-ENRSITRDVSGEGVQQALLKIIEGSLVNIPPRGGRKHPNQ--EFIQID
CLPX_DEIRA       VDEIDKIARKS-EGTSITRDVSGEGVQQALLKIIEGTVAQVPPQGGRKHPQQ--ELVQVD
CLPX2_WOLSU      IDEIDKIAKKG-ESVQSGRDIGGEGVQQGLLKILEGASVYVPLKGARKNSNT--ETVLFD
CLPX3_METCA      IDEVDKLAKSP-EMAINTRDISGEGVQQALLRFVEGSQVKVAARGRRREGSGGGEEVTID
CLPX_AZOVI       IDEVDKLAKRS-GGGTAVRDISGEGVQQALLKMVEGTEVRISKSGRRNEHS---EEQVVD
                 :**:**: :         **:.******.**:::**: . :.  * *..     :   .:

CLPX_RICCN       TSNILFICGGAFMGIDSIITSR--TNHSSIGFAANVNIDKE-KNNSEILKSLEIEDLTKF
CLPX_RICPR       TSNILFICGGAFMGIDRIIRSR--TNHSSIGFAANINIDKE-KSNNEILKSLEIEDLTKF
CLPX_BRUME       TTNILFICGGAFAGLDRIISAR--GEKTSIGFGATVKSVDE-RRIGEVFKELEPEDLLKF
CLPX_RHIME       TTNILFICGGAFAGLDKIISAR--GEKTSIGFGATVRAPED-RRVGEVLRELEPEDLVKF
CLPX_RHILO       TANILFICGGAFAGLDKIISDR--GRKTSIGFGATVASPED-RRTGDIFRQVEPEDLLKF
CLPX_CAUVC       TTNILFICGGAFAGLEKIISAR--GAAKSIGFGAKVTDPEE-RRTGEILRNVEPDDLQRF
CLPX_SALTI       TSKILFICGGAFAGLDKVIANRV-ETGSGIGFGATVKAKSDKASEGELLSQVEPEDLIKF
CLPX_SALTY       TSKILFICGGAFAGLDKVIANRV-ETGSGIGFGATVKAKSDKASEGELLSQVEPEDLIKF
CLPX_ECOLI       TSKILFICGGAFAGLDKVISHRV-ETGSGIGFGATVKAKSDKASEGELLAQVEPEDLIKF
CLPX_YEREN       TSKILFICGGAFAGLDKVIGQRI-NTGSGIGFGATVKGKSEKATEGELLRQAEPEDLIKF
CLPX_YERPE       TSKILFICGGAFAGLDKVIGQRI-NTGSGIGFGAVVKGQSEKATEGELLSQVEPEDLIKF
CLPX_VIBCH       TSKILFICGGAFAGLDKVIEQRV-ATGTGIGFGADVRSKDNSKTLSELFTQVEPEDLVKY
CLPX_PSEAE       TRNILFICGGAFAGLERVIQNR--SARGGIGFNAEVRSQEMGKKVGEAFKEVEPEDLVKF
CLPX_XYLFA       TKNILFICGGAFAGLDKVIQQRC-TEAGGIGFGVKVKSSESKRDVGKVLAGVEPEDLIKF
CLPX_RALSO       TTNILFICGGAFDGLEKIITQR--SDKSGIGFGAEVKSKEE-RDVNEVLPQVEPEDLIKF
CLPX_NEIMA       TTNILFICGGAFAGLEKVIRQR--TEKGGIGFGASVHSKDENADITKLFGIVEPEDLIKF
CLPX_NEIMB       TTNILFICGGAFAGLEKVIRQR--TEKGGIGFGASVHSKDENADITKLFGIVEPEDLIKF
CLPX_HAEIN       TSKILFICGGAFAGLDKIIDKRT-QTSTSIGFNAKVEKDEKQQSLSELFRQVEPDDLMKF
CLPX_PASMU       TSKILFICGGAFAGLDKVIEKRV-HVGSGIGFSAEVKSKQDKATLSQLFEQVEPDDLMKF
CLPX_BUCAI       TSNILFICAGAFSELSKIVSKRL-DAGTEIGFKANIKEKKQKKSEDFLLKQVEPEDLIKF
CLPX_MYXXA       TTNILFICGGAFGGLDQVIERRM-GGRS-LGFGADVQSKKQ-RSLTELLKHVEPEDLLKF
CLPX_NOSS1       TSNILFICGGAFVGLEKVVDQR--GGKKSIGFVQPGEGQSKEKRAADVLRHLEPDDLVKF
CLPX_SYNY3       TSNILFICGGAFVGLEKVIEQR--FGKKSMGFVRPGEGPSKEKRTADVLRQAEPDDLVKF
CLPX_SYNE7       TRNILFICGGAFVGLEKLVDRR--LGKKSIGFVHPEESKTKEQRAAAILRHMEPEDLVQF
CLPX_ALKHC       TTNILFICGGAFDGIEQIIKRR--LGKKVIGFGSEVK--QDELKPGEYLSKVLPEDLLRF
CLPX_BACSU       TTNILFICGGAFDGIEQIIKRR--LGQKVIGFGADNK--AADLEKEDLLSKVLPEDLLRF
CLPX_LISIN       TGNILFIVGGAFDGIEQIVKNR--MGEKVIGFGTDNA--KLKED-ETYLSRVVPEDLLKF
CLPX_LISMO       TGNILFIVGGAFDGIEQIVKNR--MGEKVIGFGTDNA--KLKDD-ETYLSRVVPEDLLKF
CLPX_STAAM       TTNILFILGGAFDGIEEVIKRR--LGEKVIGFSSNE---ADKYDEQALLAQIRPEDLQAY
CLPX_STRPN       TKNILFIVGGAFDGIEEIVKQR--LGEKVIGFGQNNK--AIDEN-SSYMQEIIAEDIQKF
CLPX_STRP1       TKNILFIVGGAFDGIEEIVKQR--LGEKVIGFGQNSR--KIDDN-ASYMQEIISEDIQKF
CLPX_LACLA       TKNILFIVGGAFDGIEEIVKQR--LGEKIIGFGANNK--KLNDD-DSYMQEIIAEDIQKF
CLPX_CLOAB       TTNILFICGGAFDGVDKIIENR--TRVSTIGFGASIQS-KQQKDIGAILKKIMPGDLLKF
CLPX_CLOPE       TSNILFICGGAFDGIDKIIEKR--GTKSSIGFGAEVKG-KSEKNVGELLKDIMPGDLLKF
CLPX_MYCLE       TTNVLFIVAGAFAGLDKIIYER--IGKRGLGFGAEVRS-KAEIDTTDHFADVMPEDLIKF
CLPX_MYCTU       TTNVLFIVAGAFAGLEKIIYER--VGKRGLGFGAEVRS-KAEIDTTDHFADVMPEDLIKF
CLPX_CHLMU       TENILFIVGGAFVNLDKIIAKR--LGRTTIGFSEE-TDLAVTDR-DRLLAKVETEDLIAF
CLPX_CHLTR       TENILFIVGGAFVNLDKIIAKR--LGRTTIGFSEE-TDLAVTNR-DHLLAKVETEDLIAF
CLPX_CHLPN       TENILFIVGGAFVNLDKIIAKR--LGKTTIGFSDDQADLSQKTR-DHLLAKVETEDLIAF
CLPX_AQUAE       TTDILFICGGAFVGLEDIIKQR--LGKSRVGFEAEIKKVD---KEQDLLELVEPDDLIRF
CLPX_THEMA       TRNILFIAGGAFDGLEEIIKRR--IQSTTMGFGAEIKSKKE-MRLGEILKHVTPDDLVQY
CLPX_BORBU       TQNILFICGGAFVGLENIVKNR--INKSSIGFSAIEKK-NIREDTSLKYLEM--EDLIKF
CLPX_TREPA       TSNILFICGGAFVGLDGIVGTR--VCKNPVGFGADVKT-VKERGLQLMHEDVIPDDLVKF
CLPX_HELPY       TSDILFICAGAFDGLAEIIKKR--TTQNVLGFTQEKMS---KKEQEAILHLVQTHDLVTY
CLPX_HELPJ       TSDILFICAGAFDGLAEIIKKR--TTQNVLGFTQEKMS---KKEQEAILHLVQTHDLVTY
CLPX_CAMJE       TSNILFVCGGAFDGLETILKRK--LGDKVVGFFDDAK-----EENKALLEKIEPDDLVHF
CLPX_DEIRA       TRNILFIVGGAFESMSEIARAR--TNVRAVGFGAEHKG---EEKEE---VRFLPEDLVKF
CLPX2_WOLSU      TKDVLFICGGAFVGIKE---ER---GEKRSGFLAS--------NPSSPTQRTLRKQLLSY
CLPX3_METCA      TRNILFIAGGAFPGLERHVEKRIGPPRGEIGFHAPVQD-AKRPLLEELLAEIQPEDLRRF
CLPX_AZOVI       TRNILFIAGGAFPGLEALVSSRIQPKNTGIGFHAQPR--REAPSINELMASLLPDDLHEF
                 * .:**: .* *  :      :        **                       ::  :

CLPX_RICCN       GLIPEFIGRLPIVTTLDELDKEALITILTKPKNAIVKQYQKQFELDDAELVIDYSALETI
CLPX_RICPR       GLIPEFIGRLPIITTLDELDKEALITILTKPKNAIVKQYQKQFELDDADLVIDYSALEAI
CLPX_BRUME       GLIPEFVGRLPVIATLEDLDVDALVQILTEPKNALVKQYQRLFDMENVELVFHDDALRAI
CLPX_RHIME       GLIPEFIGRLPVLATLEDLDEDALIQILSEPKNALVKQYQRLFEMEDVELNFHEDALREI
CLPX_RHILO       GLIPEFVGRLPVLATLEDLDEPALIQILTEPKNALVKQYQRLFEMENVDLTFHENALSAI
CLPX_CAUVC       GLIPEFIGRLPVVATLEDLDEAALVKILTEPKNAFVKQYQRLFEMENIGLTFTEDALHQV
CLPX_SALTI       GLIPEFIGRLPVVATLNELSEEALVQILKEPKNALTKQYQALFNLEGVDLEFRDEALNAI
CLPX_SALTY       GLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAI
CLPX_ECOLI       GLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAI
CLPX_YEREN       GLIPEFIGRLPVVATLSELSEDALIQILKEPKNALTKQYQALFNLEGVELEFRDEALTAI
CLPX_YERPE       GLIPEFIGRLPVVATLSELSEDALIQILKEPKNALTKQYQALFSLEGVELEFRDEALTAI
CLPX_VIBCH       GLIPEFIGRLPVTATLTELDEAALIQILCEPKNALTKQYAALFELENVDLEFREDALKAI
CLPX_PSEAE       GLIPEFVGRLPVIATLDELDEAALMQILTEPKNALTKQYAKLFEMEGVDLEFRPDALKAV
CLPX_XYLFA       GLIPEFVGRLPVVATLDELDESALVKILTEPKNAITKQFKKLFEMENVELEFRQDALSAV
CLPX_RALSO       GLIPELIGRLPVVATLAKLDEAALMEILVEPKNAIVKQYQKLLAMEGVELEIRPSALTAI
CLPX_NEIMA       GLIPELIGRLPVIATLEELDEDALINILTEPKNALVKQYQALFGMENVELEFEEGALRSI
CLPX_NEIMB       GLIPELIGRLPVIATLEELDEDALINILTEPKNALVKQYQALFGMENVELEFEEGALRSI
CLPX_HAEIN       GLIPEFIGRLPMIAPLSELDEDALIQILTKPKNALIKQYQALFGLEKVELDFTPEALKAM
CLPX_PASMU       GLIPEFIGRLPVVAPLAELDEEALVKILTEPKNALIKQYQALFSLEDVALEFSPEALTAM
CLPX_BUCAI       GLIPEFIGRLPIITILNKLTEDALVNILCKPKNALIKQYQTLFELENVKLEFNAESIQLI
CLPX_MYXXA       GMIPEFIGRLPIITALEELDEAALINILNQPKNALTKQYRKLFELDGVTLKFTDGALKAI
CLPX_NOSS1       GMIPEFIGRVPMVAVVDPLDEEALMAILTQPRSALVKQYQKLLKMDNVQLDFKPDALKAI
CLPX_SYNY3       GLIPEFIGRIPVMACLNPLDEDALIAILTQPRNAIVKQYQTLLGMDHVELDFQPDAVRAI
CLPX_SYNE7       GLIPEFIGRMPVTAVLDPLDETALTEILTEPRDALVKQYQKLMHMDSVELEFRQDAIEAI
CLPX_ALKHC       GLIPEFIGRLPVISSLQPLDEEALIEILTKPKNALVKQYKKLLELDDVNLEFTDEALREI
CLPX_BACSU       GLIPEFIGRLPVIASLEKLDEEALVAILTKPKNALVKQFKKMLELDNVELEFEEEALSEI
CLPX_LISIN       GLIPEFIGRLPVIATLEQLDEAALVSILTEPKNALVKQYKRMLELDDVELEFEPTALIEI
CLPX_LISMO       GLIPEFIGRLPVIATLEQLDEAALVSILTEPKNALVKQYKRMLELDDVELEFEPTALIEI
CLPX_STAAM       GLIPEFIGRVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAI
CLPX_STRPN       GIIPELIGRLPVFAALEQLTVDDLVRILKEPRNALVKQYQTLLSYDDVELEFDDEALQEI
CLPX_STRP1       GLIPEFIGRLPVVAALEQLNTSDLIQILTEPRNALVKQYQALLSYDGVELAFDKEALEAI
CLPX_LACLA       GLIPEFIGRLPIVAALERLTEEDLIQILTEPKNALIKQYKQLLLFDNVELEFEDEALMAI
CLPX_CLOAB       GLIPEFIGRLPIIVTLNSLDQGALVKVLSEPKNALVKQYEKLLQMDNVELEFKDGALKAI
CLPX_CLOPE       GLIPEFVGRLPVLVTLEALDNEALVSILTKPKNALVKQYKKLFELDNVKLDFTEEALKAI
CLPX_MYCLE       GLIPEFIGRLPVIASVINLDMESLVKILSEPKNALVKQYTWLFEMDGVELEFTNDALEAV
CLPX_MYCTU       GLIPEFIGRLPVVASVTNLDKESLVKILSEPKNALVKQYIRLFEMDGVELEFTDDALEAI
CLPX_CHLMU       GMIPEFIGRFNCIVNCEELTLDELVEILTEPANAIVKQYTELFAEENVKLIFEKEALYAI
CLPX_CHLTR       GMIPEFIGRFNCVVNCEELTLDELVEILTEPANAIVKQYTELFEEENVKLIFEKEALYAI
CLPX_CHLPN       GMIPEFVGRFNCIVNCEELSLDELVAILTEPTNAIVKQYMELFAEENVKLVFKKEALYAI
CLPX_AQUAE       GMIPEFIGRFPVIATLRELTEDELVRILVEPKNALVKQYQKLFELEGVKLTFTEKALREI
CLPX_THEMA       GLIPEFVGRFPVIATLDDLSEDDLVRILKEPKNAVVRQYQKLFEIDGVKLEVTDEALRII
CLPX_BORBU       GLIPEFVGRLPVHSYLEKLNKEDLLRILVDPQNSIVKQYYHMFKMDNVELVFEKDALESI
CLPX_TREPA       GLIPEIIGRLPVTVALDALSKEDLRNILVRPRNAIVRQFEALFALDDVRLVFDEDALDAI
CLPX_HELPY       GLIPELIGRLPVLSTLDSISLEAMVDILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEI
CLPX_HELPJ       GLIPELIGRLPVLSTLDSISLEAMVDILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEI
CLPX_CAMJE       GLIPELIGRLHVIASLNELNEEDMVRILTEPKNAIIKQYQKLFAIDGVNLKFEEDALRAI
CLPX_DEIRA       GLIPEFVGRLPLVVQLQDLDEDALIRILTEPQGAIIKQYQALFGFQGVDLTFSEEALQEV
CLPX2_WOLSU      GMIPEFIGRIPLILELEPLNLESLVKILKEPKDSIIAQYQYLFSLDGVKLEFTDEALLAI
CLPX3_METCA      GLIPEFIGRFPVIAPLEPLDEAAFVRILTEPRDALVRQYQKLFAYEGVELVFTEPAIRRI
CLPX_AZOVI       GLIPEFIGRFPIITFLQELDHATLLRILTEPRNALVKQYKQLFAYQGVELVITDAALNYI
                 *:***::**.        :    :  :*  * .:.  *:   :  :   * .   ::  :

CLPX_RICCN       AEKALAKKTGARGLRSILEHLLLDSMYKVAELK-KQRVTITKEVVNGLVEPIMTSLISTK
CLPX_RICPR       AEKALVKKTGARGLRSILEHLLLDSMYKVAELK-KQRVTITKEVVDGLIEPCMTSIISTK
CLPX_BRUME       ANKAVERKTGARGLRSIMEKILLDTMFELPTLEGVREVVISGDVVDGSARPLYIYAERQD
CLPX_RHIME       ARRAIVRKTGARGLRSIMEKILLDTMFELPTLEGVREVVISDEVVKGTARPLYIYSERSE
CLPX_RHILO       AKRAIERKTGARGLRSIMEAILLDTMFELPALEGVREVVISEEVVTGSARPLYIYSEQKE
CLPX_CAUVC       AKKAIARKTGARGLRSIMEGILLETMFELPTYEGVEEVVVNAEVVEGRAQPLLIYAEKKG
CLPX_SALTI       ARKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVIDESVIAGQSKPLLIYGK--P
CLPX_SALTY       ARKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVIDESVIAGQSKPLLIYGK--P
CLPX_ECOLI       AKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVIDESVIDGQSKPLLIYGK--P
CLPX_YEREN       AKKAMARKTGARGLRSIVEGALLDTMYDLPSMESVEKVVVDESVIAGQSAPMLIYGQ--P
CLPX_YERPE       AKKAMARKTGARGLRSIVEGALLDTMYDLPSMDSVEKVVVDESVIAGQSAPMLIYGQ--P
CLPX_VIBCH       AAKAMKRKTGARGLRSILEAVLLETMYELPSMEEVSKVVIDESVINGESAPLLIYSA--N
CLPX_PSEAE       ARKALERKTGARGLRSILEGILLDTMYEIPSQQDVSKVVIDESVIDGSSQPLMIYENSEK
CLPX_XYLFA       ARKALKRKTGARGLRTIVELVLLDTMYELPSQEGISKVVVDESVIENKSEPYLIYQT--M
CLPX_RALSO       ARKAIKRKTGARGLRSIVEHALMDVMYDLPNHKGVQKVVIDESTIAGDGKPLLMYEE---
CLPX_NEIMA       ARQAMERKTGARGLRSIVERCLLDTMYRLPDLQGLKKVVVGKAVIEEGREPELVFES---
CLPX_NEIMB       ARQAMERKTGARGLRSIVERCLLDTMYRLPDLKGLKKVVVGKAVIEEGREPELVFES---
CLPX_HAEIN       AKKALERKTGARGLRSIVEAVLLDTMYDLPSLENLQKVIVDESTIVDNLAPKLEY-----
CLPX_PASMU       AKKALARKTGARGLRSIVEAILLDTMYDLPSLQHLEKVIVEASTITDNQPPTLVYKA---
CLPX_BUCAI       AKKAMNKNTGARGLRSIIEGILLNIMYELPSMVNIEKILINESVVNSNSLPKIIYGKNKS
CLPX_MYXXA       ANEAIRRKAGARGLRSILESAMLDVMYEIPSRKTAREVLISEEVILKKSEPVVLHAQPEK
CLPX_NOSS1       AQEAYRRKTGARALRGIVEELMLDVMYELPSRKDVTRCTVTREMVEKRSTAELLVHPSSL
CLPX_SYNY3       ATEAHRRKTGARALRGIVEELMLDVMYELPSREDLTHCLITREMVEKRSTAELLLHPSSL
CLPX_SYNE7       AREAFRRKTGARALRGIVEEIMLEVMYELPSRQDVTHCTITREMVEKRSSADVLLLPSSL
CLPX_ALKHC       ARKAIERKTGARGLRSIIEGLTLDVMFDLPARDDVETCIIHDKCVTEGEPPILKMKDGSE
CLPX_BACSU       AKKAIERKTGARGLRSIIEGIMLDVMFELPSRDDIEKCVITGATVTHGEPPRLLLKDGTE
CLPX_LISIN       AKEAIERKTGARGLRSIIEQIMLEVMFEIPSRDDITKCIITEKAARGEEEPQLQLEDGSI
CLPX_LISMO       AKEAIERKTGARGLRSIIEQIMLEVMFEIPSRDDITKCIITEKAARGEEEPQLQLEDGSI
CLPX_STAAM       SEKAIERKTGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNL
CLPX_STRPN       ANKAIERKTGARGLRSIIEETMLDVMFEVPSQENVKLVRITKETVDGTDKPILETA----
CLPX_STRP1       ANKAIERKTGARGLRSIIEETMLDIMFEIPSQEDVTKVRITKAAVEGKSKPVLETA----
CLPX_LACLA       ARKAIERKTGARGLRSIIEEVMMDIMFEVPSHEEITKVIINEAVVDGKAEPQMIREAKKK
CLPX_CLOAB       ASEAISRSTGARGLRAIVEDIMKDIMFDIPSREDVKKVIVTENTINTKQ-PELVLEEGAK
CLPX_CLOPE       ADEAINRKTGARGLRAIVEETMMDIMFDIPSEENIVKATITEETIKDRKDPELEKLPEGE
CLPX_MYCLE       ADQAIHRGTGARGLRAIMEEVLLPVMYDIPSRDDVAKVVVTKETVQDNVLPTIVPRKPS-
CLPX_MYCTU       ADQAIHRGTGARGLRAIMEEVLLPVMYDIPSRDDVAKVVVTKETVQDNVLPTIVPRKPS-
CLPX_CHLMU       AQKAKQAKTGARALGMILENLLRDLMFEIPSDPTVESIRIEEDTITQNKSPVIIQRSPEA
CLPX_CHLTR       AQKAKQAKTGARALGMILENLLRDLMFEIPSDPTVEAIRIEEDTITQNKPPVIIQKSPEA
CLPX_CHLPN       AKKAKQAKTGARALGMILENLLRDLMFEIPSDPTVEAIHIQEDTIAENKAPIIIRRTPEA
CLPX_AQUAE       AKEAIRRKTGARGLRAIMEDIMADIMFEVPSLPGVKEVIIDENVVKNKEKPKLIFEQAV-
CLPX_THEMA       ARKALKRGTGARALKNVFEEMMIDMMFELPNLKNVEKVVITEEVALGKEKPIVVMRESA-
CLPX_BORBU       VDEAILKNTGARGLRSILEGLLKDVMFEVPSISKAKKVVVTKESVLNADVNPLILVGNAI
CLPX_TREPA       AQQAIDQKTGARGLRSIVERLMLDAMFEAPSLKGKKELCITKKVVTQEEKASVRLVSERT
CLPX_HELPY       AQLALERKTGARGLRAIIEDFCLDIMFDLPKLK-GSEVRITKDCVLKQAEPLIIAKTHSK
CLPX_HELPJ       AKLALERKTGARGLRAIIEDFCLDIMFDLPKLK-GSEVRITKDCVLKQAEPLIIAKTHSK
CLPX_CAMJE       AQLALERKTGARGLRSIIEEMMVDLMFELPEYK-DYDIVITKEVVKDNAKALLIKRKIS-
CLPX_DEIRA       AHRAKERKTGARGLRAVLEKSMTDLLFELPRDD-VKEIRFEAEYIDDPLKALESKGLKKS
CLPX2_WOLSU      AQKSLDEELGARGLRHILEEILMPLLFEIPSKEEVTQVSITQGFVLGNSEALILEPRRED
CLPX3_METCA      AARTIERDTGARGLRSIIEHILRRPMFEIPSQSDVRQCVVD-ADTVDGKAPVTLVRAEEE
CLPX_AZOVI       ADQALIRKTGARGLRAVLEAALQQTMFNMPSQPQLRGCTLDLVEHEDGGRSLEVLTRLAE
                    :     ***.*  :.*      ::  .         .                    

CLPX_RICCN       SNKKQPIITDIPA-----------
CLPX_RICPR       LNKKQPIIEDIPA-----------
CLPX_BRUME       EKGNVSA-----------------
CLPX_RHIME       EKTNVSA-----------------
CLPX_RHILO       KKGNVSA-----------------
CLPX_CAUVC       --GAASA-----------------
CLPX_SALTI       EAQ-ASGE----------------
CLPX_SALTY       EAQ-ASGE----------------
CLPX_ECOLI       EAQQASGE----------------
CLPX_YEREN       EAQ-ASGE----------------
CLPX_YERPE       EAQ-ASGE----------------
CLPX_VIBCH       ESQAAGAE----------------
CLPX_PSEAE       PAKAAPEA----------------
CLPX_XYLFA       PAKVASGE----------------
CLPX_RALSO       QPKVAGSN----------------
CLPX_NEIMA       ------------------------
CLPX_NEIMB       ------------------------
CLPX_HAEIN       ------------------------
CLPX_PASMU       ------------------------
CLPX_BUCAI       KKASGE------------------
CLPX_MYXXA       EAAEPKKESA--------------
CLPX_NOSS1       PKPESA------------------
CLPX_SYNY3       PKPESA------------------
CLPX_SYNE7       PTPESA------------------
CLPX_ALKHC       VAMTKPEPKESA------------
CLPX_BACSU       VSQDK----TSA------------
CLPX_LISIN       IPIKT-----SA------------
CLPX_LISMO       IPIKT-----SA------------
CLPX_STAAM       INNSK----TSA------------
CLPX_STRPN       ------------------------
CLPX_STRP1       ------------------------
CLPX_LACLA       ------------------------
CLPX_CLOAB       AIEAPKKKEKSKTKKDIESA----
CLPX_CLOPE       VRPTLKTEKKNKARKDIETA----
CLPX_MYCLE       -----RTERRDKSA----------
CLPX_MYCTU       -----RSERRDKSA----------
CLPX_CHLMU       IA----------------------
CLPX_CHLTR       IA----------------------
CLPX_CHLPN       IA----------------------
CLPX_AQUAE       ------------------------
CLPX_THEMA       ------------------------
CLPX_BORBU       KKPWAKELYEINLKYDKK------
CLPX_TREPA       A-----------------------
CLPX_HELPY       ILP---------------------
CLPX_HELPJ       ILP---------------------
CLPX_CAMJE       ------------------------
CLPX_DEIRA       A-----------------------
CLPX2_WOLSU      G-----------------------
CLPX3_METCA      AGGARLAAGEV-------------
CLPX_AZOVI       DGSGRIQPDPSPVVEEKSALSADL