CLUSTAL format seed alignment for MF_00178

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RISB_GLOVI       -----------------MTVFEGNLQDTRDLKFAIVIARFNDLVVGKLLSACEDSLRRHG
RISB_SYNPX       -----------------MTTFEGRFTDTADLRIAVVVARFNDLVTSKLLSGCLDCLSRHG
RISB_THEEB       -----------------MAVFEGTYQVLGTPRFGIVISRFNDLITTKLLEGCQDCLRRHG
RISB_PYRFU       ---------------MKVRTFEGDYRGEG-LRIAVVVSRFNDLLTEELLKGALDCFKRHG
RISB_THEMA       -----------------MKVVQGDYRGEG-LKIAVVVPRFNDLVTSKLLEGALDGLKRHG
RISB_CHLTE       ---------------MQVQNIEGSLNASG-LKFALVVSRFNDFIGQKLVEGAIDCIVRHG
RISB_WOLSU       -----------------MNVIEGKLNLTGNERVAVIASRFNHLITDRLVEGARDSFVRHG
RISB_GEOSL       ----------------MPRFIEGKLDATG-LRFGIIVSRFNSFIGERLLEGALDALVRHG
RISB_AQUAE       -----------------MQIYEGKLTAEG-LRFGIVASRFNHALVDRLVEGAIDCIVRHG
RISB_DEIRA       -----------------MQRIEATLLAHD-LKFALVSTRWNHLIVDRLVEGAELAFVQHG
RISB_DESVH       --------------MLHIKTIEGQLDAKG-LKFAIVATRFNDFIVDRLIGGACDYLQRHG
RISB_BUCBP       -----------------MKIVQETISTKTKKNIAIIISRYNNFINQHLLDGALDILKRIG
RISB_WIGBR       -----------------MNTYEGKLQSKNSK-IAIIISRFNSFINKNLLDGAIDSLKRIG
RISB_BUCAP       -----------------MNIIQSGINVKNAS-ITIIIARFNEFINKNLLSGAIDTLTRIG
RISB_BLOFL       -----------------MDVIEGNTVVSNITKIVVVVARFNKAINNHLLEGTIDTLKRVG
RISB_ECOLI       -----------------MNIIEANVATPDAR-VAITIARFNNFINDSLLEGAIDALKRIG
RISB_LEPIC       ----------------MIQELKADLNGKGQK-HCVIVSRFNEFITESLLKGALESFRMHG
RISB_LACPL       -----------------MTTFNGKINGNG-LKIGIAVARFNAFVTQQLLTGAQESLVQHG
RISB_BACC1       ------------------MVFEGHLVGTG-LKVGVVVGRFNEFITSKLLGGALDGLKRHG
RISB_BACTN       ------------------------------MKFGIVVSEWNFNITGALLNGAVNTLKKHG
RISB_PORGI       --------MATAYHNLSDYDYESVPCGKD-LRIGIAVAEWNHNITEPLMKGAIDTLLEHG
RISB_COXBU       -------------------------MTESSFKLAIVVSQFNRAVTEKLLNGVLQRLTELG
RISB_THET2       ----------------MKPKTLSPILTAKGVRLAIAVGRFNERVTKLLLEGALEAYARLG
RISB_BORPE       ---------------MNPYILTPDLNGEG-LHIGIVRARFNEEIGQAQLQACLEELGKLG
RISB_RALSO       ---------------MDHGFYPTNLEGEG-LRIGIVQARFNEPVCEALREACVAELEQLG
RISB_NEIMA       -----------------MNTIAPNLDGKH-LRIGIVQARFTNEIGSEMLKVCCRTLQELG
RISB_NITEU       -----------MSYYDNILEIDSNLDGNG-LCIGIVMSRFNIDVSEGLLGACTAELTRLG
RISB_CHLPN       -----------------MKTLKGHLSAKN-LRIAIVGSCFNQAMADALVSGTQETFLKFG
RISB_CHLTR       -----------------MKPLKGCPVAKD-VRVAIVGSCFNSPIADRLVAGAQETFFDFG
RISB2_CAUVC      -------------------------MVEDKIRLLIVEGRSHSGISDELLRGATQAIEARG
RISB1_RHILO      -------------MAGISQHGKAFIRPKAKAHLLIVEARFHDDLADALLDGATSALEEAG
RISB1_RHOPA      -------------MADARRAPLKDQTDVSGARVLIVEARFYDDIQDALLEGAVAELKAAG
RISB_CORGL       -------------MA-KEGLPAVELPDASGLKVAVVTARWNAEICDRLHKHAVDAGRAAG
RISB_CORDI       -------------MS-KEGLPNVSSVAGAGLVVGIVSATWNEKICNQLHAEAIRTAKDCG
RISB_MYCPA       -------------MSPAAGVPEMPALDASGVRLGIVASTWHSRICDALLAGARKVAADSG
RISB_STRAW       -------------MS-GKGAPELSVRNCGDLRVAVIAAQWHEKVMDGLVDGALRALHELG
RISB_TROW8       -------MGKDRNLSLNSPESIQSVIGDTDIKIAVIAAMWHEKIVRGLIDGATREIVSSG
RISB_BDEBA       ---------------------------MGKIKVGVVTARWNQEITSKLEEGAISYLEACE
RISB_RHOBA       -----------------MPSIDGTTGNLPSGRVAIIASRYNANICDSMVQAALQSLSDAG
RISB_XANCP       -----------------MTHYEGDLRPT-TARFVIIASRWNARITDALVTGARQSLAGNG
RISB1_CAUVC      ------------------------MTDPVPPRIAIVVSQFNPEVTDGLLKGALDHLAAQG
RISB_PYRAE       -----------------------------MVRLAIVVAEFNYDITQLMLQKAVEHAKFLG
RISB_SULTO       -------------------------MPDQSINLAIVVAEFNYDITYLMLQRAIAHAKFLG
RISB_AERPE       ------------------------MSCGDKIRIAIVVSEFNYDVTRVMEEKAIDHARFLG
RISB_METAC       ----------------------------MTISLGFVIAEFNRDLTYQMELLGREHAEFLG
RISB_HALSA       -----------------------------MTRLGLVVAEFNRSVTERMEAAAREAAADAD
RISB2_RHOPA      MSLPMTETVTDPAETAPPTAERSYPRFAKPQRVAFVQSSWHRDVVAGCWESFVREIVERG
RISB2_BRADU      --------------MDPPAIE--HPRFAKPQRVAFVQACWHRDVVEEARIAFMKEAEARH
RISB2_BRUME      ------------------MNQ-SCPNKTS-FKIAFIQARWHADIVDEARKSFVAELAAKT
RISB2_RHILO      ------------------MNQHSHKDYET-VRIAVVRARWHADIVDQCVSAFEAEMADIG
RISB2_PSESM      --------------MQPTAIDSKSKSHPN-ERVAFIQACWHKDIVDQSRKGFVAEMAKQG
                                                   .        :                

RISB_GLOVI       VAVGPDSHQVDYAWVPGSFEIPMVARQLA------LSGRYDAIVCLGAVIRGQTSHYDHV
RISB_SYNPX       IDTAETSSQLDVAWVPGSFELPIVAQNLA------QSGRYQVVITLGAVIRGDTPHFDVV
RISB_THEEB       VDPNPHGSQVDYAWVPGSFEIPLVAAQLA------ATRRYAAIICLGAVIRGQTPHFDYV
RISB_PYRFU       VE------EVHIFRVPGSFEIPITVKKIA------KRG-YDAILALGVLIKGETRHFELV
RISB_THEMA       VS----DENITVVRIPGSMEAIYTLKRLL------DLGVHDAIIVLGAVIRGETYHFNVV
RISB_CHLTE       G----SADEITVIRCPGAFELPSVTRKAM------LSGKYDAIVTLGVIIRGSTPHFDVI
RISB_WOLSU       G----KDEHLDLILVPGAFELPFALEKVL------AQGDYDGVCCLGAIIRGSTPHFDYV
RISB_GEOSL       G----DDGDIDVVRVPGAFEIPLTAQKLV------QKGNYDAVICLGAVIRGSTPHFDYV
RISB_AQUAE       G----REEDITLVRVPGSWEIPVAAGELA------RKEDIDAVIAIGVLIRGATPHFDYI
RISB_DEIRA       G----KTENLDHFLVPGSYEVPLVARRLA------ETGRYDAVVCLGAVIKGDTDHYDFV
RISB_DESVH       C----DRENLTIVRIPGAFEMPLVAKKLA------HSGKYDGIIALGAVIRGATPHFDFV
RISB_BUCBP       QI---NQKNIPIIHVPGAYEIPIIASIIS------KQKKYNAIIALGTIIKGHTLHYSHI
RISB_WIGBR       RL---KSENISIFWVPGVCEIPIIVNFLS------KQNKYNGLITLGTVIQGKTFHHELI
RISB_BUCAP       QI---DKEKILTIYVPGTYEIPIVASYIA------NTNKYDAIIAIGTIIKGSTDHFKHI
RISB_BLOFL       QV---QDENITIVWVPGAYELPLVSQALS------ISNKYDAIIVLGTIIRGITEHFEFI
RISB_ECOLI       QV---KDENITVVWVPGAYELPLAAGALA------KTGKYDAVIALGTVIRGGTAHFEYV
RISB_LEPIC       V------EDVTVVRVPGAYEMPVVVSKAA------ASKKYDSIVCLGAVIRGATAHFDLV
RISB_LACPL       VN----ETDIDVAWVPGAFEIPLTVQKMI------TTKRYDGVIALGAVIRGATAHFDYV
RISB_BACC1       VE----EADIDVAWVPGAFEIPLIAKKMA------NSGKYDAVITLGTVIRGATTHYDYV
RISB_BACTN       VK----DENILVKTVPGSFELTFGANQMM------ENCDVDAIIAIGCVIKGDTPHFDYV
RISB_PORGI       VS----ADNIIVQHVPGTFELTYASAYLA------EQHEVDAVIAIGCVVRGDTPHFDYI
RISB_COXBU       VQ----ANQIKTVWVPGAVEIPLLAKRLA------KSKHYQAVVCLGAVIRGETDHYNYV
RISB_THET2       GD----PAEVLVAWVPGSFELPLVAKRLA------QRPDVDAVVALGAVIRGETPHFEYV
RISB_BORPE       VD----ERDVMVVSVPGALELGVALARMA------ESYEFDALIALGAVIRGETYHFEVV
RISB_RALSO       VA----GEDVLLVTVPGALEVPLALQKMA------ESGQFDALIALGAVIRGETYHFELV
RISB_NEIMA       VA----DENITVATVPGALEIPIALMNFA------SSEKFDALIAIGVVIRGETYHFELV
RISB_NITEU       VQ----EADIVLTTVPGALEIPVALQKLA------ESDRFDALIALGAVIRGETYHFEVV
RISB_CHLPN       GS----EDGLMTIRVPGAFEIPCTIKKLLS-----SERKFDAIVACGVLIQGETDHYNQI
RISB_CHLTR       GD----PSSLTIVRVPGAFEIPCAIKKLLS-----TSGQFHAVVACGVLIQGETSHYEHI
RISB2_CAUVC      A-------DYDVITVSNALQIPTVIAMAEDAGHRPVGVRYDGYVALGVVIRGETYHFELV
RISB1_RHILO      A-------TYDVVTVPGSLEIPAVITFALD-GAAEGGTNYDGFVALGTIIRGDTYHFDIV
RISB1_RHOPA      A-------THDVLTVPGALEIPAAVAIAID-SAEAAGKPYDAAIALGCVVRGETIHFEIV
RISB_CORGL       A-------TVSEYRVIGALELPVVVQELA--------RTHDAVVALGCVVRGGTPHFDYV
RISB_CORDI       A-------KVIETRVIGALELPIVVQKLA--------QTCDAVVANGCVIKGGTPHFDYV
RISB_MYCPA       VD------NPTVVRVLGAIEIPVVAQELA--------RNHDAVVALGVVIRGQTPHFEYV
RISB_STRAW       ID------EPTLLRVPGSFELPVVAKVLAG-------RGYDAIVALGVVIRGGTPHFDFV
RISB_TROW8       S-------HAELFRVPGSVELVLACKKLL--------KTFDAAVALGVILRGETDHNTHI
RISB_BDEBA       DV------EIFAALVPGAVEIPLACQAFLE-------AGCDGVVALGVVIRGDTSHYDYV
RISB_RHOBA       IP----EDKQWLIRVPGAWELCWAVEQAFQ------HADVIGAITLGCVIKGETTHDEHI
RISB_XANCP       IG----EDAIDVVRVPGAWEIPMAANRVAQ------GGQHAAIIALGCVIRGDTRHYEHV
RISB1_CAUVC      AP----VAAPDIIAAPGAYELPLIAQTLA------RTGRYAGVVCLGCVIKGETAHFEFI
RISB_PYRAE       AE------ITYIVKTPGVYDIPMILKELVA------KEEVDAVATLGAVIQGATKHDELV
RISB_SULTO       AN------VKVVFKVPGSYDMAIAVKELLK------RDDIDAVVTLGAVIKGETKHDEIV
RISB_AERPE       AE------VSLVARSPGTFDTPFIVSRLLAT-----HSEVDAVAVLGAVIKGDTKHDEVV
RISB_METAC       AT------VKETILVPGVFDMPLAIKKLCQ------REDIDAVVTIGSVIEGETDHDQVV
RISB_HALSA       AA------ITDTVHVPGAYDSPLAADRLAR------RDDIDAVAVVGAIVTGDTDHDHVI
RISB2_RHOPA      IV----ASQVDLFEVPGSFEIPLHVQMLAK------TRRYTAIVAAGLVVDDGL--TGFV
RISB2_BRADU      L------THVDVFEVPGSFEIPLHAQILAK------TRRYTAIVAAGLVVDGGIYRHEFV
RISB2_BRUME      GG----SVEVEIFDVPGAYEIPLHAKTLAR------TGRYAAIVGAAFVIDGGIYRHDFV
RISB2_RHILO      GD----RFAVDVFDVPGAYEIPLHARTLAE------TGRYGAVLGTAFVVNGGIYRHEFV
RISB2_PSESM      YA----ESDIDIFEVGGAFEIPLHAKLLAN------TGRYAGIVGAALVVDGGIYRHEFV
                                 .  :                          . :: .       :

RISB_GLOVI       ASEVAKGIQALAFQTGVPVTFGVLTTDTMQQAIERAGIKS----NLGWEYGENAIEMATL
RISB_SYNPX       VAEASKGIATVARESGVPVIFGVLTTDTMQQALERAGIKS----NLGWSYGLQALEMGSL
RISB_THEEB       AAEVTKGIATASMQTGVPIIYGILTTDTMQQALERAGIKS----NKGWEYALNALEMANL
RISB_PYRFU       ASQVSRGIAQVSLEEGIPVIFGIVPAEDEIQAISRSGIKS----NRGFEYALTTIEMANL
RISB_THEMA       ANEIGKAVAQFNMTSDIPIVFGVLTTDTLEQALNRAGAKSG---NKGFEAAMVAIEMANL
RISB_CHLTE       AAEATKGIAQVGMEAAIPVSFGVLTTENLEQAIERAGTKAG---NKGFDAALAAIEMANL
RISB_WOLSU       SAEATKGIANVTLKYGAAVTFGVLTTDNIEQAIERAGTKVG---NKGFEAMTGLIEMMNL
RISB_GEOSL       AAEVSKGIAHVSLATGVPVVFGVLTTDTIEQAIERAGTKAG---NKGFDAAVTAIETARL
RISB_AQUAE       ASEVSKGLANLSLELRKPITFGVITADTLEQAIERAGTKHG---NKGWEAALSAIEMANL
RISB_DEIRA       AGGAANGILNTSLHTGVPVAFGVLTTDTVEQALNRAGIKAG---NKGGEAVLAMIETANL
RISB_DESVH       SNEASKGLAQACLESGVPLGFGLLTTDNIEQAIERAGSKAG---NKGAEAAAAVLETVRV
RISB_BUCBP       SHAVNSGLTNISITNNIPISIGIITANNIEQAIERAGTKLG---NKGSEAALTALEMINI
RISB_WIGBR       SKDFNNIIFNISIKKNIPISVGVLYTRNINQAIERSGTKLG---NKGSDAALSVLEMINL
RISB_BUCAP       ANDAYSNLSRISTKYFIPITMGILTTENIQQSIERSGTKMG---NKGSEAALAALEMINI
RISB_BLOFL       YKSCNFGLSNISISNLVPIGLGLLVTNDIGQAVERIGIKGN---NKGSEAALAALEMINI
RISB_ECOLI       AGGASNGLAHVAQDSEIPVAFGVLTTESIEQAIERAGTKAG---NKGAEAALTALEMINV
RISB_LEPIC       AGE-SAKIGSIGVQHSIPVIFGVLTTDTIEQAIERAGTKAG---NKGAEAAATAVEMVNL
RISB_LACPL       CSGVTTGIATVSLATDTPIMFGVLTTDTIEQAMDRAGFKSG---NKGADCAVSLLETLDV
RISB_BACC1       CNEVAKGVASLSLQTDIPVIFGVLTTETIEQAIERAGTKAG---NKGYESAVAAIEMAHL
RISB_BACTN       CMGATQGITELNATGDIPVIYGLITTNTMEQAEDRAGGKLG---NKGDECAISAIKMIDF
RISB_PORGI       CQGVTQGITQLNIDGFVPVIFGVLTTETMLQAEERAGGKHG---NKGTEAAVTALKMAGL
RISB_COXBU       CQQVSFGCQQVALEYEVPIIFGVLTTTTKEQAFARAGGERG---NKGADWADAAVSMIKL
RISB_THET2       AGQAASGLMQAMLQTEKPIVFGVLTTNTPEEAQERAGGKAG---NKGAEAVFTAIEMVRL
RISB_BORPE       SNESAAAISRIALETGIPVANGVLTVDTDEQAQARA----A---GKGADCAQVAVEMANL
RISB_RALSO       SNESGAGITRVCLDFNIAIANGILTTDTDAQAHART----R---EKGRDCARTAIEMANL
RISB_NEIMA       SNESGAGVSRVALDYNIPIANAVLTTENDAQAIERI----E---EKASDAAKVAVECANL
RISB_NITEU       ANESARGLAAVGREYNIPIANGILTTDDEDQATARM----A---EKGGETARVAIEMANL
RISB_CHLPN       VNQVAAGIGALSLEFCLPITLSIVAAPSAEIAWQRSGIKGR---HLGVSGMTTAIEMATL
RISB_CHLTR       ADSVAAGVSRLSLDFCLPITFSVITAPNMEAAWERAGIKGP---NLGASGMKTALEMASL
RISB2_CAUVC      ANETARGLQDLGVAKRLPIGFGVLAVDEEAQALSRARVSEG---DRGGAAAKACLETIGL
RISB1_RHILO      ANESSRALMDMSVQDSVCIGNGILTTENDAQAWTRAKRSEG---DKGGFAARAALTMIAL
RISB1_RHOPA      SMESARALMDLSVARKFPLGNGIITVNTDEQAWARAKPGDL---NKGGDAARAALAMLRI
RISB_CORGL       CDSVTEGLTRIALDTSTPIGNGVLTTNTEEQAVERSGGEGSV-EDKGAEAMVAALDTALV
RISB_CORDI       CDSVTEGLTRIALDSGVPVGNGVLTTLNEEQAIDRAGFDGST-ENKGAEATIAAMHTALV
RISB_MYCPA       CDAVTQGITRVSLDASTPVANGVLTTDNEQQALDRAGLPESA-EDKGSQAAGAALSAALT
RISB_STRAW       CQGVTQGLTQVSVDTGVPVGFGVLTCDTEEQALDRAGIEGSH-EDKGHEAVTAAVATAAT
RISB_TROW8       ARLVLSGITDVMLALEKPIGIGVLTIDTEQQGLDRSSGD----YNAGVNAARAVIRMVRL
RISB_BDEBA       CNSVTDGVTRLMLDYKKPIGFGVLTTENEEQALARAGGDHG---NKGEEAAQVTMEMIGL
RISB_RHOBA       NRAVSDTLMEQAVRSGRPVGFGLLTCNTVEQAIQRSGGAVG---NKGHEAADAMLEMLRL
RISB_XANCP       ADLCAEGLMSVQLQTGVPVLNGVLAVERVEDAEARAGGSHG---NKGEECALAALELVNL
RISB1_CAUVC      SLGASLGLMAAGLQTETPVSFGVLTTYTDEQAVARSRDDAE---NKGREAANACLSTVQT
RISB_PYRAE       ATQAARKILDIAVESGKPITLGIIGH-----GANRIQALERV-EEYARRAVEAAVKMARR
RISB_SULTO       ATQTARKILDLSVEYGKPVTLGIIGH-----GVTHEQAVERI-EEYSTRAVEAAIKLAKR
RISB_AERPE       AHQAARKLLDLSIEYGKPVTLGIIGP-----GASRLEAIERA-EEYARRAVESAVKLARR
RISB_METAC       MQHAARKIMDLSLEFNKPVTLGIPGP-----GMTRMAAHERV-D-YAKRAVEAAVKLVRR
RISB_HALSA       ASATADTLTDVSLERDTPVTFGVSGP-----GMSGAEARERV-E-KGAAAVESAVSLTQE
RISB2_RHOPA      AQTVIQALMDVQLKTEVPVFSAVATPHSFERGSPNTEHFRQHFATKGADVAHACADTLLS
RISB2_BRADU      ADTVIKALMDVQLRTEVPVFSAVLTPQQFHETEVHYDFFRRHFAIKGVEVAEACANTLLG
RISB2_BRUME      ATAVINGMMQVQLETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEAAHAALQIVSE
RISB2_RHILO      ASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRFFFEHFTVKGKEAARACVEILAA
RISB2_PSESM      AQSVVSALMQVQLETEVPVFSVVLTPHHFHAGEEHQKFFFDHFSHKGEEAAKTCADTLNK
                                   :   :                       .             

RISB_GLOVI       TRKIRHLVAVRAVQPELPEQTPPSLLQ---------------
RISB_SYNPX       MAALAQS-----------------------------------
RISB_THEEB       MQTLPSAINPPTTKLSSSTRILTDG-----------------
RISB_PYRFU       FRKLGENNER--------------------------------
RISB_THEMA       RKRLRRDVFESDSNGR--------------------------
RISB_CHLTE       YKQL--------------------------------------
RISB_WOLSU       YKNIGA------------------------------------
RISB_GEOSL       YRELR-------------------------------------
RISB_AQUAE       FKSLR-------------------------------------
RISB_DEIRA       LKQIER------------------------------------
RISB_DESVH       MEQL--------------------------------------
RISB_BUCBP       INILAQNK----------------------------------
RISB_WIGBR       LKII--------------------------------------
RISB_BUCAP       MKKLKKINN---------------------------------
RISB_BLOFL       LKTIKNNN----------------------------------
RISB_ECOLI       LKAIKA------------------------------------
RISB_LEPIC       LSLL--------------------------------------
RISB_LACPL       QRAILKADLA--------------------------------
RISB_BACC1       SKQWA-------------------------------------
RISB_BACTN       VWSLNK------------------------------------
RISB_PORGI       ERI---------------------------------------
RISB_COXBU       MKEIEITDE---------------------------------
RISB_THET2       LEAISR------------------------------------
RISB_BORPE       AAALEPEEDD-EDDEDEDFDDEEDDGR---------------
RISB_RALSO       TAALDGLQDHGQDDENE-------------------------
RISB_NEIMA       VNLL--LEEQFEDEE---------------------------
RISB_NITEU       VLTLDEMDQSAPT-----------------------------
RISB_CHLPN       FTQI--------------------------------------
RISB_CHLTR       FSLIGKE-----------------------------------
RISB2_CAUVC      KRQLLGQAR---------------------------------
RISB1_RHILO      KEQLGARS----------------------------------
RISB1_RHOPA      KRRLAKA-----------------------------------
RISB_CORGL       LSQIRATEG---------------------------------
RISB_CORDI       LRDLP-------------------------------------
RISB_MYCPA       LRELRARS----------------------------------
RISB_STRAW       LRSVSEPWR---------------------------------
RISB_TROW8       FR----------------------------------------
RISB_BDEBA       TQEIPAAMKTALMLAKKAPAKAAKKPAKAAAKTQKKKKKVRK
RISB_RHOBA       QTKMR-------------------------------------
RISB_XANCP       MELLP-------------------------------------
RISB1_CAUVC      LRRIRENALA--------------------------------
RISB_PYRAE       KKALREAK-YNGSTVYID------------------------
RISB_SULTO       LRELRKIQTLNEEMVVIE------------------------
RISB_AERPE       SKELSGEC----------------------------------
RISB_METAC       L-----------------------------------------
RISB_HALSA       L-----------------------------------------
RISB2_RHOPA      LERLRGQVAAGIV-----------------------------
RISB2_BRADU      LERLRGQVAAGIA-----------------------------
RISB2_BRUME      RSRIAALV----------------------------------
RISB2_RHILO      REKIAA------------------------------------
RISB2_PSESM      VRSLRRLDAQQKAAC---------------------------