CLUSTAL format seed alignment for MF_00180

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RIBB_AGRFC      ------------------MTIAKIEDAIEAISRGEMVIVVDDEDRENEGDIIAASDSITP
RIBB_OCEIH      -----------------MNELSKIEQAIEDLRNGKLIIVADDADREAEGDLVGLSEFVTP
RIBB_ECOLI      ------MNQT-LLSSFGTP-FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTV
RIBB_SHIFL      ------MNQT-LLSSFGTP-FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTV
RIBB_ECO57      ------MNQT-LLSSFGTP-FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTV
RIBB_ECOL6      ------MNQT-LLSSFGTP-FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTV
RIBB_SALTI      ------MNQT-LLSSFGTP-FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTV
RIBB_SALTY      ------MNQT-LLSSFGTP-FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTV
RIBB_PHOLL      ------MNQT-LLSEYGTS-SERVEHAINALRDGKGVMVLDNEDRENEGDIIFAAETMTV
RIBB_YERPE      ------MNQT-LLSDFGTP-VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTL
RIBB_BUCAI      ------MNQT-LLSKFGKP-IERIKNAILALKSGQGVIILDDEERENEGDLVFACENMTV
RIBB_BUCAP      ------MNQT-LLSEFGNP-IERVKKAISALQLGEGIIILDDEKRENEGDLVFSSETMTV
RIBB_BUCBP      ------MTQN-LLDQFGTP-KTRVKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTT
RIBB_BLOFL      ------MRQN-VLFEFGTP-IVRVLNALDALSNGRGILVVDDENRENEGDMIFAAENMTV
RIBB_WIGBR      ------MNKK-LLSEFGDP-VQRVKNALQSLKRGNGILVLDDENRENEGDMIFAAENMTV
RIBB_HAEIN      ------MNQS-ILSPFGNTAEERVLNAINAFKNGTGVLVLDDEDRENEGDLIFPAETITP
RIBB_PASMU      ------MNQS-ILSPFGQS-EERAIAAINAFKQGNGVLVLDDEDRENEGDLIFPAETITV
RIBB_VIBVU      ------MNQSSLLAEFGDP-ITRVENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTN
RIBB_VIBVY      ------MNQSSLLAEFGDP-ITRVENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTN
RIBB_VIBPA      ------MNQSSLLAEFGDP-ITRVENALIALKEGRGVLLLDDEDRENEGDIIYSVEHLTN
RIBB_VIBCH      ------MNQSSLLAEFGDP-ITRVENALQALREGRGVLLLDDEDRENEGDIIYAVESLTT
RIBB_SHEON      ------MNQS-LLAPFGTA-IERVEAGLNALRQGLGVLVVDDEDRENEGDLIFAAESLTN
RIBB_BORBR      ---MSNVVPTPVSPLFAQPFATRLERALQHLRIGRPVILMDDFDRENEADLIVAADKLTV
RIBB_BORPA      ---MSNVVPTPVSPLFAQPFATRLERALQHLRIGRPVILMDDFDRENEADLIVAADKLTV
RIBB_BORPE      ---MSNVVPTPVFPLFAQPFATRLERALQHLRIGRPVILMDDFDRENEADLIVAADKLTV
RIBB_CHRVO      ------------MNANTDILSLRVHAALDALRRGLPVIVADDADRENEADLILAADTLTV
RIBB_PSEPK      ------------MFTQHHAQFPNVSAAIAAFQAGRPVLLLDDDDREDEADIIAAAENITL
RIBB_RALSO      MPSGDASADPIEARFDPAAMPARMAAALDAMRLGIPVVVLDDADRENEADLIIAADRLTH
RIBB_HELPJ      ------------------MILRRVTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTP
RIBB_METAC      -------MNESTVYECLKYGNENINRALEVLRAGKMIQIYDSDSREGETDLVIPAKAVTY
RIBB_METMA      -------MSENMAYECLKYSNENINRALEALRAGKMIQIYDSDSREGETDLVIPAKAVTY
RIBB_ARCFU      -------------------MILDFEESLRAFRKGSPVLIYDFEDREGETDIAIPAIHVGK
RIBB_METJA      --------------------MNNVEKAIEALKKGEIILVYDSDEREGETDMVVASQFITP
RIBB_METTH      -----------------MEIVIMIQEALKALRRGEIVLVFDADNRERETDMIVAAEKIKP
                                          .:     *  : : *  .** * *:         

RIBB_AGRFC      QQIAFMMNHARGLVCVAMPGERLDALDIPLMVSRNTES--------------------LK
RIBB_OCEIH      EKVNFMTKYGRGLICVPITEERALELDLHAMATNNTDT--------------------YG
RIBB_ECOLI      EQMALTIRHGSGIVCLCITEDRRKQLDLPMMVENNTSA--------------------YG
RIBB_SHIFL      EQMALTIRHGSGIVCLCITEDRRKQLDLPMMVENNTSA--------------------YG
RIBB_ECO57      EQMALTIRHGSGIVCLCITEDRRKQLDLPMMVENNTSA--------------------YG
RIBB_ECOL6      EQMALTIRHGSGIVCLCITDDRRKQLDLPMMVENNTSA--------------------YG
RIBB_SALTI      EQMALTIRHGSGIVCLCITEDRRKQLDLPMMVENNTSA--------------------YG
RIBB_SALTY      EQMALTIRHGSGIVCLCITEDRRKQLDLPMMVENNTSA--------------------YG
RIBB_PHOLL      EQMALTIRYGSGIVCLCLTEERRQQLQLPMMVENNSSP--------------------FQ
RIBB_YERPE      EQMALTIRHGSGIVCLCITDERRQQLDLPMMVTHNSSQ--------------------FQ
RIBB_BUCAI      EQMALSIRYGSGIVCLCITESKRKQLNLPMMVKKNTSA--------------------YR
RIBB_BUCAP      EQMALTIRYGSGIVCLCITESKRKKLNLPMMVKHNTST--------------------YR
RIBB_BUCBP      EQMALTIRYGSGIVCLCITESKRKQLKLPMMVQNNTSK--------------------FG
RIBB_BLOFL      KQMALAIRYGSGIVCLCLTEEKCRQLKLPMMVKNNSNH--------------------YK
RIBB_WIGBR      NQMALAIRFGSGIVCICLTKEKCKILNLPMMVKKNNSK--------------------YK
RIBB_HAEIN      EQMAKLIRYGSGIVCLCITDERCQQLDLPPMVEHNNSV--------------------NK
RIBB_PASMU      EQMTMLIRYGSGIVCLCLSDEICQQLDLPPMVTENTSV--------------------NK
RIBB_VIBVU      AQMALMIRECSGIVCLCLTDEHANKLELPPMVVNNNSA--------------------NQ
RIBB_VIBVY      AQMALMIRECSGIVCLCLTDEHANKLELPPMVVNNNSA--------------------NQ
RIBB_VIBPA      EQMALMIRECSGIVCLCLTDAQADKLELPPMVVNNNSA--------------------NQ
RIBB_VIBCH      AQMALMIRECSGIVCLCLTEAQADRLALPPMVVNNNSA--------------------NQ
RIBB_SHEON      AQMAMLIRECSGIVCLCLPDEKVKALALPPMVENNSSQ--------------------YG
RIBB_BORBR      PVMAQLIRDGSGIVCLCLPGETLDRLELPPMVDSNRSR--------------------YS
RIBB_BORPA      PVMAQLIRDGSGIVCLCLPGETLDRLELPPMVDSNRSR--------------------YS
RIBB_BORPE      PVMAQLIRDGSGIVCLCLPGETLDRLELPPMVDSNRSR--------------------YS
RIBB_CHRVO      PEMARMIRDGSGIVCLCLTPERAERLQLPPMAAENGSR--------------------YG
RIBB_PSEPK      QTMAMMIRDCSGIVCLCLDEATVDELQLAPMVQNNQAR--------------------HG
RIBB_RALSO      AGMAMLIRECSGIVCLCLTAEKAAVLGLRPMVEHNRSQ--------------------YG
RIBB_HELPJ      EKINFMATHARGLICVSLTKDLANKFELPPMVSVNDSN--------------------HE
RIBB_METAC      KDVKWMRKDAGGLICVAVDPVASKQLKLPFMADLVREASRTSESLGEVVEKDGDLKYDSH
RIBB_METMA      TDVKWMRKDAGGLICVAVDPVASKQLKLPFMADLVREASKTSDSLGEVVEKDGDLKYDAH
RIBB_ARCFU      DEVAMMRIDGGGLICVAIHPVAAEKLGLPFMHDVLRIASEKLPEIRKVADAD-DIKYDSR
RIBB_METJA      EHIRIMRKDAGGLICTALHPDICNKLGIPFMVDILEFASQKFKVLRELYPND--IPYDEK
RIBB_METTH      EHIRIMRNDAGGLICVPVSWENSEKLGIPYMTDIMEEASGRYPVLGKLSPHD--IPYDEK
                  :        *::*  :       : :  *                             

RIBB_AGRFC      TAFTVSVDYIPGTTTGISAADRAKTVRALVSEGSR---------PEDFARPGHIFPLRAN
RIBB_OCEIH      TQFTVSVDYYT-NSTGISTADRADTIRALAEPLSK---------AADFKRPGHMFPLIAK
RIBB_ECOLI      TGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAK---------PSDLNRPGHVFPLRAQ
RIBB_SHIFL      TGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAK---------PSDLNRPGHVFPLRAQ
RIBB_ECO57      TGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAK---------PSDLNRPGHVFPLRAQ
RIBB_ECOL6      TGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAK---------PSDLNRPGHVFPLRAQ
RIBB_SALTI      TGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAK---------PSDLNRPGHVFPLRAQ
RIBB_SALTY      TGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAK---------PSDLNRPGHVFPLRAQ
RIBB_PHOLL      TAFTVTIEAAQGVTTGVSAADRITTIRAAIADNAK---------PSDLNRPGHVFPLRAQ
RIBB_YERPE      TAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAK---------PADLNRPGHVFPLRGQ
RIBB_BUCAI      TGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAK---------PSDLNRPGHVFPLRAH
RIBB_BUCAP      TGFTVTIEASKGVSTGVSAKDRLTTIKTATADDAQ---------PSDLNRPGHVFPLRAN
RIBB_BUCBP      TNFTVTIEAAEGISTGVSAKDRLTTIRAAINDNAK---------PSDLNRPGHIFPLQAH
RIBB_BLOFL      TAFTVTIEASKGITTGVSAKDRLTTIKTSIEDYAK---------PSDLNRPGHVFPLRAH
RIBB_WIGBR      TAFTVSIESAYGITTGVSAYDRIITIKTAIKDNAK---------PDDLNRPGHVFPLQAH
RIBB_HAEIN      TAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAV---------LTDLHRPGHVFPLRAA
RIBB_PASMU      TAFTVTIEAAKGVSTGVSATDRVTTIRAAVADNAK---------PSDLSRPGHIFPLRAM
RIBB_VIBVU      TAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAK---------ADDLARPGHVFPLRAR
RIBB_VIBVY      TAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAK---------ADDLARPGHVFPLRAR
RIBB_VIBPA      TAFTVSIEAKVGVTTGVSAADRVTTIKTAANPHAK---------PEDLARPGHVFPLRAR
RIBB_VIBCH      TAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAK---------PEDLARPGHVFPLRAR
RIBB_SHEON      TAFTVSIEAKVGVTTGVSAADRVTTIKTAIADHAK---------PSDLARPGHVYPLRAQ
RIBB_BORBR      TAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGAR---------SGDVVSPGHVFPLRAQ
RIBB_BORPA      TAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGAR---------SGDVVSPGHVFPLRAQ
RIBB_BORPE      TAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGAR---------SGDVVSPGHVFPLRAQ
RIBB_CHRVO      TAFTVAIEAAQGVTTGVSAADRTTTIRAAIHPDAK---------PGDLVRPGHVYPIVAR
RIBB_PSEPK      TGFTVTIEAAEGITTGVSAQDRITTIDAALRSSAE---------QRHIVSPGHVFPLRAR
RIBB_RALSO      TAFTVSIEARVGVSTGVSAADRITTIRAAVAPDAD---------AQSVVSPGHVFPLVAQ
RIBB_HELPJ      TAFTVSIDAKE-AKTGISAFERHLTIELLCKDTTK---------PSDFVRPGHIFPLIAK
RIBB_METAC      SSFSIWVNHRD-TRTGIPDLERALTIRKIGEITEKSLSGNGIRFGNEFRTPGHVALLRAA
RIBB_METMA      SSFSLWVNHRD-TRTGIPDIERALTIRKIGEITEESLSGNGVRFGNEFRTPGHVALLRAA
RIBB_ARCFU      SSFSLWVNHRD-TFTGITDVDRALTIRRIGEVVDEVMMGKKVDFGREFRSPGHVALLRAA
RIBB_METJA      SSFSITINHRK-TFTGITDNDRAFTIKKLAELVKE---GRFNDFGKEFRSPGHVTLLRAA
RIBB_METTH      SAFSITVNHRK-TFTGITDNDRALTIGELAGICRD---DRHESFGDLFRSPGHVTLLRAA
                : *:: ::      **:.  :*  *:                     .  ***:  : . 

RIBB_AGRFC      PEGVLGRTGHTEAAVDLCRLAGKFPSGTICEVANDDGTMARLPQ--LEIFAERHGLLVVT
RIBB_OCEIH      NAGVLERRGHTEAAVDLARLSNSIPSAYICEILNDDGTMARYPA--LETLAKDWDLTLIT
RIBB_ECOLI      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPE--CIEFANKHNMALVT
RIBB_SHIFL      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPE--CIEFANKHNMALVT
RIBB_ECO57      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPE--CIEFANKHNMALVT
RIBB_ECOL6      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPE--CIEFANKHNMALVT
RIBB_SALTI      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPE--CIAFAGQHNMAVVT
RIBB_SALTY      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPE--CIAFAGQHNMAVVT
RIBB_PHOLL      PGGVLVRQGHTEAAIDLVSLAGFKPAGVLCELTNDDGSMARTLE--VVQFAKLHNMPVVT
RIBB_YERPE      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPE--VIAFAKLHDMPVVT
RIBB_BUCAI      KGGVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPE--IIKFSENKKMQVLT
RIBB_BUCAP      GGGILARAGHTEAAIEIVSLAGFKPYGVICELTNKDGSMSRTPE--IIKFSKSKKMKILT
RIBB_BUCBP      KNGILGRIGHTEAAIEFVTLAGFKPAGIICELTNRNGTMSKVPD--IIKFSKLKKMTIVT
RIBB_BLOFL      NGGVLSRSGHTEAAVDLTTLAGLKPFGVICEVTNEDGSMARTTE--IIKFSKQYDMPVLT
RIBB_WIGBR      PGGILSRAGHTEAAVDLTKLAGLKPAGVICEVMNDDGSMARMPE--IINFSKKYNMPVLI
RIBB_HAEIN      NGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARAPE--IVEFAKKFGYSVLT
RIBB_PASMU      TGGVLKRRGHTEASVDLARLAGYKAAGVICEITNDDGSMARAPE--IVTFAQKFGFPVVT
RIBB_VIBVU      PGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPE--IIAFGKQHNMPVLT
RIBB_VIBVY      PGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPE--IIAFGKQHNMPVLT
RIBB_VIBPA      PGGVMTRRGHTEGTIDLMQMAGLQPAGVLCEVTNPDGTMAKAPE--IVAFGHLHNMPVLT
RIBB_VIBCH      AGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPE--IIEFGKLHNMPVLT
RIBB_SHEON      PGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPE--IIAFGALHNMPVLT
RIBB_BORBR      PGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGAS--LERYAAKEGLVALA
RIBB_BORPA      PGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGAS--LERYAAKEGLVALA
RIBB_BORPE      PGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGAS--LERYAAKEGLVALA
RIBB_CHRVO      AGGVRERRGHTEASVELARLAGFSPAGVLCELMNPDGTMMRGQQ--VQDYAERHDLPQLS
RIBB_PSEPK      NGGVLTRRGHTEGSVDLARLAGLRPAAVLCELMNPDGSMARGEQ--VAVYARQYNLPVLT
RIBB_RALSO      AGGVLARRGHTEGSVDLARLAGLSPAGVLCELMLPDGTMARRDD--AVRFADQHGLPVLT
RIBB_HELPJ      DGGVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFLSDFAIKHNLKTLY
RIBB_METAC      EGLLDERMGQTELSVALARMAGITPAMVVCEMLDDESGRALSKEN-SKDYGKDHGLVFLE
RIBB_METMA      EGLLDERMGQTELSVALARMAGITPAMVVCEMLDDDSGKALSKEK-SKEYGKEHGLVFLE
RIBB_ARCFU      DKLTYERVGQTELSVALAEMAGIAPAVAICEMLDAETGKALTKEK-AMEYAEEKGIPFID
RIBB_METJA      EGLVKNRQGHTEMTVALAELANLVPITTICEMMGD-DGNAMSKNE-TKRYAEKHNLIYLS
RIBB_METTH      DGHVLRRGGHTEMSIALMEMAGLTGVAVCCEMMDDRTGNSLSTED-AMKYAREHDLIFMS
                      * *:** :: :  ::.       **:                  .       : 

RIBB_AGRFC      IKDLVSYLKGEVVEEMVQKQVA--
RIBB_OCEIH      VEDLVQYREKEIAIEN--------
RIBB_ECOLI      IEDLVAYRQAHERKAS--------
RIBB_SHIFL      IEDLVAYRQAHERKAS--------
RIBB_ECO57      IEDLVAYRQAHERKAS--------
RIBB_ECOL6      IEDLVAYRQAHERKAS--------
RIBB_SALTI      IEDLVAYRQAHERKAS--------
RIBB_SALTY      IEDLVAYRQAHERKAS--------
RIBB_PHOLL      IEDLVIYRQAIEQKAS--------
RIBB_YERPE      IDDLAAYLQSRAKKAS--------
RIBB_BUCAI      IQDLIFYIKNINHL----------
RIBB_BUCAP      IKDLILYVQNKK------------
RIBB_BUCBP      IRDLIQYISR--------------
RIBB_BLOFL      ISDVIAYRMSNL------------
RIBB_WIGBR      IKDIIEYYNFIN------------
RIBB_HAEIN      IEDLVEYRLAHNI-----------
RIBB_PASMU      IEDLVAYRQKYDV-----------
RIBB_VIBVU      IEDMVMYRNQYDLKLA--------
RIBB_VIBVY      IEDMVMYRNQYDLKLA--------
RIBB_VIBPA      IEDMVAYRNQFDLKLA--------
RIBB_VIBCH      IEDMVQYRIQFDLKLA--------
RIBB_SHEON      IEDIVVYRKSLLANVG--------
RIBB_BORBR      IDELAAHLQARGATGAPAELAVAA
RIBB_BORPA      IDELAAHLQARGATGAPAELAVAA
RIBB_BORPE      IDELAAHLQARGATGAPAELAVAA
RIBB_CHRVO      VAELAEWLQREPA-----------
RIBB_PSEPK      IEELARYREAMLEREAEPA-----
RIBB_RALSO      IEDIARYREQMARAVSFA------
RIBB_HELPJ      VSDLISYRLE>-------------
RIBB_METAC      GQEILEAYMLWTGSEC--------
RIBB_METMA      GREIVEAYLLWAGTDC--------
RIBB_ARCFU      GRTIVEHYRKFREVEVSLFV----
RIBB_METJA      GEEIINYYLDKYLKD---------
RIBB_METTH      GAELIESYMEFRS-----------
                   :