CLUSTAL format seed alignment for MF_00182

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FMT_BACVZ         -----------MTRIVFMGTPDFSVPVLRTLIEDG---YEVVGVVTQPDRPKGR-KKIMT
FMT_BACSU         -----------MTRIVFMGTPDFSVPVLRTLIEDG---YEVVGVVTQPDRPKGR-KKVLT
FMT_BACLD         -----------MTRIVFMGTPDFSVPVLGTLIDDG---YEVVGVVTQPDRPKGR-KKVMT
FMT_BACP2         -----------MARIVFMGTPDFSVPVLQTLITEG---YEVVGVVTQPDRPKGR-KRVLT
FMT_BACCN         -----------MIKVVFMGTPDFSVPVLRRLIEDG---YDVVGVVTQPDRPVGR-KKVMT
FMT_BACMK         -----------MMKVVFMGTPDFSVPVLRRLIEDG---YDVVGVVTQPDRPVGR-KKVLT
FMT_GEOTN         -----------MTNIVFMGTPDFAVPVLRQLLDDG---YRVVAVVTQPDKPKGR-KRELV
FMT_BACHD         ------------MKIVFMGTPDFSVPVLRRLIEDG---YTIAAVVTQPDRPVGR-KRVLT
FMT_OCEIH         -----------MKRIVFMGTPDFAVPVLQKLLELK---YDIVLVVTQPDRPKGR-KKVIT
FMT_STAAW         -----------MTKIIFMGTPDFSTTVLEMLIAE----HDVIAVVTQPDRPVGR-KRVMT
FMT_STAEQ         -----------MSKIIFMGTPDFSTKVLEMLIAE----HEVIAVVTQPDRPVGR-KKVMT
FMT_LYSSC         -----------MTSIIFMGTPDFSAPILRMLHEEG---YDIKAVVTQPDRPVGR-KRILT
FMT_LISMF         -----------MTKIIFMGTPEFSVPVLTQLAST----YDVVAVVTQPDRPVGR-KRVLT
FMT_BACSK         ------------MKIVFMGTPAFSVPILKRLIDT----HTVLAVVTQPDRPVGR-KRLLT
FMT_LACBA         -----------MTSVIFMGTPQFSAPILSSLIDN-G--YDVLAVVTQPDRRVGR-KHVLT
FMT_PEDPA         -----------MKSIIFMGTPEFSAPILQSLIDEPN--YDVIGVVTQPDRKVGR-KHVLT
FMT_LACPL         -----------MTSIVFMGTPAFAAPILESLIKE-Q--YQVLGVVTQPDRKVGR-KHVLT
FMT_LACF3         -----------MKSIVFMGTPQFAVPILKALIDSED--YQVLAVVSQPDRRVGR-KRELR
FMT_LACS1         -----------MTNIVFMGTPAFAAPILEGIIEN-G--YNVLAVVTQPDRPVGR-KRVLH
FMT_LACCB         -----------MTSVIFLGTPEFAVPILEGLIAQ-H--YDILAVMTQPDRKVGR-KQRLA
FMT_LACSS         -----------MTSIVFMGTPQFSVPILEALVAN-D--YQILAVVTQPDRKVGR-KQVLQ
FMT_ENTFA         -----------MTKIVFMGTPAFSVPILESLIEA-G--YDVQAVVTQPDRPVGR-KKVIT
FMT_LACAC         -----------MTSVIFMGTPEFSVPVLEGLIEA-G--YEIRAVVTQPDKKVGR-KQKIA
FMT_LACJO         -----------MSSVIFLGTPNFGSVVLQGLIEQ-G--YEIKAVVTQPDKRVGR-KQVVH
FMT_LACDB         -----------MNSVIFLGTPQFGATVLEGLIKA-G--YHILAVVTQPDKKVGR-KQKVV
FMT_STRA5         -----------MTKLLFMGTPDFSATVLKGILADGK--YDVLAVVTQPDRAVGR-KKEIK
FMT_STRT1         -----------MTKIIFMGTPAFSATVLEGLLTDER--YDIVAVVTQPDRAVGR-KKEIR
FMT_STRGC         -----------MTKLIFMGTPDFSATVLKGLLESDQ--YEVLAVVTQPDRAVGR-KKEIR
FMT_STRP4         -----------MTKLIFMGTPDFSATVLKGLLTDDR--YEILAVVTQPDRAVGR-KKVIQ
FMT_STRS2         -----------MTKLIFMGTPAFSATVLRGLLADGN--YNILAVVTQPDRAVGR-KKVIQ
FMT_STRSV         -----------MMKIIFMGTPDFSATVLKGLLDSGQ--YEVLAVVTQPDRAVGR-KREIR
FMT_STRMU         -----------MTKLIFMGTPDFSATVLKGLLEDSH--YHVLAVVTQPDRAVGR-KKEIK
FMT_STRPM         -----------MIKLLFMGTPQFSATVLKGLLDNPA--YEILGVVTQPDRAVGR-KKDIK
FMT_LACLA         ---------MTKTKIIFMGTPQFAATVLKGLIDSNQ--YEILAVVTQPDRKVGR-KQELR
FMT_ALKMQ         ------------MRVIYMGTPEFAVAPLHSLIG---NQYDVVAVFTQPDRPKGR-GKKLQ
FMT_ALKOO         ------------MKIIYMGTPEFAVPCLEMLID---SGHEIVGVFTQPDKPSGR-GQKMN
FMT_CLOD6         ------------MKIVFMGTPDIAVPCLQKIID---ENYEILGVVTQPDKPKGR-GKKLG
FMT_CLOB8         ------------MNIVFMGTPDFAVPSLQRMIK---E-YNVTAILTQPDKPKGR-GKKMA
FMT_CLOBB         ------------MKIVFMGTPDFAVPSFKKLIE---E-HEVKAVLTQPDKPKGR-GKKLA
FMT_CLONN         ------------MKIVFMGTPEFAVPSLKAMVE---N-FNVEGVFTQPDRPKGR-GKKLA
FMT_CLOPS         ------------MKIVFMGTPDFAVPSLKSLIN---E-FGVEAVFTQPDRPKGR-GKKLG
FMT_CLOTE         -----------MMKIVFMGTPEFAVPSLERLIK---E-FGVKAVFTQPDRPKGR-GKKLS
FMT_CLOAB         -----------MLKIVFMGTPEFSVPSLEKLIE---N-YDVRAVLTQPDKPKGR-GKKLA
FMT_HUNT2         ------------MRIVFMGTPEFAIPSLEMLVR---ERYEVAAVVTQPDKPKGR-GKKTA
FMT_CALS4         ------------MRIVFMGTPEFAVPSLKRLFE---EGYDVLAVVTQPDKQRGR-GMKVS
FMT_THEYD         ----------MSSGIIFFGTPEFAVPSLKALIS---RGEKILLVVTQPDKPKGR-GKNLQ
FMT_AQUAE         -----------MKRILFMGTPQFAVPSLEE-FA---KNFKVIGVVAQPDKPAGR-GKKLT
FMT_HYDS0         ------------MRIVFCGTSSFAVPSLEL-LA---SEFEIALVITQPDKPAGR-GQKLT
FMT_FUSNN         ------------MKIIFMGTPTFAVPSLEK-IY---KEHEIISVFTKVDKPNAR-GKKIN
FMT_SULSY         ------------MKVLFWGTPDFAVKSLKALIE---SNHQVVGVITQPDKPRGR-GQKIQ
FMT_DICT6         ------------MRVIYFGTPEFSRIILEKIY----DHLNIIGIVTQPDKPKGR-GKKIL
FMT_DICTD         ------------MRIIYFGTPEFSRIILERIS----PYLNIIAVVTQPDKPKGR-GKRIM
FMT_CARHZ         ------------MRIVYMGTPEFAVKPLAKLI----SHHEVALVVTKPDAAAGR-GKKVI
FMT_SYNWW         ------------MRIVFMGTSHFAIPSLKALIA---SEHEIAGVVSQPDKQRGR-GRKVT
FMT_ANAPZ         ------------MKVVFMGSSEFSLPAFEALVSADS--YDVVAVYTKAPKPAGR-GYALT
FMT_ANAMM         ------------MKVIFMGSSEFSVPTLEFLIGSQ---HEVLAVYTKAPKPAGR-GHLLT
FMT_EHRCJ         ------------MKIIFMGSPEFSVSALSYLLENES--HEVVAVYTKIPKPAGRRGRILT
FMT_EHRCR         ------------MKIIFMGSPEFSVPALCALLEEKD--HEVIAVYTRLPKPAGRRGKVLT
FMT_EHRRW         ------------MRIIFMGSPEFSVVALSSILNNTE--HKIVGVYTRVPKPAGR-GKVLT
FMT_WOLPM         ------------MRIIFMGSPGFAVNSLSLLLKSK---SEVVAVYTKAPKPSGR-GQKPT
FMT_WOLPP         ------------MRIIFMGSPGFAVGALNLLLKLQ---SEVVAVYTKAPKPSGR-RQRLT
FMT_RICCK         ------------MKVIFMGTPEFAVPTLKKLI--AH--HEVTAVFTQQPKAKGR-GLSLA
FMT_RICTY         ------------MKVIFMGTPEFAVPTLKKLI--IH--HEVKAVFTQQPKAKGR-GLYLA
FMT_RICBR         ------------MKIIFMGTPEFAVPALTKLIN-SN--HKVVAAFTQPPKAKGR-GLSET
FMT_ORITB         ------------MKIIFMGSPEFAIPALKELVL-SK--HNVIAVFTSKPKKRDR-YLNIQ
FMT_BLOFL         -----MKLHLKGLRIAFFGTSDFAAYHLFVLIHCSI--HKIVAIFTQES--IKI-KQKSS
FMT_BLOPB         ------MVHSKSLRIAFFGTTSFAAWHLHTLAHLST--HQIIAVFTQE---IQI-STCKS
FMT_WIGBR         ------MNSSKSLRIVFAGTSQFSYEFLYALLE-SR--HVVVGILANPDRFSGR-GHKIK
FMT_BUCAI         ---------MKKLKIVFAGTEYFSAEHLHALIT-SS--HDVISVITQPDRYSGR-GQKIT
FMT_BUCAP         ---------MKKLTIIFAGTAYFSMRYLDALTK-SE--HKVIAVITQPDRPSGR-GQKII
FMT_BUCBP         ----MILNTLNSLKIVFAGTDKFSKDHLKILVTNTT--HKILGVITKPDQPLGR-GKQIT
FMT_FRAP2         ---------MKKLNIVFAGTPDISAQVLKDLYQ-SQ--HNIQAVLTQPDRAKGR-GKKIQ
FMT_FRATN         ---------MKKLNIIFAGTPDISAQVLKDLYK-SQ--HNIQAVLTQPDRAKGR-GKKVQ
FMT_PROM9         ------------MRIIFWGTPEYSISSLDIFIK-SK--HEVIAVVSQPDKKRSR-GKKLI
FMT_PROMS         ------------MRIIFWGTPEYSIASLDIFIK-SK--HEVIGVVSQPDKKRSR-GNKLI
FMT_PROM2         ------------MRIIFWGTPDYSISSLDILIK-SN--HEIIAVVSQPDKKRSR-GNKLI
FMT_PROM5         ------------MRIIFWGTPEYSVKSLEVLKK-SD--HEILAVITQPDKKRSR-GNKLI
FMT_PROMP         ------------MRIIFWGTPEYSVKSLEVLKK-SD--HDIVAVITQPDKKRSR-GNKLI
FMT_PROMA         ------------MNIIFWGTPIFCVPILEKLLK-SN--HNVLAVITQPDRRRGR-GNKVL
FMT_PROM4         ------------MKIVFWGTPEFSVPILEALIN-SD--HDVVGVVTQPDRRRSR-GNKLI
FMT_SYNPW         ------------MKILFWGTPAYAVPTLDTLHE-AG--HQIVGVVTQPDRRRGR-GKQLM
FMT_SYNSC         ------------MNILFWGTPAYAVPTLDALHG-AG--HTIVGVVTQPDRRRGR-GKQLV
FMT_SYNPX         ------------MRILYWGTPAYAVPTLRQLHQ-AG--HTIVGVVSQPDRRRGR-GQQLV
FMT_SYNS3         ------------MNILFWGTPDYAVPTLMALHQ-AG--HTIVGVVTQPDRRRGR-GKTLV
FMT_SYNS9         ------------MKILYWGTPEYAVPTLLALHA-AG--HEIVGVVTQPDRRRGR-GKQLM
FMT_SYNR3         ------------MRVLFWGTPAYAVPTLEALHG-AG--HQIVGVVTQPDRRRGR-GSSLM
FMT_PROMM         --------------MLFWGTPSYAVPTLDALND-SG--YEIVGVVSQPDRRRGR-GNQQM
FMT_PROMT         ------------MKIVFWGTPKYAAENLKTIAK-AG--YEVIAVVTQPDRKRGR-GKKLS
FMT_PELUB         ----------MTKKIVFMGTPFFAVPILKSLYE-KN--YIIPAVYTQPPKKSQR-GQKIN
FMT_CAMJ8         -----------MKKIIFMGTPSYATCILKALVENE--NFKLVALFTQPDKAVGR-KQILT
FMT_WOLSU         -----------MIRVLFMGTPAYAKTILEALWFSE--EVEVVGVVSQPDKPVGR-RQELT
FMT_CAMFF         -----------MKNIVFMGTPDYASVILEAILKNG--GYNVVAVFTQPDRPVGR-KAILT
FMT_HELAH         ------------MRIVFMGTPGFAEVILRALIENQNNNIEVVGLFTQMDKPFGR-KKELK
FMT_HELPY         ------------MRIVFMGTPGFAEVILRALVGDK--DIEVVGLFTQMDKPFGR-KKELK
FMT_SULDN         ------------MKIIFMGTPDYAAHILEKLLNTK--NIEVVALYTQPDKPVGR-KKILT
FMT_CALS8         ------------MDIVFMGTPDFAANILQKLIEEP--QFNIKLVVTQPDKPVGR-KQILT
FMT_ECOLI         --------MSESLRIIFAGTPDFAARHLDALLS--SGH-NVVGVFTQPDRPAGR-GKKLM
FMT_SALDC         --------MSDSLRIIFAGTPDFAARHLDALLT--SGH-NVVGVFTQPDRPAGR-GKKLM
FMT_KLEP7         --------MSQSLRIIFAGTPDFAARHLDALLS--SEH-QVVGVFTQPDRPAGR-GKKLM
FMT_ENT38         --------MSKKLRIIFAGTPDFAARHLDALLS--SGH-QIVGVFTQPDRPAGR-GKKLM
FMT_CROS8         --------MSESLRIIFAGTPDFAARHLDALLS--SSH-QVVGVFTQPDRPAGR-GKKLM
FMT_YERE8         --------MSDSLRIIFAGTPDFAARHLGALLS--SQH-QIVGVFTQPDRPAGR-GNKLT
FMT_YERPY         --------MSDSLRIIFAGTPDFAARHLGALLS--SQH-KIVGVFTQPDRPAGR-GNKLT
FMT_SERP5         --------MSDSLRIIFAGTPDFAARHLDALLS--SGH-QIVGVFTQPDRPAGR-GNKLT
FMT_ERWT9         --------MSESLKIIFAGTPDFAARHLDALLS--SGH-QVVGVFTQPDRPAGR-GNRVT
FMT_PECAS         --------MSDSLRIIFAGTPDFAARHLDVLLS--SGH-EVVGVFTQPDRPAGR-GNKLT
FMT_SODGM         --------MSDSLRIIFAGTPDFAARHLDALID--AKQ-QVVGVFTQPDRPAGR-GNRLT
FMT_PHOLL         --------MSDSLRIVFAGTPDFAARHLEALLM--SQH-EVVGVLTRPDKPAGR-GKKLT
FMT_PROMH         --------MSDSLRIIFAGTPDFAARHLAALLS--TQH-HIVGVLTPPDKPAGR-GKKLT
FMT_ACTP2         ---------MSKLNIIFAGTPDFAAQHLQALLD--SEH-NVIAVYTQPDKPAGR-GKKLQ
FMT_HAEDU         ---------MSKLNIIFAGTPEFAAQHLQALLA--SQH-NIVAVYTQPDKPAGR-GKKLQ
FMT_ACTSZ         ---------MKNLNIIFAGTPDFAAQHLQALLA--SNH-NVIAVYTQPDKPAGR-GKKLQ
FMT_MANSM         ---------MKPLKIIFAGTPDFAAQHLQALLN--SHH-QVIAVYTQPDKPAGR-GKKLQ
FMT_HAEIE         ---------MKSLNIIFAGTPDFAAQHLQAILN--SQH-NVIAVYTQPDKPAGR-GKKLQ
FMT_PASMU         ---------MTSLKIIFAGTPAFAAQHLQALLN--SHH-QVVAVYTQPDKPAGR-GKKLQ
FMT_HISS2         ---------MKPLNIIFAGTPDFAAQHLQALLQ--SQH-NVLAVYTQPDKPAGR-GQTLR
FMT_VIBPA         --------MSQSLRIVFAGTPDFAARHLAALLS--SEH-EVIAVYTNPDRPAGR-GKKLA
FMT_VIBVY         --------MSKPLRIVFAGTPDFAAQHLAALLS--SEH-EVIAVYTQPDRPAGR-GKKLT
FMT_VIBC3         --------MSQSLRIVFAGTPDFAARHLAALLS--SEH-EIIAVYTQPERPAGR-GKKLT
FMT_ALIFM         --------MSKPLRIIFAGTPDFAARHLSALID--SHH-EVIGVYTQPDRPAGR-GKKLT
FMT_PHOPR         --------MSKPLRIVFAGTPDFAARHLAALLS--SQH-EVIAVYTQPDRPAGR-GKKLT
FMT_AERS4         ---------MNKLKLIFAGTPDFAARHLAALLS--SDH-EVVAVYTQPDKPAGR-GQKLT
FMT_SHEAM         ---------MKPLKIIFAGTPDFAARHLQALLT--SEH-EVIAVYTQPDRPAGR-GQKLT
FMT_SHEON         ---------MKPLNIIFAGTPDFAARHLQALIN--SHH-NVIAVYTQPDRPAGR-GKKLT
FMT_SHEDO         ---------MKPLNIIFAGTPDFAARHLQALLD--SEH-NVIAVYSQPDRPAGR-GKKLS
FMT_SHEFN         ---------MKPLKIIFAGTPDFAARHLQALID--SEH-DVIATYTQPDRPAGR-GKKLT
FMT_SHEPA         ---------MKPLNVIFAGTPDFAARHLQALID--SEH-NVIAVYTQPDRPAGR-GKKLQ
FMT_SHEPW         ---------MKPLNVIFAGTPDFAARHLQALIE--SQH-KVIAVYTQPDRPAGR-GKKLQ
FMT_SHESH         ---------MKPLNIIFAGTPDFAARHLQALID--SEH-NIIGVYSQPDRPAGR-GKKLQ
FMT_SHEWM         ---------MKPLNVIFAGTPDFAARHLQALIN--SEH-NVIAVYSRADKPAGR-GKKLQ
FMT_SHELP         ---------MKPLKILFAGTPDFAARHLQALID--SEH-QVIGVYSQPDRPAGR-GKKLQ
FMT_PSYIN         ---------MEKLNIIFAGTPDFAAKHLSALIN--SEH-NVIAVYTQPDRPAGR-GKRLT
FMT_PSEHT         --------MTQPLRIIFAGTPDFAARHLQALIQ--SEH-QIVGVYSQPDRPAGR-GKKLK
FMT_COLP3         --------MVTPLNIIFAGTPEFAAQHLAALIN--SEH-NIVAVYCPPDKPAGR-GKKLT
FMT_PSEA6         --------MKSGLKIVFAGTPEFAANHLSALIE--SEH-QVIAAYTQPDRPAGR-GKKLH
FMT_IDILO         ------------MRIVFAGTPDFAAQHLQQLLD--ESH-QVVGVYTQPDRPAGR-GKKPQ
FMT_PSEE4         ------------MRIVFAGTPEFAAEHLKALLD--SPY-EIVAVYTQPDRPAGR-GQKLM
FMT_PSEPF         --------MTEPLRIVFAGTPEFAAEHLKALLD--SPY-EIVAVYTQPDRPAGR-GQKLM
FMT_PSE14         --------MTEPLRIVFAGTPEFAAEHLKALLD--SPY-QIVAVYTQPDRPAGR-GQKLM
FMT_PSEA7         ------------MRIVFAGTPEFAAEHLKALLD--TPH-QLVAVYTQPDRPAGR-GQKLM
FMT_PSEMY         --------MPDSLRIVFAGTPEFAAEHLKALLA--SQH-EVIAVYTQPDRPAGR-GQKLM
FMT_PSEU5         --------MTQPLRIVFAGTPEFAAQHLQALLD--AGK-SIVAVYTQPDRPAGR-GQKLM
FMT_CHRSD         --------MSHSLRVVFAGTPDFAAASLLALLD--SRH-QVVAAYTQPDRPAGR-GRKLT
FMT_HAHCH         --------MSSPLKVIFAGTPDFAASALQALLD--ANY-QIVAVYTQPDRPAGR-GNKLL
FMT_ALCBS         ---------MKPLRLAFAGTPDFAAASLQAVLD--NGH-QVVAVLTQPDRAAGR-GKKLQ
FMT_ACIAD         ------------MKIIFAGTPDFAATALDALIK--TPH-DIVAVYTQPDRKAGR-GQKLT
FMT_ACIBS         ------------MKIIFAGTPEFAATALAALLK--TSH-EIIAVYTQPDRKAGR-GQKLT
FMT_COXB1         ----------MSLKIVFAGTPQFAVPTLRALID--SSH-RVLAVYTQPDRPSGR-GQKIM
FMT_METCA         ------------MRIVFAGTPEFAVPTLRALIA--SGH-PPCAVYTQPDRPAGR-GRKIA
FMT_LEGPC         ---------MSGLTVVFAGTPEFGLSCLDALIQ--SRH-HLKAVYTQPDRPAGR-GRKLQ
FMT_ACIAC         ------------MKIIFAGTPEFARVALERLLA--AGA-EVPLVLTQPDRPAGR-GMKLQ
FMT_ACISJ         ------------MRVIFAGTPEFARVALERLLA--AGF-TVPLVLTQPDRPAGR-GMKLQ
FMT_DELAS         ------------MRVIFAGTPEFARVALERLLA--AGF-TVPLVLTQPDRPAGR-GMKLQ
FMT_POLNA         ------------MRVIFAGTPEFARVALAQLHG--AGF-EIPLVLTQPDRPAGR-GMKLQ
FMT_VEREI         ------------MKVVFAGTPGFARVALQRLLD--AGF-SLPLVLTRPDQPAGR-GLQWQ
FMT_METPP         ------------MRIAFAGTPEFARVALRQLLD--AGF-DVPLVLTQPDRPAGR-GLKLQ
FMT_RHOFT         ------------MRLIFAGTPEFARVALAQLHA--GGH-EIALVLTQPDRPAGR-GMKLQ
FMT_BORA1         ------------MRLVFAGTPEFARLALEALLA--AGH-EIPLVLTQPDRPAGR-GLKLT
FMT_BORPD         ------------MRLVFAGTPEFARVALDALLA--AGH-DIPLVLTQPDRPAGR-GLKLT
FMT_BORPE         ------------MRLVFAGTPEFARIALDALLA--AGH-DVPLVLTQPDRPAGR-GLKLT
FMT_PARP8         --------MSHTLRVIFAGTPEFAAAALAAIHE--AGF-PVPLVLTQPDRPAGR-GMKLQ
FMT_PARXL         --------MSHSLRVIFAGTPEFAAAALAAIHG--AGF-PVPLVLTQPDRPAGR-GMKLQ
FMT_BURM1         --------MTHTLRVIFAGTPEFAAAALAAIHD--AGF-AAPLVLTQPDRPAGR-GMKLQ
FMT_BURTA         --------MTHSLRVIFAGTPEFAAAALAAIHE--AGF-PVPLVLTQPDRPAGR-GMKLQ
FMT_RALPJ         --------MTSTLRVAFAGTPEFAQIALAAIHQ--AGF-PVVAVLSQPDRPAGR-GMQLQ
FMT_HERAR         ------------MKIIFAGTPEFAAVALAALHA--AGF-EIPLVLTQPDRPAGR-GMQLQ
FMT_JANMA         ------------MKIIFAGTPEFAAVALAALHA--AGF-EIPLVLTQPDRPAGR-GMQLH
FMT_CHRVO         ------------MKLIFAGTPEFAAAALRELIA--AGH-EIALVLTQPDRPAGR-GMKLK
FMT_THIDA         ------------MRVIFAGTPPFAAAALEALVA--AGH-EIVLVLTQPDRPAGR-GMKLA
FMT_AROAE         -------MTAAPLKVAFAGTPEFAAAALEAILA--AGF-EVPLVLTQPDRPAGR-GMKLS
FMT_NEIM0         ------------MKVIFAGTPDFAAAALRAVAA--AGF-EIPLVLTQPDRPKGR-GMQLT
FMT_DECAR         ------------MKLIFAGTPEFAAQALQGIVN--AGH-EVALVLTQPDRPAGR-GMALQ
FMT_METFK         ------------MKIIYAGTPDFAVPALRALIQ--SSH-EVSLVLTQPDRPAGR-GLKLK
FMT_POLNS         ------------MKIVFAGTPEFAAQAVRAIHA--AGH-EIVLAFTQPDRRAGR-GMHLQ
FMT_POLAQ         ------------MKIVFAGTPEFAAQAMRAIHA--AGH-EIVLALTQPDRRAGR-GMHLQ
FMT_NITEC         ------------MKIIFAGTPVFAAKALEAVQK--SGF-DILLVLTQPDRPAGR-GMKLQ
FMT_NITEU         ------------MRIIFAGTPDFAARALEELQK--AGL-DIVLTLTQPDRPAGR-GMKMQ
FMT_NITMU         ------------MRIIFAGTPPFAAAALEALAD--AGH-EIALVLTQPDRPAGR-GMKNA
FMT_STRM5         ------------MRIVFAGTPEFAVSSLRAAAR--HH--EVVAVYTQPDRPAGR-GRGLA
FMT_XANC8         ------------MRIVFAGTPDFAVASLRAAAQ--RH--EVVAVYTQPDRPAGR-GRGLT
FMT_XYLFA         ------------MRIVFAGTPDFAVPSLRSVTQ--RA--DVVAVYTQPDRPAGR-GRELT
FMT_HALHL         ----------MAARIVFAGTPDFAVPGLDALVE--AGV-RPVAVFTQPDRPAGR-GRRLT
FMT_GLUDA         ------------MRLAFMGTPDFAVPALHALHE--AGH-EIAVVYSQPPRPAGR-GQAVR
FMT_GLUOX         ------------MRLIFMGTPDFSVPALHALLD--AGH-EVVAVYTQPPRPAGR-GKALR
FMT_ACICJ         ------------MRLAFMGSPGFAVPALRALHA--AGH-DIVAVYCQPPRPVGR-GHRIH
FMT_GRABC         --------MAERLTLAFMGSPDFSVPALHALHQ--AGH-HIAAVYTQPPRPAGR-GHRLT
FMT_AGRFC         ----------MSLRIIFMGTPDFSVPTLRALVE--AGH-EIVAVYTQPPRPGGRRGLDLQ
FMT_RHILW         ----------MSLSIIFMGTPEFSVPTLRLLVD--AGH-RIVAVYTQPPRPGGRRGLDLQ
FMT_RHIME         ----------MPLRMIFMGTPEFSVPTLLALAG--AGH-EIAAVYTQPPRPGGRRGLDLQ
FMT_SINMW         ----------MPLRIIFMGTPEFSVPTLLALAG--AGH-EIAAVYTQPPRPGGRRGLDLQ
FMT_CHESB         ----------MTLRLVFMGTPEFSVPTLRALAG--AGH-EITAIYTQPPRPAGRRGLELT
FMT_OCHA4         ------------MRVVFMGTPEFSVPILTAIIG--HGY-EVVAAYTQPPRPAGRRGLELT
FMT_RHILO         ----------MPLRVIFMGTPEFSVPTLRAIAK--AGH-EISAVYTQPPRAAGRRGLELT
FMT_BRADU         ----------MPLRLIFMGTPDFSVPTLLELVA--HGH-EIVAVYTRAPKPGGRRGLQLQ
FMT_BRASO         ----------MPLRLIFMGTPDFAVPTLLELAG--HGH-EIVAVYTRAPKPGGRRGLALV
FMT_NITHX         ----------MPLRLIFMGTPEFAVPTLLQLIA--HGH-EIAAVYTREARPAGR-GMKLQ
FMT_NITWN         ----------MPLRLIFMGTPDFAVPTLQQLVA--HGH-EIAAVYTREARPAGR-GMKLQ
FMT_RHOP2         ----------MPLRLVFMGTPDFAVPTLLALSA--YGH-DIAAVYSREPKPAGR-GMKLQ
FMT_RHOPT         ----------MPLRLVFMGTPEFAVPTLLALAA--HGH-DIAAVYTREPKPAGR-GMKLQ
FMT_RHOPB         ----------MPLRLIFMGTPDFAVPTLRTLAA--AGH-QIVAVYSREAKPSGR-GMKLQ
FMT_OLICO         ----------MPLRLIFMGTPDFAVPTLRELHA--QGH-EIAAVYTRAAKPAGR-GMKLQ
FMT_METS4         ----------MSLKVVFMGTPDFAVPTLAEIVG--GGH-EVVAVYTRAPAPAGR-GMALR
FMT_PARL1         ------------MKLAFMGTPDFSVPVLAEILA--AGH-EVVAVYSQPPRKAGR-GMAEQ
FMT_CAUVC         ------------MRIAFLGTPDFAVTCLAELVA--SGH-EIVCVYSQPPAPRGR-GQDLK
FMT_CAUSK         ------------MRIAFLGTPEFSVACLAELVA--AGH-EIACVYSQPPAPRGR-GQDLK
FMT_PHEZH         ------------MRLAFLGTPDFAVQALAEIVE--AGH-EVACVYSQPPAPRGR-GHELR
FMT_RUEPO         ------------MRVVFMGTPDFSVPVLEALVA--AGH-EIAAVYCQPPRPAGR-GKKDR
FMT_RUEST         ------------MRVIFMGTPEFSVPVLDALVE--AGH-EIAAVYCQPPRPAGR-GKKDR
FMT_DINSH         ------------MRLVFMGTPAFSVPVLDALVA--AGH-EVAAVYCQPPRPAGR-GKKPR
FMT_ROSDO         ------------MRLVFMGTPDFSVPVLEALVA--AGH-EIACVYSQPPRPAGR-GKKDR
FMT_JANSC         ------------MRIIFMGTPDFSVPVLDALVA--AEH-EVVAVYSQPPRPAGR-GKRDR
FMT_RHOS1         ------------MRLIFMGSPDFSVPVLEAL-H--AHH-EVVCVYCQPPRPAGR-GKKDR
FMT_RHOS5         ------------MRVVFMGSPDFSVPVLEAL-H--AHH-EVVCVYCQPPRPAGR-GKKDR
FMT_PARDP         ------------MRVIFMGTPDFSVPALRAI-A--ARH-QVVAVYSQPPRAAGR-GQKPR
FMT_NOVAD         ------------MRIIFMGTPDFAVPTLEALVA--AGH-DVVAAYSQPPRPAGR-GKKLQ
FMT_SPHWW         ------------MRIAFMGTPDFAVPTLDALVA--AGH-ELAAVYCQPPRPAGR-GKALM
FMT_SPHAL         ------------MRIAFMGTPPFAVPTLAALHT--AGH-DIAAVYSQPPRPAQR-GKKLQ
FMT_ZYMMO         ------------MKIIFMGTPDFALPTLNALVD--AGH-EIVAVYSQPARPAGR-GKAPR
FMT_MAGSA         ------------MKLVFMGTPDFSVPILDSLIE--AGH-QVICVYSQPPRPAGR-GHKEQ
FMT_BARQU         ----------MGLRLSFMGTPHFSVPILHALLD--AGH-DIVAVYSQPPRPAGRRGLKMI
FMT_BART1         ----------MALRLSFMGTPDFSVPILHALLD--AGH-DVVAVYSQPPRPAGRRRLKLI
FMT_BARHE         ----------MVLRLSFMGTPDFSVPILQALLD--AGH-DIAAVYSQPPRPAGRRGLKLI
FMT_BARBK         ----------MALRLSFMGTPDFAVPVLHALLN--AGH-DIVAVYSQPPRPAGRRGLQLV
FMT_MAGMM         ---------MTAWRVVFMGTPDFATGTLQALLD--GPD-TVVAVFTQPDKPVGR-GMKMQ
FMT_SYMTH         -----------MLKILFMGTPEFAAVSLRALLE--AGY-PVVGVVTQPDKPAGR-GGKLR
FMT_BDEBA         ---------MSKVRVCFLGTPEFAVTSLKALLS--DEHFEVVGVVTQPDRPAGR-KLQLT
FMT_TRIV2         ------------MKIVFFGTPEFAVPTLEKLLL--NQEFEVLAVVTQPDKRRER-GNKLT
FMT_TRIEI         -----------MMKIIFFGTPLFAVPTLKKLLD--NPKIEVTAVVTQPDKRRGR-GNKLI
FMT_GLOC7         ------------MKVVFFGTPQFAVPSLERLLE--HSDIDVVAVVTQPDKPRGR-GKQLI
FMT_MICAN         ------------MRIVFFGTPTFAVPTLKKLLA--NPDIEIITVVTQPDKRRGR-GNQLI
FMT_SYNP2         -----------MLKVVFFGTPQFAVPYLEALLN--HPDIEVLGVVTQPDKRRGR-GSQLI
FMT_SYNY3         -----------MMKTVFFGTPDFAVPTLEALLG--HPDIDVLAVVSQPDRRRGR-GSKLI
FMT_SYNP6         ------------MRVVFFGTPQFAVPTLQQLLD--APDVEVMAVVSQPDRRRGR-GNQVS
FMT_THEEB         ------------MNIVYFGTPEFALAPLQRLLQ--TETYQVLGVVTQPDRRRGR-GNQLS
FMT_GLOVI         ------------MRVVYFGTAEFAVPTLEALLA--AREIEVVAAVSQPDRPQGR-GNRLT
FMT_SYNJA         ------------MRVVFFGTPEFALPSLQILLQP-QSPFEVVGLVCQPDRPQGR-GQKVL
FMT_DEIRA         ------MSAAAGPKVAFFASPAFALPVLEALRA----EFEVVLVVAQPDKPVGR-GLKLT
FMT_THET8         ------------MRVAFFGTPLWAVPVLDALRK----RHQVVLVVSQPDKPQGR-GLRPA
FMT_ROSCS         ----------MSLRIVFLGSPTFAVLPLERLVAD-SRY-QVVGVVTQPDRPAGR-GKMPV
FMT_ROSS1         ----------MPLRIVFLGSPAFAVAPLERLVAD-ARY-QVVGVVTQPDRPAGR-GRASV
FMT_CHLAA         ------------MRILFLGSPSFAVHALEALVA--AGH-EIVGVVTQPDRPAGR-DRRLT
FMT_HERA2         ------------MRILYLGTPEIAVAPLELLHA--SGH-EIVGVVTQPDRPAGR-KNVLT
FMT_DEHMB         ------MAVMNELKIVFMGSPEFALTPLKMLLA--EGY-DICGVYTQPDRPAGR-GRELC
FMT_AKKM8         ------------MRIVFMGTGDIAIPAFRSLIRHS----DLAGLVTQPDRPVGR-HQV--
FMT_DESVV         ------MAESAPLKIVFMGTPDFAAASLRHLLAWDG--CDVVGVYTQPDRPCGR-GQQ--
FMT_MYXXD         ---------MSRPRIVFMGTPEFAVSSLAACFELG---D-VVAVVTQPDKPKGR-GNT--
FMT_SORC5         ------------MRALFFGTPAIAVPSLEALASIA---D-VVGVVCQPDRPAGR-GLE--
FMT_ANASK         ------------MRIAFLGTPAFAVAALDALDWAG---HALVTVVAQPDRPAGR-GQA--
FMT_KORVE         ------------MILVFCGTPRFAVPSLEHIVRAG---HDVRLVVTQPDRPKGR-GMG--
FMT_SOLUE         ------------MRLVFLGTPAFAVPTLEAVVRAG---HEVAAVLTQPDRPRGR-GQN--
FMT_GEOBB         ---------MTGMRIVFMGTPEFACPTLRTLIERG---EKVVAVVTQPDRPKGR-GQQ--
FMT_GEOUR         ---------MAGMRIIFMGTPEFACPTLQKLLDRG---EDVIAVITQPDRPKGR-GQQ--
FMT_GEOMG         ---------MAGLSIIFMGTPDFACPTLTRLIERG---EDVIAVVTQPDRPKGR-GQK--
FMT_GEOSL         ---------MAGLRIIFMGTPEFACPTLRKLIERG---EEVIAVVTQPDRPKGR-GQK--
FMT_GEOLS         ---------MTGWRIIFMGTPEFACPTLQTLLDRT---ENVVAVFTQPDRPKGR-GQK--
FMT_PELPD         ---------MSSRSIVFMGTPEFACPTLQALIDRG---ERLLAVVTQPDRPKGR-GHK--
FMT_SYNAS         ---------MAKISILFMGTPEFALPSLEILVRNG---YPIAAVVTQPDRPKGR-GKQ--
FMT_DESPS         MVSSQIESEEKSLRIIFMGTPDFASSNLRALLAGP---DQVVAVVTQPDRPKGR-GKK--
FMT_DESRM         ------------MRIVFMGTPDFAATSLKALIDAG---QQVVAVVTQPDKPKGR-GRQ--
FMT_PELTS         ------------MRVVFMGTPDFAVPSLKALVEAG---HDVLAVVTQPDRPRGR-GRK--
FMT_MOOTA         ------------MRLVFMGTPDFAVPSLQALVAAG---HEFAAVITQPDRPRGR-GKK--
FMT_HELMI         ------------MRLVFMGTPDFAVPTLEAIVAAG---HEVALVVTRPDRPRGR-GQK--
FMT_NATTJ         ------------MRTIFMGTPDFSVPFIEAIARST---HNLNLVVTQPDRRKGR-GKE--
FMT_METI4         -----------MMRVVFIGTGDFGVPSLEAIALDGR--YTIPAVVTQADKPLGR-QKE--
FMT_RHOBA         ---MEPRRMADSLRYVLMGTGPFAVPSFEAIRQQMD--STGDQIARVFVRPLPP-VKSRG
FMT_FRAAA         ------------MRLVFAGTPAVALPSLRALIDSP--RHEVVAVVTRPDRPAGR-GRKIK
FMT_FRACC         ------------MRLVFAGTPAVALPSLRALIDSP--RHDVVAVVTRPDRPSGR-GRKVK
FMT_FRASN         ------------MRLVFAGTPAVALPSLRALLDSP--RHQVVAVVTRPDRPAGR-GRHQR
FMT_SACEN         ------------MRLVFAGTPEPAVPSLRALIESA--NHEVAAVVTRPDAPAGR-GRKLM
FMT_SALTO         ------------MRVIFAGTPAVAVPTLAA-VAAS--RHDLVAVLTRPDAPAGR-GRGLS
FMT_STRCO         ------------MKLVFAGTPEVAVPALDALIASG--RHEVAAVVTRPDAPAGR-GRRLV
FMT_STRGG         ------------MKLVFAGTPEVAVPALDALIASD--RHEVAAVVTRPDAPAGR-GRRLV
FMT_STRAW         ------------MKLVFAGTPEVAVPALDALIASG--RHEVAAVVTRPDAPAGR-GRRLV
FMT_THEFY         ------------MRLVFAGTPEVAVPSLDALLASE---HEVVAVVTRPDAAAGR-GRRLV
FMT_MYCBP         ------------MRLVFAGTPEPALASLRRLIESP--SHDVIAVLTRPDAASGR-RGKPQ
FMT_MYCLE         ----------MLVRLVFAGTPESALPALCRLIDSP--RHDVIAVLTRPDAASGR-RGKPE
FMT_MYCPA         ------------MRLVFAGTPEPALPALRRLLDSP--RHEMIAVLTRPDAASGR-RGKPE
FMT_MYCUA         ------------MRLVFAGTPETALPALHQLIDSP--RHDVIAVLTRPDAASGR-RGKPE
FMT_MYCS2         ------------MRLVFAGTPEPALPSLRRLIESP--RHDVVAVLTRPDAAAGR-RGKPR
FMT_MYCSS         ------------MRLVFAGTPEPALPSLQRLIASP--RHEVVAVLTRPDAAAGR-RGRPT
FMT_MYCGI         ------------MRLVFAGTPEPALPSLQRLIDSA--RHDVIAVLTRPDAAAGR-RGRPS
FMT_MYCVP         ------------MRLVFAGTPEPALPSLQRLIDSD--RHEVIAVMTRPDAVAGR-RGRPS
FMT_MYCA9         ------------MRIVFAGTPAPALPSLERLLAS---RHEVVAVLTRPDARAGR-GRASA
FMT_NOCFA         ------------MRLVFAGTPEPAVPSLRRLIASP--RHEVVAVVTRPDAVAGR-GRKIT
FMT_NOCSJ         ------------MRVVFAGTPEVAIPVLDAVAASS---HELVAVVTRPDAPAGR-GRRLL
FMT_ACIC1         ------------MRLLFAGTPQTALPSLRLLLESS---HEVVAVLTRPDAPAGR-GRTPR
FMT_KINRD         ------------MRLVLAGTPEVAVPALDALLAS---RHEVVAVLTRPDAAAGR-GRKQV
FMT_PAEAT         ------------MRVLFAGTPAVAVPSLDALVKAG---FDVVAVLTRPDAPVGR-KRVLT
FMT_ARTS2         ------------MRVLFAGTPAVAVPSLDALVQAG---FDVVAVLTRPDAPVGR-KRVLT
FMT_RENSM         ------------MRVLFAGTPAVALPSLEALLAAG---FDVVGVLTRPDAPIGR-KRVLA
FMT_CLAM3         ------------MRLVFAGTPRAAVPSLVRLHASG---HEVALVVTRADAPTGR-KRQLT
FMT_CLAMS         ------------MRLVFAGTPLAAVPSLQRLAASG---HEVALVVTRADAPLGR-KRVLT
FMT_LEIXX         ------------MRLVFAGTPAVAVPSLTALAAR----FEVAAVITREDAPLGR-KRILT
FMT_CUTAK         ------------MRLLFAGTPDVAVPTLTALVADP--RHEVAAVLTRPDAAVGR-HRTPR
FMT_BIFAA         -----------MLKVLFAGTPDVAVPSLKLLAQDTE-HFEVVAVLTRPDAPTGR-GRKLV
FMT_BIFLD         -----------MLKLVFAGTPDVAVPSLKAFAADP--RFDVVGVITRPDAPTGR-GRKLT
FMT_COREF         ------------MRLVFAGTPEPAVVALQKLIDSEH---EVVAVLTQPDARRGR-GRTLH
FMT_CORGB         ------------MRLVFAGTPEPAVVALQKLIDSDH---EVVAVLTQPDARRGR-GRTLH
FMT_CORDI         ------------MRLIFAGTPEPAVVVLSRLLESEH---EVVAVLTRPDARRGR-GRTLH
FMT_CORJK         ------------MKIVFAGTPEPAAVALEHLIADERI--EVVAVVTQPDAKRGR-GRSLR
FMT_CORU7         ------------MKILFAGTPKPAAIVLEHLLTDPRL--EVLGVITQPDARRGR-GRSLH
FMT_RUBXD         ------------MRVAFAGTPEFAATVLRGLLGSG---HEVGLVISQPDAPRGR-GRRTA
FMT_BACFN         -------MKKEDLRIVYMGTPDFAVEALQCLVE---GGYNVVGVITMPDKPAGR-GHKIQ
FMT_BACTN         -------MKKEDLRIVYMGTPDFAVEALRQLVE---GGYNVVGVITMPDKPAGR-GHKIQ
FMT_BACV8         -------MEKKDLRIVYMGTPDFAVESLKRLVE---GGYNVVGVITMPDKPMGRHGSVLQ
FMT_PARD8         -------MKKEDLRIVYMGTPDFAVESLRALVE---GGYNVVGVITMPDKPMGRHGSVLQ
FMT_AZOPC         -------MTASKARIVFMGTPDFAVASLDALIG---EGYNVVGVVTIPDKSIGKHQSIPQ
FMT_PORG3         -------MKKEELRLIFMGTADFAVPALRALVE---NGYQVKAVVTMPDKPMGR-GHKVS
FMT_CHLCH         ------------MRIIVMGTPDFAVPSLQAIAAMG-NGFDIVLVVTGQDKPRKSKHAAAE
FMT_CHLPD         ------------MRIVFMGTPEFAVPSLRSIAAEH-NHFELVLVVTGSDKPRRGRNAPSE
FMT_CHLL2         ------------MRIVFMGTPDFAVPSLQRIASEN-HDFEIVLVVTGRDKPRRKKNALPE
FMT_PELLD         ------------MRILFMGTPEFAVPSLRAVAGAG-PGFEVVMVVTGPDRPRRSRNSAPE
FMT_CHLPM         -------MHVTPLRLIFMGTPDFAVPSLQAIVDAS-LPVEVVQVVTAPDRPRRKKNAEAE
FMT_CHLPB         ------------MRVIFMGTPLFAVPSLRAVAEAD-NDVEIVLVVTGKDKPRRSQRAEPE
FMT_PROA2         ------------MRIIFMGTPDFAVPSLKAIAAMD-GDFEVQLVVTGKDKPRRSKRSEPE
FMT_CHLTE         ----------MGLRVVFMGTPEFAVPSLRRIAAMK-PQFETVLVVTGCDKPRRSKNSPPE
FMT_CHLAB         ----------MSLKIVYFGTPQFAATVLADLLH---HEVNVVAVVTRVDKPQKR-SSQLI
FMT_CHLCV         ---------MLNLKVIYFGTPQFAATVLEDLLH---HDVNVIGVVTRVDKPQKR-SSQPI
FMT_CHLPN         ----------MNLKVVYFGTPTFAATVLQDLLH---HKIQITAVVTRVDKPQKR-SAQLI
FMT_CHLMU         ---------MLNLRVVYLGTPQFAATVLETLVD---ARIHVVGVVTRADKPQKR-SSKPI
FMT_CHLTA         ----------MSLRVVYLGTPQFAATVLKTLLD---AHTHIVGIVTRADKPQKR-SSKLI
FMT_PARUW         -------MRNRKMKVIFFGTPLFAAQVLEFLLQ---NQVEVVAVISKPDRPKGR-SSIPV
FMT_BORAP         ------------MKIFFVSSSSIALEVFKEIVKHY----EVVGVLTLPDKPKGR-GQKLS
FMT_BORBP         ------------MKIFFVSSSFIALEVFKEILRHY----EVVGVLTLPDKPKGR-GQKLS
FMT_BORHD         ------------MRIFFASSESIALEVLKKVADQH----NVVGVLTAPDKPSGR-GLFLR
FMT_BORRA         ------------MRIFFASSDGIALEVLKKISDQY----DVVGVLTAPDKPSGR-GLSLK
FMT_TREDE         ------------MRILFAGTPSCAVPALNLIAREF----DLCGVLTNPPAPAGR-NKKMQ
FMT_TREPS         -----------MVRVFFAGTPECAVPSLRRVACAH----RVVGVLTNPPAAVGR-SGKLV
FMT_LEPBL         ------------MKIGYFGTPEHSAKLLKALIDSTLA--EVLFVVTNPDRPKGR-NKKTE
FMT_LEPIC         ------------MKIGYFGTPEHSAKLLEALIDSQLT--EVLFVVTNPDRPKGR-SKIPE
FMT_ELUMP         ------------MKTIFFGTPEVAVPYLEILNRYT----EVVLVVTQPDRPRGR-GMVIT
FMT_UNCTG         ------------MRILFFGTAFISETYLKELHKKC----HEIFVVTTPDKPALR-GQKLI
D1B5G6_THEAS      ------------MKWAVLSSGPFGALWLEGLLAVGR---RPLWIMTKPPRPAGR-GYRER
FMT_COPPD         ------------MKIAFFSSGTFGLPVLEELKKEN----HEIVLITKVDAPSGR-GLKLQ
FMT_THEAB         ------------MRILFLGTPSFASEHLEFLIKNNF---DVVAVISQPDKPKGR-GKKVQ
FMT_THEM4         ------------MRILFLGTPDFASVHLEFLMKNGF---DVVAVISQPDKPKGR-GKKIL
FMT_FERNB         ------------MRILFMGTPEFAASYLDFLIQKKF---NVVAVISQKDKPRGR-GQKLL
FMT_THEMA         ------------MRIVFVGTPEFAAEILEHLIKNGF---NVVGVVTQPDKPRGR-GRKVA
FMT_PSELT         ------------MKILFLGTPLYASRHLEALLSAGH---MVIGVITQPDKPAGR-GLRMV
FMT_MESFL         ---------MEKIKVIFCGTPQIGADILTTLTEM--ENVEVVLVISQPDRPVGR-KKELK
FMT_MYCMS         --------MQNKIKVVFCGTPKIGADVLKALIEM--NQVEIVLVISQPDKPIGR-KKQIV
FMT_UREP2         ----------MKYKVMFFGTPEIAKIVLETLFNM--HEVDLIAVVSQPDAHFDR-KKNVI
FMT_UREU1         ----------MKYNVMFFGTPEIAKIVLETLFNM--PEVNLIGVVSQPDSHFDR-KKNVV
FMT_MYCPE         --MGEKRNSCKNKKIVFMGTPEIATYALNALLE---KSFDVVAVVCQPDKPIGR-KKEII
FMT_MYCPU         ------------MKLLLAGTPEFSVPIFEELIK----KFEIVAIITQPDKPKNR-GYSLE
                                    .:       .                                

FMT_BACVZ         --------PPPVKAEAERH--GIPVLQPEKVRLE-----------EEIEKVLSL---KPD
FMT_BACSU         --------PPPVKEEALRH--GIPVLQPEKVRLT-----------EEIEKVLAL---KPD
FMT_BACLD         --------PPPVKEEALRR--GIPVLQPEKVREE-----------AETDKILAL---EPD
FMT_BACP2         --------PPPVKVEALKH--GIPVLQPEKVRLD-----------EEIDKVLAL---KPD
FMT_BACCN         --------PTPVKVEAEKH--GIPVLQPLKIREQ-----------DEYEKVLAL---EPD
FMT_BACMK         --------PTPVKVEAEKH--GIPVVQPLKIREK-----------DEYEKVLAL---EPD
FMT_GEOTN         --------PPPVKVEAQKH--GIPVLQPTKIREP-----------EQYEQVLAF---APD
FMT_BACHD         --------PPPVKVEAEKH--QIPVLQPEKIRDE-----------AELERLFSF---EPD
FMT_OCEIH         --------PPPVKEEAIKH--DLDIFQPEKLR-------------DDYKKITDL---KPD
FMT_STAAW         --------PPPVKKVAMKY--DLPVYQPEKLSGS-----------EELEQLLQL---DVD
FMT_STAEQ         --------PPPVKRVATKH--QIPVYQPEKLKDS-----------QELDVLLSL---ESD
FMT_LYSSC         --------PPPVKAAALEL--GLPIIQPEKLRGS-----------EELQQILSL---QPD
FMT_LISMF         --------PPPVKKAALEL--AIPVYQPEKLRTS-----------SELEELIAL---EAD
FMT_BACSK         --------PSPVKEEAQKH--GIPVLQPEKIR-------------EQHEDILAF---APE
FMT_LACBA         --------ASPVKQVAVAH--DIEVLQPEKISGS-----------SEMARAIEL---APD
FMT_PEDPA         --------PSPVKKVAVKN--DIKVYQPEKLSGS-----------AELTELIAL---NAD
FMT_LACPL         --------ASPVKEVAVAH--DIPVFQPEKISGS-----------PEMQQIIDL---QPD
FMT_LACF3         --------ATPVKELALEN--GIEVLTPEKINHS-----------PEMDRVIEL---APD
FMT_LACS1         --------ASPVKEVALKY--GIKVFQPVKLSGS-----------DEMQEIIDL---QPD
FMT_LACCB         --------ASPVKQAAQKH--DIPVLQPEKLSGS-----------PELAQAIAM---APD
FMT_LACSS         --------QTPVKEAAVRL--DLPVFQPEKLSGS-----------PELADVIAL---QPD
FMT_ENTFA         --------PTPVKEAALKH--NLLVLQPEKISGS-----------PEMEKVIDL---APD
FMT_LACAC         --------KTPAKIAAEKH--DLPVLQPVKLSGS-----------EEMNQLIDM---HAD
FMT_LACJO         --------QSAVKETALKH--NLPVYQPAKLSGS-----------EELAELMKI---EPD
FMT_LACDB         --------YSPVKEVALAN--DLPLYQPVRLSKS-----------DELDELLQL---DAD
FMT_STRA5         --------MTPVKEVALEN--NIPVYQPEKLSGS-----------PELEQLMTL---GAD
FMT_STRT1         --------MTPVKELALAH--ELPIYQPEKLSGS-----------EEMAQLISL---GAD
FMT_STRGC         --------ITPVKEVALSY--GLPIYQPEKLSGS-----------PEMEAIMNL---GAD
FMT_STRP4         --------ETPVKQAAKEA--GLSIYQPEKLSGS-----------PEMEELMKL---GAD
FMT_STRS2         --------MTPVKEVALEY--NLPVYQPEKLSGS-----------QEMDELMNL---GAD
FMT_STRSV         --------MTPVKELALEY--KLPVYQPEKLAKS-----------SDLEELMNL---EAD
FMT_STRMU         --------MTPVKQLALEH--GLKVYQPEKLSGS-----------SEMVELMNL---GAD
FMT_STRPM         --------VTPVKQLALEH--GISIYQPEKLSGS-----------QELIEIMEL---GAD
FMT_LACLA         --------MTPVKELALTV--NLPVLQPEKLSGS-----------VEMTQIMTLLESGEV
FMT_ALKMQ         --------STPVKELALAH--GLMLYQPIKLR-ESS----------VVEIIKSLEPD---
FMT_ALKOO         --------RTPVKEKALAH--NIPVFQPHTLR-DTN----------VMNEIENLKPD---
FMT_CLOD6         --------MSPVKELAIEN--NIPVYQPVKAR-DKE----------FIDKIKSLNPD---
FMT_CLOB8         --------YSAVKEEGLKH--EIPIYQPIKLKDDRD----------LIEKLKELKPD---
FMT_CLOBB         --------YSPVKEEALKH--DIPVYQPTKLKDDKE----------IIEKLKEINPD---
FMT_CLONN         --------MSPVKEVALEN--NIDVYQPVSLRKEPE----------FIEKLKNIQPD---
FMT_CLOPS         --------MSPVKEVALEH--NIPVYQPLRLKNEPE----------TIEELKNMEPD---
FMT_CLOTE         --------ISPIKEVALRE--NIKILQPQKLRDDRE----------AIEFLKKLSPD---
FMT_CLOAB         --------MSEVKEVAVKN--NIPVFQPVKLKNDIE----------VINKLKEIAPD---
FMT_HUNT2         --------MPPVKEFAIKN--NIEVLQPSKVKT-PE----------FVSTIRELRPD---
FMT_CALS4         --------FSPVKELALQK--GVKVLQPESVKNNPE----------FLQELKELNPE---
FMT_THEYD         --------APEIKKVALQC--GLPLCQPEKMK-DDN----------FIKKLKSLNPE---
FMT_AQUAE         --------PPPTKVLAQKL--GIPIYQPEKK---KE----------LIPLVEELKPD---
FMT_HYDS0         --------PPPVKQKALEL--NLNISQPEKI---SF----------LKEELLNIKPD---
FMT_FUSNN         --------YSPIKEFALAN--NLKIYQPENFKDNT-----------LIEEIRNMQAD---
FMT_SULSY         --------PTPVKEEALKH--NIPVFQPEKIKNNQE----------ILETIKKLNPD---
FMT_DICT6         --------PSPVKQFAINK--GITVYQPEKLKGNIE----------FFNIIKDLKPD---
FMT_DICTD         --------CSPVKDFAISK--GIPVYQPEKLKGNKE----------FFEIIRSLNPE---
FMT_CARHZ         --------SSPVKLFAQEN--HLRVITP--LKFNEE----------VYQEILAVKPE---
FMT_SYNWW         --------PTPVKEIAEQY--KLELLQTANIKTP-E----------SIKRIKQWKPE---
FMT_ANAPZ         --------KTPVHICAEGK--GIPVRSPVSLRAEGE-----------ESIMAEYAPD---
FMT_ANAMM         --------KTPVHAYADAH--NVPVRSPASLSSDSE-----------RDIIEKYMPD---
FMT_EHRCJ         --------KTPVHIIAEQN--NIEVNTPKSLKHDAE-----------QEKILSLNPD---
FMT_EHRCR         --------KTPIHIIAEQN--NIEVNTPKSLKHDYE-----------QEKIFALNPD---
FMT_EHRRW         --------KTPIHTVAEMH--GLTVYTPKSLKRIEE-----------QDRIKELNPD---
FMT_WOLPM         --------KSPVHVIAEES--NIEVCTPISLKFSAE-----------QEKFRNFKPD---
FMT_WOLPP         --------KSPVHIVAEKS--DIEVCTPASLKSSIE-----------QEKFGNFKPD---
FMT_RICCK         --------QSPIHQLACEH--QIPVYTPSTLRNDKT-----------INLINKVNAD---
FMT_RICTY         --------KSPIHQLAFEH--QIPVYSPSTLRNDET-----------INLINKVDAD---
FMT_RICBR         --------KSPIHQLADEA--QIPVYTPTTLRNEEA-----------ANLINNIDAD---
FMT_ORITB         --------RSPIHKLASAL--SIPVYTPDSLKTNDV-----------QNLIATFDAD---
FMT_BLOFL         --------ILSIHTISQIN--NILLFQS-YFLSQSQ----------INHIIKNLNID---
FMT_BLOPB         --------FLSLHKIAKKY--NISLFQS-RTLSISD----------IIYIIKKINVD---
FMT_WIGBR         --------FSPVKKLAKYY--NIKILQPDSTESLDN----------LENDLKKMRCD---
FMT_BUCAI         --------FSPVKILSLNN--GIPIFQP-ENLNDTD----------FQNKLLKLNAD---
FMT_BUCAP         --------FSPVKILSIKR--NIPIFQP-SELKNEK----------IQREIFNLNAD---
FMT_BUCBP         --------SSLTKKLAKKL--KIPVFQP-TALNTST----------FYNQIYNLNAD---
FMT_FRAP2         --------FSPVKEVAIAN--NTLVLQPLSFKKDPQ----------VLEQIRELKPD---
FMT_FRATN         --------FSPVKEVALAN--HTPVFQPLSFKKNPE----------VLEQIKQLKPD---
FMT_PROM9         --------SSPVKSFAEQE--SIKIYTPEKIRDNIN----------FINELKSLSCD---
FMT_PROMS         --------SSPVKSFAEQE--SIKIYTPVKIRDNIH----------FINELKSLSCD---
FMT_PROM2         --------ASPIKSFAEQE--YIKIYTPEKIRNNIP----------FINELKSLSCD---
FMT_PROM5         --------ASPVKQYAMKE--GLPVFTPETLKKNDH----------FISLLKEFSCD---
FMT_PROMP         --------SSPVKEYATKE--NIPVFTPETIKENIQ----------FISILNDLSCD---
FMT_PROMA         --------PSPIKQKALEE--NLPIYTPVNITKEKD----------IQAKIKQYNAD---
FMT_PROM4         --------HSPVKTVALEN--NIPVLTPQNIRQESL----------IQQKIINLKAD---
FMT_SYNPW         --------PSPVKARAQEL--GCPVFTPERIRRDLD----------CQQQLNALDAD---
FMT_SYNSC         --------PSPVKARAEEL--GLPVFTPERIRRDDD----------CKAKLAALGAD---
FMT_SYNPX         --------ASAVKQEALNL--NLPVFTPERIKKDSD----------CQAQLAALKAD---
FMT_SYNS3         --------PSAVKAKAIKM--GLRVFTPERIKQDET----------CQQQLAELQPD---
FMT_SYNS9         --------PSAIKVCAQSL--GLAVFTPERIKTDVG----------CQKELADLNAD---
FMT_SYNR3         --------PSPVKARALDLLGDVPVLTPQRIRREPE----------TQEQLAALQAD---
FMT_PROMM         --------ASPVKQRAMDQ--GLRLFTPERIRDEGD----------IQAELKSLKAD---
FMT_PROMT         --------PSPVKEAAEEL--SIPVYATNSISKDQK----------TKEILLNLKAD---
FMT_PELUB         --------KSPIQIVAEDY--NIDCRTPDTLKTNKE----------EYEYLKQLDLD---
FMT_CAMJ8         --------PSDTKAFLSQNYPSIPIFTPSSLKDEN-----------IIREIKDLNPD---
FMT_WOLSU         --------PPPVKESCLRLAPHTPLFQPENLKEER-----------WAKEWRALEPD---
FMT_CAMFF         --------PPEVKKTVLQSGLDIPIFQPLNLKDSS-----------TVNDIKALKPN---
FMT_HELAH         --------APETKTYILENHSNIPIFQPQSLKEP------------EVQILKGLKPD---
FMT_HELPY         --------APETKTYILENHLNIPIFQPQSLKEP------------EVQILKDLKPN---
FMT_SULDN         --------PPAAKNIALKYGIAIS--QPSRLRDKE-----------TVAEVTSIECD---
FMT_CALS8         --------PPPVKEFALKFNLNVV--QPDRLKGNEE----------FFEVLKKINPE---
FMT_ECOLI         --------PSPVKVLAEEK-GLP-VFQPVSLRPQ-----------ENQQLVAELQAD---
FMT_SALDC         --------PSPVKVLAEEK-GLP-VFQPVSLRPQ-----------ENQQLVADLHAD---
FMT_KLEP7         --------PSPVKVLAEAH-NLP-VFQPSSLRPQ-----------DNQRLVADLGAD---
FMT_ENT38         --------PGPVKVLAEKH-NLP-VFQPVSLRPQ-----------ENQQLVSDLNAD---
FMT_CROS8         --------PGPVKVLAQEN-DIP-VFQPKSLRSA-----------ENQELVAALNAD---
FMT_YERE8         --------PSPVKVLAEQH-DIP-IFQPKSLRPE-----------ENQHLVADLNAD---
FMT_YERPY         --------PSPVKILAEHH-GIP-VFQPKSLRPE-----------ENQHLVADLNAD---
FMT_SERP5         --------PSPVKVLAEQH-HLP-VFQPKSLRPE-----------ENQHLVADLNAD---
FMT_ERWT9         --------ASPVKQLAAQH-NIP-VFQPESLRSE-----------ENQQKVAALNAD---
FMT_PECAS         --------PSPVKVLAEQH-SIP-VFQPKSLRPA-----------ENQAMVEALDAD---
FMT_SODGM         --------PSPVKELAERH-DLP-VFQPASLRKP-----------EGQRSVAELNAD---
FMT_PHOLL         --------PSPVKVLAEER-NIT-VFQPATLRSE-----------ENQQWVLKQQPD---
FMT_PROMH         --------INPVKELALTN-NIP-VYQPTSLKPE-----------ENHEWIKALQPD---
FMT_ACTP2         --------ASPVKQLAEQH-NIP-VYQPKSLRKE-----------DAQAELKALNAD---
FMT_HAEDU         --------ASPVKQLALQH-NIP-VYQPKSLRNP-----------QAQAELNALNGD---
FMT_ACTSZ         --------ASPVKQLAQQH-NLP-VYQPKSLRNE-----------EAQSELAALNAD---
FMT_MANSM         --------ASPVKQLAEQY-NIP-VYQPKSLRKE-----------EAQAQFAQLQAD---
FMT_HAEIE         --------ASPVKQLAEQN-DIP-VYQPKSLRKE-----------EVQSELKALNAD---
FMT_PASMU         --------ASPVKQLAEQH-NIP-VYQPKSLRKV-----------EAQEEMRAIDAD---
FMT_HISS2         --------ASAVKILAEKH-HIP-VYQPKSLRKV-----------EVQEHLSKLNAD---
FMT_VIBPA         --------APPVKQLALEH-NIP-VYQPESFKSD-----------EAKQELADLNAD---
FMT_VIBVY         --------ASPVKTIALEH-NIP-VYQPENFKSD-----------EAKQALADLNAD---
FMT_VIBC3         --------ASPVKTLALEH-NVP-VYQPENFKSD-----------ESKQQLAALNAD---
FMT_ALIFM         --------ASPVKELALEH-NIP-VFQPENFKSD-----------EAKQELADQNAD---
FMT_PHOPR         --------ASPVKNIALEN-DLP-VYQPASLRNE-----------DAQQELAALKAD---
FMT_AERS4         --------ASPVKELALTH-NLP-VYQPASLRKE-----------EAQAELASLGAD---
FMT_SHEAM         --------PSPVKSLALEH-QIP-VYQPKSLRKE-----------EAQQELAALGAD---
FMT_SHEON         --------ASPVKELALSH-SIP-VYQPGSLRKE-----------PAQQELASLNAD---
FMT_SHEDO         --------ASPVKELALSH-DIP-VFQPASLRAV-----------EAQAELATLNAD---
FMT_SHEFN         --------ASPVKALALEH-AIP-VFQPASLRNE-----------EAQAELAALNAD---
FMT_SHEPA         --------ASPVKALALEN-DIA-VFQPKSLRDE-----------DAQAELAALNAD---
FMT_SHEPW         --------SSPVKALALEN-DIP-VLQPKSLRDE-----------TAQQELTALNAD---
FMT_SHESH         --------ASPVKSLAIEH-NLP-VFQPKSLRDE-----------QAQAELANLNAD---
FMT_SHEWM         --------ASPVKMLALEN-EIP-VYQPTSLRDE-----------QAQAELASLNAD---
FMT_SHELP         --------ASPVKALALEH-DIP-VYQPVSLRNE-----------DAQAELAALGAD---
FMT_PSYIN         --------ASAVKELAMEQ-QIP-VYQPANFKEV-----------DSTKQLAALNAD---
FMT_PSEHT         --------ASEVKELALEH-NLP-VFQPQSLKTE-----------DALNELTRLNAD---
FMT_COLP3         --------ACATKLLAIEH-DII-VEQPINFKNE-----------EDQQQLAKYNAD---
FMT_PSEA6         --------ASAVKQLAQQH-DIP-VYQPASLKSE-----------EAQQQLAALNAD---
FMT_IDILO         --------PSAVKKLALEH-QLP-VYQPESLKSE-----------EDQAALADLKPD---
FMT_PSEE4         --------PSAVKALAVAH-DIP-VYQPQTLRNP-----------EAQAELAALKPD---
FMT_PSEPF         --------PSPVKQLALEN-NIQ-VLQPPTLRNA-----------DAQAELAALKPD---
FMT_PSE14         --------PSPVKQLALQH-EIP-VMQPPTLRAP-----------EAQAELAALKPD---
FMT_PSEA7         --------PSAVKSLALEH-GLP-VIQPPSLRSA-----------DAQAELAALRPD---
FMT_PSEMY         --------PSPVKQLAVEH-GIP-VHQPASLRNE-----------EAQAELAALKPD---
FMT_PSEU5         --------PSPVKQLAVQH-DIP-VLQPQTLRDP-----------AAQAELAALQAD---
FMT_CHRSD         --------PSPVKALAQEH-GLP-VHQPTSLKDT-----------DAQQTLAALEAD---
FMT_HAHCH         --------PGPVKQLALKH-TIP-VEQPLNFKNE-----------EDRQQLRDYEAD---
FMT_ALCBS         --------QSPVKQLAHSQ-GIT-VLQPENLKGE-----------AIHQQLRDLNLD---
FMT_ACIAD         --------PSPVKQLALEH-NLP-VLQPLHFKSSTEEGL------AAQAELAAFNAD---
FMT_ACIBS         --------PSPVKQLVLEY-NIP-VYQPLHFKASTEEGL------AAQQELAALGAD---
FMT_COXB1         --------ESPVKEIARQN-EIP-IIQPFSLRDE-----------VEQEKLIAMNAD---
FMT_METCA         --------PSPVKQLAIEH-GLP-VFQPASLKGP-----------EERERLVALEPD---
FMT_LEGPC         --------ESPVKEWAINN-QVP-VYQPLNFKNQ-----------EAIDELSALKPD---
FMT_ACIAC         --------ASPVKQCALAH-GIA-VAQPRGLRLDGRYAE---DAAAARAALEAAGAD---
FMT_ACISJ         --------ASPVKQCALQH-GIA-VAQPLSLRLDGKYPE---DAAAAKAAIEAAQAD---
FMT_DELAS         --------ASPVKQCALEH-GIA-VAQPRSLRLDGKYPE---EAAAARAAIEAAQAD---
FMT_POLNA         --------ASAVKQWAESH-AIA-VAQPRSLRLDGKYPE---DAAAARAAIEAAQAD---
FMT_VEREI         --------ASPVKQCALAH-GLA-VAQPRSLRLDGRYPQ---DAAAARAALLAAQAE---
FMT_METPP         --------ASAVKALAVER-GLA-VTQPRSLRLDGKYPD---DASAAREALEAAQLD---
FMT_RHOFT         --------ASAVKQFALDH-GLA-LAQPRSLRLDGKYPE---DAAAAREALVAAQAD---
FMT_BORA1         --------PSPVKEAALAA-GIE-VAQPRSLRLDGRYPD---EALAAQARLVAVAPE---
FMT_BORPD         --------PSPVKQAALAA-GIE-VAQPRSLRLDGRYPD---DAAQAQAQLRQAAPE---
FMT_BORPE         --------PSPVKQAALAA-GIE-VAQPRSLRLDGRYPD---EAAAARAQLERVAPD---
FMT_PARP8         --------ASPVKRYAQEH-GIE-VAQPPSLRRNGKYPA---QATAAIEQLRATPHD---
FMT_PARXL         --------ASPVKRYAQEH-GLA-VAQPPSLRRAGKYPE---QAAAAIGQLRATPHD---
FMT_BURM1         --------ASAVKRYALEH-GLP-VAQPPSLRRAGKYPA---EAAEAIELLRATPHD---
FMT_BURTA         --------ASAVKRYALEH-GIT-VAQPPSLRRAGKHPA---EAAAALDLLHATPHD---
FMT_RALPJ         --------ASPVTQYAVTH-GFAPILQPPSLRRTGKYPQ---EAAEAIDALTAQRPD---
FMT_HERAR         --------ASAVKQFALAH-KIP-VAQPISLRLDGKYPD---VAQEAHDLLRATPHD---
FMT_JANMA         --------ASAVKQFALAH-DIP-VAQPVSLRLDGKYPE---VAAEAHALLKATPHD---
FMT_CHRVO         --------PSPVKEVALAH-GLR-VEQPEKLRG----------NQEAQQMLRDIQAD---
FMT_THIDA         --------ASAVKQAALAH-GLP-VYQPTTLK-----------TPEAQARLADCAAD---
FMT_AROAE         --------PSPVKQLALAH-GIA-VDQPSSLR-----------GEEQRATLAACAPD---
FMT_NEIM0         --------APPVKQAALEL-GLR-VEQPEKLR----------NNAEALQMLKEVEAD---
FMT_DECAR         --------PSAVKKVALTH-GIE-VFQPLTLK-----------DAEAQARIAAVGAE---
FMT_METFK         --------PSPVKSLALEH-GIP-LLQPETLK-----------DEAVQARIAAEHAD---
FMT_POLNS         --------ASPVKEFALQK-NIP-ILQPETLRRTSADPQKKAQAEEAYKSLSAIEFD---
FMT_POLAQ         --------ASPVKEFALEK-NIP-VLQPETLRRNNKDPEKQQQAEDAYRALINTNFD---
FMT_NITEC         --------ASPVKILAQQY-NIP-LLQPETLK-----------SPDIQTQLETLKPD---
FMT_NITEU         --------ASPVKILAQQY-DIP-LLQPETLK-----------SSDIQAQLATFKPD---
FMT_NITMU         --------SSAVKLLAQKR-GFG-LLQPPSLR-----------QPELHMQLEAVRAD---
FMT_STRM5         --------PSPVKLEAVAR-GIP-VYQPESLKDE-----------AAQQQLRDLQPD---
FMT_XANC8         --------PSPVKLDAIAR-GIP-VFQPQTLRSP-----------EALATLRALQPD---
FMT_XYLFA         --------PSPVKLEAVAR-GLP-VYQPQTLRSP-----------EMLEQLRALRPD---
FMT_HALHL         --------PPPVKRAAERH-GLG-VHQPERLGAE-----------EA-EQIRALAPD---
FMT_GLUDA         --------PQPVHLAAEAL-GIP-VRVPTRLRA----------NHDEHAFFRALDLD---
FMT_GLUOX         --------RSPVHEAAEAA-GIE-VRTPARVRR----------DTAEHEAFAALNAD---
FMT_ACICJ         --------KCPVHEAAEAL-GLT-VRTPERLRR----------DDAERAYFRALDLD---
FMT_GRABC         --------PCPVHRAAEAL-GLE-VRHPALLKN----------AADEHEAFRALNLD---
FMT_AGRFC         --------KSPVHQVAELL-GLP-VLTPVNFK-----------AEEDRQQFRDFNAD---
FMT_RHILW         --------KSPVHQAAELL-GLP-VFTPVNFK-----------DPEERERFAALKAD---
FMT_RHIME         --------KSPVHQAAERL-GIP-VLTPANFK-----------DAADRQTFRDFGAD---
FMT_SINMW         --------KSPVHQAAERL-DIP-VLTPVNFK-----------EAADRRTFRNFGAD---
FMT_CHESB         --------RSPVHQAAEEL-DLY-VRTPQSLK-----------SEEEQQVFRELEAD---
FMT_OCHA4         --------KSPVHEKAEQF-GIP-VFTPKSLK-----------GAEEQDVFASLEAD---
FMT_RHILO         --------PSPVQREAERL-GIE-VRTPTSLK-----------GEAEQAAFNALRAD---
FMT_BRADU         --------PTPVEEAARRL-GVP-VLTPKTLK-----------TEEALEEFRAFDAD---
FMT_BRASO         --------PTPIESEARRL-GIP-VLTPKTLK-----------TEEALAEFRAHEAD---
FMT_NITHX         --------PSPVAREAHRL-GIP-VLTPKTLK-----------TPAALDEFRSHGAD---
FMT_NITWN         --------PTPVAREAQRL-GLP-VLTPKTLK-----------TQESQDQLRSYGAD---
FMT_RHOP2         --------HSPVAQEAQRL-GIP-VLTPKTLR-----------TDEALAEFRSHEAD---
FMT_RHOPT         --------ETPVALAAHRL-QAP-VLTPKTLR-----------TDEALANFRAHEAD---
FMT_RHOPB         --------PTPVAQEAERL-GIP-VLTPKTLR-----------TPEAAAEFAAFQAD---
FMT_OLICO         --------ITPVEKAAREL-GLP-VLTPSTLR-----------TPEAEAEFRAHNAD---
FMT_METS4         --------PSPVQALAERF-GLP-VLTPSTLR-----------GPEAAETFRAHGAD---
FMT_PARL1         --------PSPVHRFAEEH-GIP-VFTPVSLK-----------GEAEQQAFASLDLD---
FMT_CAUVC         --------PSPVHAFAEGL-GLP-VRTPVSMK-----------TPEEIAAFQALDLD---
FMT_CAUSK         --------PSPVHAFAESL-GLP-VRTPVSMK-----------TAEEIEAFRALDLD---
FMT_PHEZH         --------PSPVHAYAESR-GIP-VRTPASMR-----------DPAEIEAFRALGLD---
FMT_RUEPO         --------PTPVHARALDL-GLE-VRHPVSLK-----------GAEAQADFAALGAD---
FMT_RUEST         --------PTPVHARAEAL-GLE-VRHPVSLK-----------GSEEQQAFAALNAD---
FMT_DINSH         --------PSPVQARAEVL-GLA-VRHPVSLK-----------GAEAQADFAALGAE---
FMT_ROSDO         --------PSPVQARAEAL-GLP-VRHPVSLR-----------SDEALADFAGLQAE---
FMT_JANSC         --------PSPVQARAETL-GLT-VRNPVSLK-----------STEEQSALADLNAD---
FMT_RHOS1         --------PTPVQTRAEEL-GLP-VRYPTSLR-----------TPEAQAEFAALGAE---
FMT_RHOS5         --------PTPVQARAEEL-GLP-VRHPKSLR-----------TPEVQADFAALGAE---
FMT_PARDP         --------PSPVHRAAEEL-GLP-VRTPERLK-----------SPQDQGDFAALQAD---
FMT_NOVAD         --------PSPVHLAAEAH-GID-VRTPVSLK-----------GADEQTTLAAFDAD---
FMT_SPHWW         --------PSPVQRRAEEL-GIP-VRHPVTLR-----------DADAQAVFAALALD---
FMT_SPHAL         --------KSPVQLWAEEH-GLP-VRTPKSLK-----------SDEAQAEFAALDLD---
FMT_ZYMMO         --------PSPVEKRAREL-GLN-VYTPVSLK-----------EAETQKIFADHQAD---
FMT_MAGSA         --------LTPVHAFAHER-GIP-VRTPKSLK-----------PAEAQAEFAALEAD---
FMT_BARQU         --------PSPVQNAAQAK-SIP-VFTPQTLK-----------TAEKQAQFAELAVD---
FMT_BART1         --------PSPVQNAAEER-SIP-TFTPQTLK-----------TAEQQAQFAALSVD---
FMT_BARHE         --------PSPVQNLAKAK-SIP-VFTPQTLK-----------TAEQQTKFTELAVD---
FMT_BARBK         --------SSPVQNAAEAK-SIP-VFTPQSLK-----------TAEEQARFAALSVD---
FMT_MAGMM         --------KTPVKQLAEQH-GIP-VYQPNRLREA-----------EAVTALRALRPD---
FMT_SYMTH         --------PSPVKEVALAH-GLP-VFQPRRLRRP-----------EVVAQLKELGSD---
FMT_BDEBA         --------PSPVKALAQAH-NLK-VLAPESLKAN----------PLMLQEIKTWGAE---
FMT_TRIV2         --------PSPVKNMAIAH-DLP-VWQPERIK----------KDTETLNKLKQLDAD---
FMT_TRIEI         --------PSPVKSVAVAH-NIP-VWQPRRVK----------KNPETLNLLREAQAD---
FMT_GLOC7         --------PSPIKKVALDH-QIP-IWQPKRVK----------KNAQTLTKLRETNAD---
FMT_MICAN         --------PSPVKQIAIEQ-QIP-VLQPKSVK----------KNARTLDFLRQSRAD---
FMT_SYNP2         --------PSAVKKVAIAH-DLP-VWQPKRIK----------KDPETLAILENLQAD---
FMT_SYNY3         --------PSPVKEVAVQA-GIP-VWQPERVK----------RCQETLAKLKNCQAD---
FMT_SYNP6         --------ASPVKALAIAY-DLP-VWQPERLR----------RDPEVLSQLQQTQAD---
FMT_THEEB         --------PSPVKAFALRH-GLP-IWQPPRLR----------QDPQLPEVLRSLAAD---
FMT_GLOVI         --------PPPVKAIAQSR-GIP-VFQPDRLR----------KDLEVLAHLEALQAD---
FMT_SYNJA         --------PPPTKILAQAH-GIP-VWQPGRLR----------RDPEVLAALEALAAD---
FMT_DEIRA         --------PPPVAARAAEL-GLP-LAQPHKLR----------GNADFAAQLRDSGAD---
FMT_THET8         --------PSPVARYAEAE-GLP-LLRPARLR----------EEA-FLEALRQAAPE---
FMT_ROSCS         --------ATPVKQAALRL-GLP-VLTPETLRDP-----------AAVADLADLRPD---
FMT_ROSS1         --------ATPVKQAALRL-GVP-VLTPETLRDP-----------AAVAELAALRPD---
FMT_CHLAA         --------PPPVKIAAMAH-NLP-VLQPETLRDP-----------TVVETLSALQPE---
FMT_HERA2         --------APPVKLAAERL-GIP-VFQPETLKDP-----------AAVARLRAFEPE---
FMT_DEHMB         --------PPPVKTLALEH-GLA-VYQPQSLKKP-----------EEQAFLKELKPD---
FMT_AKKM8         -LT-----APAIKNIAREA-GIP-VLQPHSLRS-PD----------ALSNLRRLNPD---
FMT_DESVV         -CR-----PSAVKMLALEH-GLD-VRQPVNFRD-EA----------DVQALRDFGAD---
FMT_MYXXD         -VT-----APPVKELALSR-GVP-VLQPTKLRT-PP----------FAEELRQYAPD---
FMT_SORC5         -LK-----APPVKVKALEL-GVP-VLQPEKVRT-PE----------FAAWVAGAGAD---
FMT_ANASK         -LR-----EPATKAWARAR-GVP-VLQPEKVRD-GT----------LAAALRALAPD---
FMT_KORVE         -LA-----FSPVKDAALAL-NLP-VTQPEKIKNNEE----------FRAQLSAIAPD---
FMT_SOLUE         -PA-----ASPVKQAALAL-SLE-VYQPERVRR-PE----------PVEFLRGIGAR---
FMT_GEOBB         -TL-----PPPVKVVAEQH-GIP-VLQPVKVRL-PE----------SIEEIRGLNPD---
FMT_GEOUR         -TL-----PPPVKVLAERH-GIP-VMQPLKVRV-PE----------VVESIRSLAPD---
FMT_GEOMG         -LV-----PPPVKVIAEEH-GIP-VLQPQKVRA-PE----------VVAQIRELNPD---
FMT_GEOSL         -LV-----PPPVKALAQEH-DIP-VLQPLKVRT-PE----------SVDEIRRLAPD---
FMT_GEOLS         -LQ-----PPPVKELALRH-GIP-VHQPPKVRT-PE----------VIEQIRALQPD---
FMT_PELPD         -LM-----PPPVKELALAH-DIP-VLQPHRVRA-SA----------FVESIRQLAPE---
FMT_SYNAS         -LV-----APPVKIAATSY-QIP-VLQPPGIKD-PA----------FLEILEKISPD---
FMT_DESPS         -LT-----SPPVKVIAEEA-GLP-VLQPTKVRT-DE----------FLEALAAYAPD---
FMT_DESRM         -VQ-----PPPVKVLANEY-KIP-VLQPTSIKI-NE----------FQQTIEELKPE---
FMT_PELTS         -ET-----PPPVKQAAHAL-NIP-VFQPLKIKD-AD----------FTALLKKLSPQ---
FMT_MOOTA         -LL-----PPPVKSTALAA-GLP-VRQPSDMKD-RE----------FLEDLRLLQPE---
FMT_HELMI         -PQ-----PSPVKEAALRL-GLP-VDHPACL-D-NE----------FVQKLKDLGVE---
FMT_NATTJ         -LQ-----PPPAKRKAEEL-GID-VFQPESIHN-NY----------AYQILSDIEPH---
FMT_METI4         -VI-----PSPIKRTALKH-HIW-VFQPENINS-AG----------SIQQIQFLKPD---
FMT_RHOBA         GPP-----PQPVREWAESH-GLP-VDAPASIND-PE----------TIASLTELNAD---
FMT_FRAAA         --------PPPVHLLADEA-GIP-VLSPERPRDPD-----------FLAALTDLAPD---
FMT_FRACC         --------PPPVHVLADEA-GIP-VLSPDRPRDPE-----------FLATLAGLAPD---
FMT_FRASN         --------SSPVRELADER-GLE-VLAPARASDPD-----------FLARLGEIAPD---
FMT_SACEN         --------RSPVGALADEH-GIE-VLTPAKASDPE-----------FLARLRELEPE---
FMT_SALTO         --------RSPVGAWADEH-GIE-VLTPARPREPE-----------FLDRLRALAPD---
FMT_STRCO         --------ASPVAERAEEA-GIE-VLKPAKPRDPD-----------FLERLREIAPD---
FMT_STRGG         --------ASPVAERAQEA-GIE-VLKPAKPRDEE-----------FLARLREIAPD---
FMT_STRAW         --------ASPVAQRAEEA-GIE-VLKPVKPRDEE-----------FLARLREIAPD---
FMT_THEFY         --------ASPVARRAAEA-GIE-VLKPARADDPA-----------FLDRLRELAPD---
FMT_MYCBP         --------PSPVAREAAER-GIP-VLRPSRPNSAE-----------FVAELSDLAPE---
FMT_MYCLE         --------PSPVAREALDR-GIP-LLRPARPNSPV-----------FVSELSEWAPE---
FMT_MYCPA         --------PSPVAREALDR-GIP-VLRPARPNSPE-----------FVAELAQLAPD---
FMT_MYCUA         --------PSPVARAALER-GIP-VLRPSRPNSAE-----------FVAELSELAPQ---
FMT_MYCS2         --------PSPVAQLALEH-GIP-LLRPDRPNSDE-----------FVAELTELAPD---
FMT_MYCSS         --------PSPVARLALDH-DIP-VLRPPKPNSEE-----------FVAELRELAPD---
FMT_MYCGI         --------PSPVAELAAAH-GIP-VLKPPRPNSEE-----------FVAELAALAPD---
FMT_MYCVP         --------PSPVAQLAAAH-GIP-VLKPARPNSGE-----------FVAELSALSPD---
FMT_MYCA9         --------SSPVAALAREH-GVA-VLTPARPNEPE-----------FVRELAQLDVD---
FMT_NOCFA         --------RSPIAALADEH-GIP-VLSPRTPAEPE-----------FLDRLTELAPD---
FMT_NOCSJ         --------ASPVALRAEEL-GVP-VLKPAHPKDPE-----------FQEQLRALRPD---
FMT_ACIC1         --------PSPVALAAEQA-GLP-VLKPRRLADPE-----------TLAALRSLNAE---
FMT_KINRD         --------ASPVALRAREA-GLP-LLQPEKPGGEE-----------FLAALRELAPD---
FMT_PAEAT         --------PSPVAARAMEL-GID-VIRAARV-DAD-----------TTAGIAKYAPD---
FMT_ARTS2         --------PSPVAARAAEL-GIE-VIHAAKV-DAE-----------VTARIAAAAPD---
FMT_RENSM         --------PSPVAARAEEL-GLP-IIRANRL-DTE-----------VQEQIALLRPE---
FMT_CLAM3         --------PSPVAREAEGL-GIP-TLRTNRL-DEE-----------ATARIAAVGAG---
FMT_CLAMS         --------PSPVAAEAERL-GIP-TLRVNRL-DDD-----------ATARIAAVGAE---
FMT_LEIXX         --------PSPVAIAAEEL-GLS-VIRANRL-REE-----------AIERVRVLRPD---
FMT_CUTAK         --------PCPVAKAAEEL-GIP-AIKATSVKSGE-----------GHDAITSLDAD---
FMT_BIFAA         --------ANPVKQAALEL-GLP-VIE-SDPSEET-----------FVSELAATGAQ---
FMT_BIFLD         --------PSPVKATALEL-GLP-VID-LKPRSPE-----------FMEALNNLHAD---
FMT_COREF         --------PSAVAELAQAH-GIE-VIKPTSLKADTGDGRL------VRQRLAELQPD---
FMT_CORGB         --------PSAVAELAQQH-GIE-VLKPTSLKADTEDGQA------IRQRLAELAPD---
FMT_CORDI         --------PSPVSELAQQH-GIE-VLTPATIKPNTPDGDA------FRARLTELAPD---
FMT_CORJK         --------PSKVAEVAEEA-AIP-TYKWPSLKAGTESGDE------ARAVLGDLAAQGVT
FMT_CORU7         --------PSPVAEVAEGA-GLK-VHKWHSLGASSEDAAA------VRETLAAYREAGAT
FMT_RUBXD         --------SPPVALLAREA-GLP-LLQPASISEAA-------------GEISRHDAL---
FMT_BACFN         --------YSPVKQYALDH-QLP-LLQPEKLKDEE-----------FIQALREWKAD---
FMT_BACTN         --------YSPVKQYALEQ-NLP-LLQPEKLKDEA-----------FVQALREWKAD---
FMT_BACV8         --------PSPVKEYAVSQ-GLR-ILQPEKLKDEA-----------FIEELRSLQAD---
FMT_PARD8         --------PSAVKQYAVSV-GLP-VLQPEKLKDEA-----------FLEELRALRAD---
FMT_AZOPC         --------FSPIKQYALSH-EIP-LLQPKKLKDPD-----------FLKSLKAWNTD---
FMT_PORG3         --------PSMVKLYAQEL-GLP-ILQPDNLNEES-----------FLDELRTYQPH---
FMT_CHLCH         --------ASPIKQAALAL-NLP-VHEVDDVNDPH-----------FAEIVAAYKPD---
FMT_CHLPD         --------PSPVKSAALEL-GFQ-VYETDDVSSSD-----------FLSVVADSAPD---
FMT_CHLL2         --------PTPVKQSALEL-GLP-VYETDDPSSAE-----------FASVVLASRPD---
FMT_PELLD         --------PTPVKQAALEL-GLR-VLEVEDVKDPA-----------FASTVQELRPD---
FMT_CHLPM         --------PTPVKSLALQL-GLP-VLEVEDVKDPG-----------FAEAVRRLQPD---
FMT_CHLPB         --------PTPVKKAAKEL-GLA-VLEIDDVKDAR-----------FADTIARYRPD---
FMT_PROA2         --------PTPVKKAAREL-GIP-VMEVDDVKDER-----------FVDTVARYRPD---
FMT_CHLTE         --------PTPVKQAALEL-GLP-VLEADDVSSHE-----------FALQVAAARPD---
FMT_CHLAB         --------PSPVKTLALSK-NIP-LLQPEKVSDPQ-----------FVEQLRDFEAD---
FMT_CHLCV         --------PSPVKTLALSK-NIP-LLQPEKASDPQ-----------FIEQLKAFEAD---
FMT_CHLPN         --------PSPVKTIALTH-GLP-LLQPSKASDPQ-----------FIEELRAFNAD---
FMT_CHLMU         --------ASPVKQLALSK-NIP-LLQPTKTTDPA-----------FLAQLREWQAD---
FMT_CHLTA         --------SSPVKQLALSK-NIP-LLQPIKTTDPA-----------FLAQLREWQAD---
FMT_PARUW         --------PTPVKLIAQSY-HLP-LYQPEVVSSLD-----------FAPVLKNYEAD---
FMT_BORAP         QN--------VIKLEAIAK--NIKVFDPLILDDN------------ILNLIRDLNPD---
FMT_BORBP         QN--------VIKVEAIAK--DIKVFDPLILDNN------------TLNSIRDLNPD---
FMT_BORHD         AN--------DIKVEATNR--NITVLDPVVLNSD------------VVEIVKRLNPD---
FMT_BORRA         VN--------DIKREALSR--KITVLQPVVLDAD------------VINLVKSLEPE---
FMT_TREDE         DSDTALAVKELIKEGVLPE--NFPILTPQKLDDN------------YRKELEALKSE---
FMT_TREPS         HSAVAREFFRLKASGVLPE--SASLFVPGRLDRA------------FYDAVEALRPD---
FMT_LEPBL         AG--------PVKKTALEH--HIPVFQYESIKREKE---------KALSDFGSFPAD---
FMT_LEPIC         PG--------PVKKKALEY--NIPVFQYESIKKEKE---------KALSDFGLFSAD---
FMT_ELUMP         PC--------PVKETALKM--GLKVLSPEKIT-DI------------EADLKAAGAD---
FMT_UNCTG         YP--------AVKVYAVKN--NISFIQPEKFTLDV------------IETIKNFAAD---
D1B5G6_THEAS      VT--------PVEEVALSF--GLTPVRTNSPVDD-------------VAALAPQGLD---
FMT_COPPD         PS--------PPAVVAEAL--QIPIVKVNSLKNDF------------IEWYFSQGFD---
FMT_THEAB         PT--------PVKEVAQKY--NIPVFQPTKLTSE------------GLSIIERYKPD---
FMT_THEM4         PT--------PVKEVALKY--NIPVFQPKKLNKE------------GLKIIENLKPD---
FMT_FERNB         PT--------PVKEVAQKY--GIPVFQPSKLNEE------------GLEIIENYRPD---
FMT_THEMA         PT--------PVKAVAEKH--EVPFIQPESINKKE-----------ALEFLRSVRPD---
FMT_PSELT         HS--------PVKDLALKN--KIPVF--ESLKDF---------------PFDRLTPD---
FMT_MESFL         --------PTPVKEIALKN--NLKIIQPVKISEA-------------YEEIAQIESD---
FMT_MYCMS         --------HTPVKKLALEN--NLKVVQPNKIGEI-------------YDDLAKLEFD---
FMT_UREP2         --------YSPVKQFCLDH--NIKLFQPEKIKEI-------------EEEIRILGPD---
FMT_UREU1         --------YSPVKQFCLDH--DIKLFQPQKIKEI-------------EEEIRSLAPD---
FMT_MYCPE         --------FSSVKKLAIEK--NIKFFQPNKIKEI-------------ENELKELNPF---
FMT_MYCPU         --------ASPVKKLAQKY--DIKVYDPEKISTI-------------YDQIKDLEFD---
                                                                              

FMT_BACVZ         LIVTAAFGQILPKQLLDGP----KYGCINVHASLLPELRGGAPIHYSILQGKKKTGVTIM
FMT_BACSU         LIVTAAFGQILPKELLDSP----KYGCINVHASLLPELRGGAPIHYSILQGKKKTGITIM
FMT_BACLD         LIVTAAFGQILPKKLLDYP----KYGCINVHASLLPELRGGAPIHYAILEGKEKTGVTIM
FMT_BACP2         LIVTAAFGQILPKRLLDEP----QFGCINVHASLLPELRGGAPIHYAILQGKKKTGVTIM
FMT_BACCN         LIVTAAFGQIIPKEILEAP----KYGCINVHASLLPELRGGAPIHYAIMQGKEKTGITIM
FMT_BACMK         LIVTAAFGQIVPNEILEAP----KYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIM
FMT_GEOTN         LIVTAAFGQILPKALLDAP----KYGCINVHASLLPELRGGAPIHYAIWQGKTKTGVTIM
FMT_BACHD         LIVTAAFGQILPNALLEYP----KHGCINVHASLLPKYRGGAPIHQAIIDGEKETGITIM
FMT_OCEIH         LIVTAAYGQILPKEILEIP----TFGCINVHASLLPELRGGAPIHYAIMQGKEVTGVTIM
FMT_STAAW         LIVTAAFGQLLPESLLALP----KLGAINVHASLLPKYRGGAPIHQAIIDGEQETGITIM
FMT_STAEQ         LIVTAAFGQLLPESLLNAP----KLGAINVHASLLPKYRGGAPIHQAIIDGEEETGITIM
FMT_LYSSC         IVITAAFGQILPKELLDAP----SLGCINVHASLLPKYRGGAPIHQAIIDGEKETGVTIM
FMT_LISMF         LLVTAAYGQILPNSLLESP----KHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIM
FMT_BACSK         LIVTAAYGQIVPKAVLDAP----PYGCINVHASLLPKYRGGAPIHQAIIDGEKQTGISIM
FMT_LACBA         LIVTAAFGQFLPTKLLKAA----KVAAVNVHASLLPKYRGGAPVHYAIMNGDSETGVSIM
FMT_PEDPA         LIVTAAFGQFLPMSLINSV----KIGAVNVHASLLPKYRGGAPVHYAIMNGDKETGVTII
FMT_LACPL         LIVTAAFGQFLPTKLLKAA----KIGAVNVHGSLLPKYRGGAPVQYSIINGESETGITII
FMT_LACF3         LIITAAFGQFLPDKLLAAA----KVAAINVHGSLLPKYRGGAPIQYAVMNGDAETGVTIM
FMT_LACS1         LIVTAAYGQFLPTKLIESV----KIAAINVHGSLLPKYRGGAPVQYSIMNGDDKTGVTII
FMT_LACCB         LIVTAAYGQFLPTKFLEAA----KIIAVNVHGSLLPKYRGGAPIQYSIMNGDSETGVTII
FMT_LACSS         LIVTAAYGQFLPTKLLEAA----KIAAINVHGSLLPKYRGGAPIQYAVLNGDSEIGITIM
FMT_ENTFA         LIVTAAFGQFLPEKILKAP----KLGAINVHASLLPKYRGGAPVHYSIIEGEKETGVTIM
FMT_LACAC         LIVTAAYGQFLPTKFLKSV----NIAAVNVHGSLLPKYRGGAPIQYSLINGDKETGITIM
FMT_LACJO         FIITAAYGQFLPTKFLKSA----KVAPVNVHGSLLPKYRGGAPIQYSVLNGDKETGVTIM
FMT_LACDB         FIITAAFGQFLPTKFLKSA----KIAAVNVHGSLLPKYRGGAPIQYAVRNGDAETGVTIM
FMT_STRA5         GIVTAAFGQFLPTKLLESV----GF-AINVHASLLPKYRGGAPIHYAIINGEKEAGVTIM
FMT_STRT1         GIVTAAYGQFLPSKLLDSM----DF-AVNVHASLLPKYRGGAPIHYAIINGDAEAGVTIM
FMT_STRGC         GIVTVAFGQFLPSKLLARM----NF-VVNVHASLLPKHRGGAPIHYALIQGDKETGVTIM
FMT_STRP4         GIVTAAFGQFLPSKLLDSM----DF-AVNVHASLLPRHRGGAPIHYALIQGDEEAGVTIM
FMT_STRS2         GIVTAAFGQFLPTKLLNSV----DF-AVNVHASLLPKYRGGAPIHYALINGDERAGVTIM
FMT_STRSV         GIVTAAFGQFLPSCLLDSV----DF-AVNVHASLLPKYRGGAPIHYALINGDEQAGVTIM
FMT_STRMU         GIVTAAFGQFLPMILINSV----DF-AVNVHASLLPKYRGGAPIHYAIINGDKKAGVTIM
FMT_STRPM         GIITAAFGQFLPTILLDSV----SF-AINVHASLLPKYRGGAPIHYAIMNGDKEAGVTIM
FMT_LACLA         GIVTAAFGQFLPGKLLDVA----QF-AVNTHASLLPKYRGGAPIHYAIMNGEKEAGVTIM
FMT_ALKMQ         VIVVVAYGQILSKEILEIP----TYGCINVHASLLPKYRGAAPIHRAIIDGEKKTGVTTM
FMT_ALKOO         LIVVVAYGQILPKAILELP----KHGCINVHASLLPKYRGAGPINWVIINGEKKTGITTM
FMT_CLOD6         VIVVVAFGQILPKEILEIP----KLGCINVHVSLLPKYRGAAPINWVIINGEEKTGVTTM
FMT_CLOB8         FIIVVAFGQILTKEVLDIP----KYGCINLHASLLPMYRGAAPLNWAIINGEKSSGNTTM
FMT_CLOBB         FIIVVAFGQILTKEVLDIP----KYGCINLHASLLPMYRGAAPLNWVIIKGEKKSGNTTM
FMT_CLONN         FIIVVAYGQILPKEVLEIP----KYACINLHASLLPKYRGAAPLNWAIINGEKKSGNTTM
FMT_CLOPS         FIIVVAFGQILPKEVLDIP----KYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTM
FMT_CLOTE         FIIVVAYGQILSKEILDIP----KYGCINLHASLLPKYRGAAPINWAIINGEKFSGNTTM
FMT_CLOAB         FIVVVAFGQILSKEVLDIP----KYACINLHASLLPNYRGAAPINWAIINGETKTGNTTM
FMT_HUNT2         LLVTAAYGKILPQEVLDIP----PYGCVNVHGSLLPKYRGAAPINWAIINGEKVTGITTM
FMT_CALS4         VIVVAAYGKILPEEILTLP----EYGCINVHASLLPKYRGAAPINWAIINGEKETGITTM
FMT_THEYD         FAIVVAYGKILPKEILEIP----KHGCINLHASLLPKYRGAAPIQWALINGEKITGVTTM
FMT_AQUAE         CIVVVAYGKILPKEVLDLP----PYKTINLHASLLPKYRGAAPIQRAIMAGEKETGNTVM
FMT_HYDS0         IMIVVAYGQIIPKSMLEIP----TFKSLNLHGSVLPKYRGAAPIQRALMQGEKETGNTVI
FMT_FUSNN         LIVVVAYGKILPKEVIDIP----KYGVINLHSSLLPRFRGAAPINAAIINGDTKSGISIM
FMT_SULSY         ISVVVAYGKILPEEIINIP----KYKTINVHASLLPEYRGAAPIQRAIMEGKDKTGVCIM
FMT_DICT6         ALIVASYGKIIPEDILNIP----PYGGINVHASILPKYRGAAPIERALMNCEKETGVSIM
FMT_DICTD         ALVVASYGKIIPEDILNIP----PYGGINVHASVLPKYRGAAPIERAIMNCEKETGVSIM
FMT_CARHZ         VIVVAAYGKLLPREILNIP----PYGCLNIHASLLPFYRGAAPIERCLMAGEKETGITIM
FMT_SYNWW         LIIVVSYGQIIPLSILEYP----RHGCINVHASLLPRYRGAAPVQRALMDGIKSSGITIM
FMT_ANAPZ         VIVVVSYGLMLPKWTLTAS----RMGCVNIHPSLLPRWRGAAPMQHAILSGDTVTGVTIM
FMT_ANAMM         AIIVASYGMILPRWMLEVP----RFGCINVHPSLLPRWRGAAPMQHAILSGDAVTGVTIM
FMT_EHRCJ         VIVVVAYGLIIPQGVLSIP----KYGCINIHPSLLPRWRGAAPIHYAILSGDDKTGVTII
FMT_EHRCR         VIVVVAYGLIIPEAVLSIP----KYGCINIHPSLLPRWRGAAPIHYAILSGDEQTGVTIM
FMT_EHRRW         VIVVVAYGLIIPKEVLSIP----KYGCINIHPSLLPRWRGAAPIHYAILHGDSQTGVTIM
FMT_WOLPM         VAVVAAYGLILPREILNIP----KYGCINIHPSLLPRWRGAAPIQHTILAGDQETGVSIM
FMT_WOLPP         VAVVAAYGLILPKEILNIP----KYGCINIHPSLLPRWRGAAPIQHTILAGDQETGVSIM
FMT_RICCK         IIVVIAYGFIVPKAILDAK----KYGCLNIHPSDLPRHRGAAPLQRTIIEGDKTSSVCIM
FMT_RICTY         IIVVIAYGFIVPKAILEAK----KYGCLNIHPSDLPRHRGAAPLQRTIIEGDLKSSVCIM
FMT_RICBR         IIVVIAYGFIIPQNILDAK----KYGCLNIHPSDLPRHRGAAPLQRTIIEGDKTSSVCIM
FMT_ORITB         VIVVAAYGLIIPKAILKMK----KYGCINIHPSMLPKYRGAAPIQRTIINGEKETAVCII
FMT_BLOFL         IIIVVSYGVILSQEILHIP----KLGCINIHGSLLPRWRGPAPIQRALEHGDTMTGISII
FMT_BLOPB         LIVVVSYGLILPQEILNIP----RLGCINVHGSLLPRWRGPAPIQRALEYGDSITGITII
FMT_WIGBR         IIIVVSYSIILSKKILSLP----RLGCINLHSSLLPRWRGAAPIHRALQSGDKTTGITII
FMT_BUCAI         IMTVVSYGKIIPKKILNMF----SKGCINVHASLLPRWRGATPIQSSILHGDKKTGISII
FMT_BUCAP         MMIVVSYGKLIPKEILTMF----PKGCINVHTSLLPRWRGATPIQSAILFGDKETGISII
FMT_BUCBP         IIIVVSYGKIIPQLILNIF----PLGGINVHTSLLPRWRGPSPIQSALLNGDKLTGITII
FMT_FRAP2         VIVVIAYGIIVPQEFLDIP----KYGCLNIHVSLLPKWRGAAPIQRAIQAGDSKTGICIM
FMT_FRATN         VIVVIAYGIIVPQEFLDIA----RYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGICIM
FMT_PROM9         LFIVIAYGKILPKEILEIP----KFGCWNAHASLLPRWRGAAPIQWSLMKGDEFTGVGIM
FMT_PROMS         LFIVIAYGKILPKEILEIP----KFGCWNAHASLLPRWRGAAPIQWSLIKGDKFTGVGIM
FMT_PROM2         LFIVIAYGKILPKEILEIP----KFGCWNAHASLLPRWRGAAPIQWSLMKGDEYTGVGIM
FMT_PROM5         LFVVIAYGKILPKKILDIP----KYKSWNAHASLLPRWRGAAPIQWSILEGDDFTGVGIM
FMT_PROMP         LFIVIAYGKILPKAILDIP----KYKSWNAHASLLPRWRGAAPIQWSILEGDKITGVGIM
FMT_PROMA         IFVVVAFGQILPKSVLKLP----KYGCWNIHASLLPRWRGAAPIQWSILSGDSETGVGLM
FMT_PROM4         LNLVVAFGQILPLLILDSP----PLGSWNIHASLLPRWRGAAPIQRAILEGDILTGICIM
FMT_SYNPW         VSVVVAFGQILPKDILQHP----PLGCWNGHGSLLPRWRGAGPIQWSILEGDPETGVGIM
FMT_SYNSC         ASVVVAFGQILPKDVLEQP----PLGSWNGHGSLLPRWRGAGPIQWALLEGDQETGVGIM
FMT_SYNPX         ASVVVAFGQILPLEVLEQP----PLGCWNGHGSLLPRWRGAAPIQWSILDGDAETGVGVM
FMT_SYNS3         LSVVVAFGQILPKNVLNQP----PLGCWNGHGSLLPRWRGAGPIQWSILEGDPETGVGVM
FMT_SYNS9         VSVVVAFGQILPKSVLEQP----PLGCWNGHGSLLPRWRGAGPIQWALLEGDSETGVGIM
FMT_SYNR3         LSVVVAFGQLLPPEVLQQP----PLGCWNGHGSLLPRWRGAGPIQWCLMEGDAQTGVGIM
FMT_PROMM         ISVVVAFGQLLPSTVLNQP----PLGCWNGHASLLPRWRGAGPIQWSLLSGDSVTGVGIM
FMT_PROMT         VYLVVAFGQILPKEILDQP----KLGCWNSHASLLPVWRGAAPIQWSIINADAKTGICIM
FMT_PELUB         LVIVVAYGQIIPKEYLNLA----KKGFINIHASLLPKWRGAAPIQRSIMNLEKETGISIM
FMT_CAMJ8         FIVVAAYGKILPKAILDLA----P--CVNLHASLLPKYRGASPIQSAILNKDEKSGVCTM
FMT_WOLSU         FIVVAAYGKILPKVILDIA----P--CINLHASILPLYRGASPIHESLRRGDAWSGVSAM
FMT_CAMFF         FIVVAAYGQILPKDILDIA----P--CINLHASLLPKFRGASPIQEAILRGELLSGVTAM
FMT_HELAH         FIVVVAYGKILPKEVLKIA----P--CINVHASLLPKYRGASPVHEMILNDDTIYGVSAM
FMT_HELPY         FIVVVAYGKILPKEVLTIA----P--CINLHASLLPKYRGASPIHEMILNDNKIYGISTM
FMT_SULDN         YIVVAAYGQILPLEILKHA----P--CINLHASILPHYRGASPIQQTLLHGDVKTGVTAM
FMT_CALS8         VIVVVAYGKILPKEILQIP----KYGCINVHASLLPEYRGAAPIQRVLMDGKNYTGITIM
FMT_ECOLI         VMVVVAYGLILPKAVLEMP----RLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIM
FMT_SALDC         VMVVVAYGLILPKAVLDMP----RLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIM
FMT_KLEP7         IMVVVAYGLILPKAVLEMP----RLGCINVHGSLLPRWRGAAPIQRSLWAGDSETGVTIM
FMT_ENT38         VMVVVAYGLILPKAVLDMP----RLGCINVHGSLLPRWRGAAPIQRSLWAGDSETGVTIM
FMT_CROS8         VMVVVAYGLILPEAVLSMP----RLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIM
FMT_YERE8         IMVVVAYGLILPASVLAMP----RLGCINVHGSLLPRWRGAAPIQRSLWAGDAKTGVTIM
FMT_YERPY         IMVVVAYGLILPAAVLAMP----RLGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIM
FMT_SERP5         VMVVVAYGLILPKAVLDMP----RLGCINVHGSLLPRWRGAAPIQRSLWAGDHETGVTIM
FMT_ERWT9         VMVVVAYGLILPKLVLEMP----RHGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIM
FMT_PECAS         VMVVVAYGLILPQPVLSMP----RLGCINVHGSLLPLWRGAAPIQRALWAGDSETGVTIM
FMT_SODGM         IMVVVAYGLILPQAVLDLP----LLGCINVHGSLLPRWRGAAPIQRALWAGDDRTGVTIM
FMT_PHOLL         VLIVVAYGLILPKVVLNIP----ELGCLNVHGSLLPRWRGAAPIQRSLWAGDTETGVTIM
FMT_PROMH         VMIVVAYGMILPKAVLDIP----RLGCLNVHGSLLPKWRGAAPIQRALWAGDTETGVTIM
FMT_ACTP2         VMVVVAYGLILPEAVLNAP----KYGCLNVHGSLLPRWRGAAPIQRSIWAGDQETGVTIM
FMT_HAEDU         VMVVVAYGLILPEAVLHIP----RYGCLNVHGSLLPRWRGAAPIQRAIWAGDQETGVTIM
FMT_ACTSZ         VMVVVAYGLILPKAVLEAP----RLGCLNVHGSILPRWRGAAPIQRAIWAGDKQTGVTVM
FMT_MANSM         VMVVVAYGLILPKAVLEMP----RLGCLNVHGSILPRWRGAAPIQRAIWAGDKQTGVTIM
FMT_HAEIE         VIVVVAYGLILPKVVLDAP----RLGCLNVHGSILPRWRGAAPIQRSIWAGDAQTGVTIM
FMT_PASMU         VMVVVAYGLILPQTVLAMP----RLGCLNVHGSLLPRWRGAAPIQRAIWAGDKQTGITIM
FMT_HISS2         VMVVVAYGLILPLAVLQTF----PLGCLNVHGSLLPRWRGAAPIQRAIWAGDKKTGVTIM
FMT_VIBPA         LMVVVAYGMLLPQAVLDTP----KLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIM
FMT_VIBVY         IMVVVAYGLLLPQAVLDTP----KLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIM
FMT_VIBC3         LMVVVAYGLLLPKVVLDTP----KLGCINVHGSILPRWRGAAPIQRSIWAGDSETGVTIM
FMT_ALIFM         LMVVVAYGLLLPQAVLDTP----KLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIM
FMT_PHOPR         IMVVVAYGLLLPKFVLDTP----KLGCINVHGSILPRWRGAAPIQRSIWAGDEETGVTIM
FMT_AERS4         LMVVVAYGLILPKVVLDTP----RLGCINVHGSLLPRWRGAAPIQRSIWAGDTETGVTIM
FMT_SHEAM         IMVVVAYGLILPKVVLDTP----RLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIM
FMT_SHEON         IMVVVAYGLILPKVVLDTP----RLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTIM
FMT_SHEDO         IMVVVAYGLILPQIVLDTP----RLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIM
FMT_SHEFN         IMIVVAYGLILPKVVLDTP----RLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIM
FMT_SHEPA         IMVVVAYGLILPKVVLDTP----RLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIM
FMT_SHEPW         IMVVVAYGLILPKVVLDTP----RLGCINVHGSILPRWRGAAPIQRALWAGDAETGVTIM
FMT_SHESH         IMVVVAYGLILPKVVLDTP----KLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIM
FMT_SHEWM         IMVVVAYGLILPKVVLDTP----KLGCINVHGSILPRWRGAAPIQRALWSGDTETGVTIM
FMT_SHELP         IMVVVAYGLILPQVVLDTP----RLGCINVHGSILPRWRGAAPIQRALWAGDAATGVTIM
FMT_PSYIN         LMIVVAYGLLLPQLVLGIP----RLGCLNVHGSLLPRWRGAAPIQRAIWAGDTETGVTIM
FMT_PSEHT         IMIVVAYGLILPKAILDAP----RLGCLNVHGSILPRWRGAAPIQRAIWAGDEQTGVTIM
FMT_COLP3         IMVVVAYGLLLPEVILNSP----RLGCINVHGSILPKWRGAAPIQRSLEAGDKKTGVTIM
FMT_PSEA6         VMVVVAYGLILPQIILDTP----KYGCLNVHGSLLPKWRGAAPIQRAIWAGDAETGVTIM
FMT_IDILO         VMVVVAYGLLLPQAVLDIP----TKGCLNVHGSLLPRWRGAAPIQRAIWAGDLESGVCIM
FMT_PSEE4         LMVVVAYGLILPQVVLDIP----RLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVM
FMT_PSEPF         LMVVVAYGLILPQAVLDIP----RLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVM
FMT_PSE14         LMVVVAYGLILPQVVLDIP----RLGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVM
FMT_PSEA7         LMVVVAYGLILPQAVLDIP----RLGCINSHASLLPRWRGAAPIQRAVEAGDAQSGVTVM
FMT_PSEMY         LMVVVAYGLILPQVVLDTP----RLGCINSHASLLPRWRGAAPIQRAVQAGDLESGVTVM
FMT_PSEU5         LMVVVAYGLILPQAVLDLP----RLGCINSHASLLPRWRGAAPIQRAIEAGDSESGVTVM
FMT_CHRSD         VLVVVAYGLILPQAVLDIP----RLGCLNVHASLLPRWRGAAPIQRAIEAGDTRSGVTIM
FMT_HAHCH         VMVVAAYGIILPQAVLDAP----KRGCLNIHASLLPRWRGAAPIQRAIIAGDQESGITIM
FMT_ALCBS         ALVVVAYGLIIPQAVLDMP----RLGCLNVHGSLLPRWRGAAPIQRAITAGDTETGNTIM
FMT_ACIAD         VMVVAAYGLILPQIVLDTP----KYGCLNIHGSLLPRWRGAAPIQRAIAAGDAETGVTIM
FMT_ACIBS         VMVVAAYGLILPQAVLDTP----KYGCLNIHGSLLPRWRGAAPIQRAIATGDDETGITIM
FMT_COXB1         VMVVVAYGLILPKKALNAF----RLGCVNVHASLLPRWRGAAPIQRAILAGDRETGISIM
FMT_METCA         LMVVVAYGLILPTPVLTVP----RFGCVNIHASLLPRWRGAAPIQRAILAGDRETGVTLM
FMT_LEGPC         VMVVIAYGLILPKAVLEIP----RLGCINVHASLLPRWRGASPIQHAILHGDAESGVTIM
FMT_ACIAC         AMVVAAYGLILPQWVLDLP----RLGCLNIHASLLPRWRGAAPIHRAIEAGDAETGVTIM
FMT_ACISJ         VMVVAAYGLILPQWVLNTP----RLGCLNIHASLLPRWRGAAPIHRAIEAGDAETGVTIM
FMT_DELAS         VMVVAAYGLILPQWVLDTP----PRGCLNIHASLLPRWRGAAPIHRAIEAGDAETGVTIM
FMT_POLNA         VMVVAAYGLILPQWVLDMP----RLGCLNIHASLLPRWRGAAPIHRAIQAGDPQTGVTIM
FMT_VEREI         VMVVAAYGLILPQWVLDLP----ARGCLNIHASLLPRWRGAAPIQRAIEAGDTHTGVTIM
FMT_METPP         AMVVAAYGLILPAWVLKLP----ARGCLNIHASLLPRWRGAAPIHRAIEAGDTETGITIM
FMT_RHOFT         AMVVAAYGLILPQWVLDVP----ARGCFNIHASLLPRWRGAAPIHRAIEAGDAQTGVTIM
FMT_BORA1         VMVVAAYGLILPRWTLALP----ARGCLNIHASLLPRWRGAAPIQRAIEAGDARTGVTIM
FMT_BORPD         VMVVAAYGLILPAWTLALP----PRGCLNIHASLLPRWRGAAPIQRAIEAGDTQTGVTIM
FMT_BORPE         VMVVAAYGLILPQWTLDLP----RLGCLNIHASLLPRWRGAAPIQRAIEAGDAETGVTIM
FMT_PARP8         VMVVAAYGLLLPQEVLDIA----PHGCINIHASLLPRWRGAAPIHRAIEAGDAETGITLM
FMT_PARXL         VMVVAAYGLILPQEVLDIP----PLGCINIHASLLPRWRGAAPIHRAIEAGDAETGITLM
FMT_BURM1         VMVVAAYGLLLPQEVLDIP----RHGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLM
FMT_BURTA         VMVVAAYGLLLPQEVLDLP----RYGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLM
FMT_RALPJ         VMVVAAYGLILPQEVLDLP----RFGCINIHASLLPRWRGAAPIHRAIEAGDAESGITLM
FMT_HERAR         VMVVAAYGLILPQSVLDIP----PLGCLNIHASLLPRWRGAAPIHRAIEVGDEKTGITIM
FMT_JANMA         VMVVAAYGLILPQSILDIP----PRGCINIHASLLPRWRGAAPIHRAIESGDAETGVTIM
FMT_CHRVO         VMVVAAYGLILPQDVLDIP----ARGCLNIHASLLPRWRGAAPIQRAILAGDDETGITIM
FMT_THIDA         VMVVAAYGLILPQAVLDLP----RLGCLNIHASLLPRWRGAAPIQRAILAGDCETGITIM
FMT_AROAE         VLVVAAYGLILPRAVLDLP----RFGCLNIHASLLPRWRGAAPIHRAIEAGDTETGITIM
FMT_NEIM0         VMVVAAYGLILPQDVLDVP----KHGCLNIHASLLPRWRGAAPIQRAIEAGDAETGVCIM
FMT_DECAR         IMVVAAYGLILPQVVLDMP----RFGCINIHGSLLPRWRGAAPIQRALLAGDAETGVCIM
FMT_METFK         ALVVAAYGLIIPATVLSMP----RYGCYNIHASLLPRWRGAAPIQRALLAGDKETGVTIM
FMT_POLNS         AMVVVAYGLILPQEILDITEKPGRHGSFNIHASLLPRWRGAAPIQRAIEAGDAKTGVCIM
FMT_POLAQ         AMVVVAYGLILPQEILDITQQAPRFGSFNIHASLLPRWRGAAPIQRAIEAGDAKTGVCIM
FMT_NITEC         VMIVAAYGLILPEAVLRIP----RHGCINIHASLLPRWRGAAPIQRALLEGDAETGISIM
FMT_NITEU         VMIVAAYGLLLPEAVLRIP----RHGCINIHASLLPRWRGAAPIQRALLEGDTETGISIM
FMT_NITMU         IMVVAAYGLILPFSVLNIP----KLGCVNIHASLLPRWRGAAPIERAILAGDRETGITIM
FMT_STRM5         LMVVVAYGLILPKAVLAIP----THGCWNVHASLLPRWRGAAPIQRAIQAGDTKTGVCLM
FMT_XANC8         LMVVVAYGLILPKAVLAAP----THGCWNVHASLLPRWRGAAPIQRAIEAGDTETGVCLM
FMT_XYLFA         LIVVVAYGVILPEAVLAIP----DDGCWNVHASLLPRWRGAAPIQRAIEAGDTETGVCLM
FMT_HALHL         LMVVVAYGQILRRNVLDVP----RFGCVNVHASLLPRWRGAAPIQRALLAGDEQTGVTLM
FMT_GLUDA         AAVVAAYGLILPGAMLTPR----AGARLNVHASLLPRWRGAAPIQAAILAGDDESGVTIM
FMT_GLUOX         AAVVAAYGLILPKAMLDAP----RLGCLNIHASLLPRWRGASPIQSAIVAGDSQSGVSIM
FMT_ACICJ         AAVVAAYGQILPADMLVAP----RRGCINIHASLLPRWRGAAPIHAAILAGDAQTGVTIM
FMT_GRABC         AAVVAAYGLILPRVMLDTP----QRGCLNIHASLLPRWRGASPIQNAILAGDTESGVTIM
FMT_AGRFC         VAVVVAYGLLLPEAILSGT----RLGCYNGHASLLPRWRGAAPIQRAIMAGDAETGMMVM
FMT_RHILW         VAVVVAYGLLLPEAVLNGT----RDGCYNGHASLLPRWRGAAPIQRAIMAGDAETGMMVM
FMT_RHIME         VAVVVAYGLLLPEEILSGT----RYGCYNGHASLLPRWRGAAPIQRAIMAGDRETGMMVM
FMT_SINMW         AAVVVAYGLLLPEEILSGT----RCGCYNGHASLLPRWRGAAPIQRAIMAGDRETGMMVM
FMT_CHESB         AAVVVAYGLLLPRAILEGT----RLGAFNGHASLLPRWRGAAPIQRAIMAGDRETGMMVM
FMT_OCHA4         VAIVVAYGLLLPQAILDAP----RLGCYNGHASLLPRWRGAAPIQRAIMAGDSETGMMIM
FMT_RHILO         IAVVVAYGLLLPKVILDAP----RLGCINGHASLLPRWRGAAPIQRAIMAGDLESGMMVM
FMT_BRADU         AAVVVAYGMILPQAILDAP----KLGCYNLHASLLPRWRGAAPINRAIMADDAESGVMVM
FMT_BRASO         AAVVVAYGMILPQAILDAP----KLGCYNLHASLLPRWRGAAPINRAIMAGDAESGVMVM
FMT_NITHX         AAVVVAYGMILPQAILDAP----PLGCFNLHGSLLPRWRGAAPINRAIMAGDAETGVMVM
FMT_NITWN         AAVVVAYGLILPQAILDAP----RYGCYNLHASLLPRWRGAAPINRAVMAGDAESGVMVM
FMT_RHOP2         AAVVVAYGMILPQAILDAP----KLGCYNLHGSLLPRWRGAAPLNRAIMAGDAESGVMVM
FMT_RHOPT         AAVVVAYGMILPQAILDAP----ELGCYNLHGSLLPRWRGAAPLNRAIMAGDAETGVMVM
FMT_RHOPB         AAVVVAYGMILPQPILDAP----TFGCFNLHGSLLPRWRGAAPINRAIMAGDPEAGVMVM
FMT_OLICO         AAVVVAYGMILPANILNAV----PRGCFNLHASLLPRWRGAAPIQRAIMTGDAESGVMVM
FMT_METS4         VAVVVAYGMILPPAILDAP----PLGCLNLHASILPRWRGAAPIQRAVMAGDAETGVAVM
FMT_PARL1         VAVVVAYGLILPKPVLEAP----RLGCLNLHASLLPRWRGAAPIQRAIMAGDAETGVMVM
FMT_CAUVC         AAVVVAFGQILVKDVLEAP----KHGCFNLHASLLPRWRGAAPIQRAIMAGDAVTGVQVM
FMT_CAUSK         AAVVVAFGQILVRDVLEAP----RLGCFNLHASLLPRWRGAAPIQRAIMAGDAVTGVQVM
FMT_PHEZH         AAVVVAFGQILPREVLEAP----RLGSFNVHASLLPRWRGAAPIQRAIMAGDAVTGVQVM
FMT_RUEPO         VAVVVAYGLILPQAVLDAP----RHGCLNIHASLLPRWRGAAPIHRAIMAGDEATGICIM
FMT_RUEST         VAVVVAYGLILPQAVLDAP----RAGCLNIHASLLPRWRGAAPIHRAIMAGDTHTGICIM
FMT_DINSH         IAVVVAYGLILPQAVLDAP----EHGCWNIHASLLPRWRGAAPIHRAILAGDAETGVCIM
FMT_ROSDO         VAVVVAYGLILPQAILDAP----TRGCLNIHASLLPRWRGAAPIHRAIMAGDAQTGVCIM
FMT_JANSC         VAVVVAYGLILPQAVLDAP----ARGCLNIHASLLPRWRGAAPIHRAIMAGDTMTGVCIM
FMT_RHOS1         AAVVVAYGLILPQPILDAP----ERGCLNIHASLLPRWRGAAPIHRAILAGDEETGICIM
FMT_RHOS5         VAVVVAYGLILPQPILDAP----DRGCLNIHASLLPRWRGAAPIHRAILAGDDETGICIM
FMT_PARDP         VAVVVAYGLILPQPVLEAP----WLGCLNIHASLLPRWRGAAPIHRAIMAGDAETGVAIM
FMT_NOVAD         VAVVAAYGLILPQAVLDAP----RLGCLNVHGSLLPRWRGAAPVQRAILAGDEMTGVTIM
FMT_SPHWW         VAVVAAYGLILPQPILDAP----RHGCLNVHGSLLPRWRGAAPVQRAILAGDPTTGVTIM
FMT_SPHAL         VAVVAAYGLILPQAVLDAP----REGCLNVHGSILPRWRGAAPVQRAILAGDAETGVTIM
FMT_ZYMMO         VAVVAAYGLLLPKAILEMP----RLGCLNVHGSLLPKWRGAAPVQRAILAGDQESGVTIM
FMT_MAGSA         VAVVAAYGLILPQAVLDAP----RLGCLNVHASLLPRWRGAAPIQRAILAGDAETGITIM
FMT_BARQU         VAIVVAYGLFLPKAILETP----RLGCFNAHASLLPRWRGAAPIQRAIMAGDKETGMMIM
FMT_BART1         AAIVVAYGLLLPKAILETP----RFGCFNAHASLLPRWRGAAPIQRAIMAGDKETGMMIM
FMT_BARHE         VAIVVAYGLLLPKTILETP----RFGCFNAHASLLPRWRGAAPIQRAIMAGDKETGMTIM
FMT_BARBK         AAVVVAYGILLPKAILEAP----RFGCFNAHASLLPRWRGAAPIQRAIMAGDKETGMMIM
FMT_MAGMM         VVVVVAYGQILSREVLEIP----THGCINVHASLLPRWRGAAPIQRAILAGDAQSGVTIM
FMT_SYMTH         LTVVVAYGQILSREALEIS----PLGSINVHASLLPRWRGAAPIQRAIMAGDVETGVCTM
FMT_BDEBA         VAVVVAFGQILTQEFLDSF----RFGCVNVHGSVLPRWRGAAPIQRAIEAGDVESGVTLQ
FMT_TRIV2         AFVVVAYGQILSQKILDMP----KLGCVNVHGSILPQYRGAAPIQWCLYNGETETGITTM
FMT_TRIEI         VFVVVAYGQILSTEILEMP----KLGCVNVHGSILPKYRGAAPIQWSIYHGEAETGNTTM
FMT_GLOC7         AFAVVAYGQILSAEILQMP----KLACINVHGSILPKYRGAAPIQWSIYHGETQTGITTM
FMT_MICAN         AFVVVAYGQILSPEILEMP----RLGCINVHGSILPKYRGAAPVQWCIARGEKETGITTM
FMT_SYNP2         VFAVVAYGQLLSPQILQMP----RLGCVNGHGSLLPKYRGAAPIQWSLVQGETVTGMTTM
FMT_SYNY3         FFVVVAYGQLLSPEILVMP----RLGCVNVHGSLLPKYRGAAPLQWAIANGETETGVTTM
FMT_SYNP6         AFVVVAYGQLLPAEVLAMP----RLGCINVHGSLLPAYRGAAPIQWSLINGDRETGIVTM
FMT_THEEB         VFVVVAYGQILPQSILDIP----RYGCINIHGSLLPRYRGAAPIQWALYHGEEETGVTTM
FMT_GLOVI         FFVVAAYGQILPQRVLDMP----GRGCINVHGSLLPKYRGAAPVQWAIYHGEPETGITTM
FMT_SYNJA         VFVVVAYGQILPPAVLQMP----KLGCINVHASLLPAYRGAAPIQWAIANGETETGVTTM
FMT_DEIRA         VAVTCAYGKILPAGVLEIP----RFGFLNTHTSLLPRYRGAAPIQWALIRGETVTGTTIM
FMT_THET8         VAVVAAYGKLIPKEALDIP----PHGFLNLHPSLLPKYRGAAPVQRALLAGERETGVSIM
FMT_ROSCS         VGVVAAYGEILRRDVLAIP----PLGYVNIHPSLLPLYRGPSPVAGAILNGDAETGVTIM
FMT_ROSS1         VGVVAAYGEILRRDVLAIP----PLGYVNIHPSLLPLYRGPSPVAGAILNGDAETGVTIM
FMT_CHLAA         VGVVAAYGEILRRAVLSIP----PLGYLNIHPSLLPLYRGPTPVAGAILAGETVTGVTIM
FMT_HERA2         VGVVAAYGEILRKQVLAIP----ALGYLNIHPSILPLYRGPAPVTGAILAGDDLVGVSII
FMT_DEHMB         VIVVAAYGLILPQAVLDIP----VYGVLNIHPSLLPRYRGATPVAATLLGGDEWAGVSLM
FMT_AKKM8         LIVVMAYGQILSQEVIDMA----PMGCINAHASLLPRHRGAACIQSAIKSGDAETGITIM
FMT_DESVV         ILVVAAYGLILPQSVLDAA----PMGAVNVHGSLLPRYRGAAPIQRAVMNGDAVTGITIM
FMT_MYXXD         VCVVTAYGRILPKDLLELP----THGCVNVHGSLLPRFRGAAPIQWAIAHGDTETGVSLM
FMT_SORC5         VALVIAYGRILPKAVLEAP----RRGCMNLHASILPRYRGAAPITWAIVGGETETGISLM
FMT_ANASK         ALVVAAYGRILGKDLLTLA----PHGAINVHGSLLPRWRGAAPIQWAVAEGERETGVTIM
FMT_KORVE         AIIVVGYGRIIPQWMIDLP----PLGNINVHASLLPKYRGAAPIQWAIAMGEAVTGVTTM
FMT_SOLUE         AMVIVGYGQIIPQNVIDLA----PLGIINVHASLLPKYRGAGPIQWSIVNGETRTGVTTM
FMT_GEOBB         LIVVIAFGQILPKALLDIP----KYGCINVHASLLPRYRGAAPLNWCIINGENETGVTTM
FMT_GEOUR         LIVVVAFGQILPKSLLDIP----KYGCINVHASLLPRWRGAAPLNWCIINGETETGVTTM
FMT_GEOMG         LIVVVAFGQILPQSLLEIP----RHGCINIHASLLPRYRGAAPINWCLINGETETGITTM
FMT_GEOSL         LIVVVAFGQILPQSLLDIP----KHGCINIHASLLPRYRGAAPLNWCLINGETETGITTM
FMT_GEOLS         LIVVIAFGQILPKALLEIP----PQGCVNVHASLLPRYRGAAPLNWCIVNGETETGVTTM
FMT_PELPD         LIVVVAFGQILPKALLDIP----PLGCVNVHASLLPRYRGAAPLNWCIINGETETGVTTM
FMT_SYNAS         LIVVAAFGQILPKTVLDFP----PLGCINVHPSLLPRYRGAAPINWTLIHGETRTGVTIM
FMT_DESPS         LIVVTAYGRILPKPILDLA----PLGCINVHGSLLPKYRGAAPIQWAVIQGDDEVGVTTM
FMT_DESRM         CIVVVAYGKILPTEILELP----PKGCINVHASLLPYYRGSAPIHWAIINGEEETGVTTM
FMT_PELTS         VIAVVAYGRIIPPDILTIP----KYGCINVHASLLPKYRGAAPIHWAVINGEKETGITTM
FMT_MOOTA         LIVVVAFGRILSREILDLP----ARGCVNLHASLLPRYRGAAPIHRAVMNGEVETGVTTM
FMT_HELMI         AGVVVAFGRILPPRLLDAF----PQRWINVHASLLPKYRGAAPIHRAVIDGEKETGITTM
FMT_NATTJ         LIVTAAYGQILPRKILDLP----RIKAINVHASLLPEYRGAAPIHRAVMDGKEQTGVTIM
FMT_METI4         LLVVCDYGQILSKAVLEIP----SIGALNIHGSLLPKYRGASPIQAAIMNRDKETGVTVI
FMT_RHOBA         LLVVCDYGQILKPDALQSA----RLGGINLHGSLLPAYRGAAPVQRALLSGDRETGVSVI
FMT_FRAAA         CCPVVAYGALLPREALAIP----RHGWVNLHFSLLPAYRGAAPVQRTVLAGDDLTGASVF
FMT_FRACC         CCPVVAYGALLPPAALAIP----RHGWVNLHFSLLPAYRGAAPVQRTLLAGDDLTGASVF
FMT_FRASN         CCPVVAYGALLPRPALDIP----KHGWVNLHFSLLPAYRGAAPVQRAVLAGEDMTGASVF
FMT_SACEN         CCPVVAYGALLRQTALDIP----EHGWVNLHFSLLPAWRGAAPVQAAIKHGDQITGASTF
FMT_SALTO         CVPVVAYGALVPPAALEIP----RHGWVNLHFSLLPAWRGAAPVQHALLHGDELTGASVF
FMT_STRCO         CCPVVAYGALLPRVALDVP----ARGWVNLHFSLLPAWRGAAPVQHALMAGDEITGASTF
FMT_STRGG         CCPVVAYGALLPKVALDVP----ARGWVNLHFSLLPAWRGAAPVQHAVMAGDEVTGASTF
FMT_STRAW         CCPVVAYGALLPRVALDIP----AHGWVNLHFSLLPAWRGAAPVQHSIMAGDEITGASTF
FMT_THEFY         CCPVVAYGALLRQEALDIP----RYGWVNLHFSLLPAWRGAAPVQHAILHGDDITGATTF
FMT_MYCBP         CCAVVAYGALLGGPLLAVP----PHGWVNLHFSLLPAWRGAAPVQAAIAAGDTITGATTF
FMT_MYCLE         CCVVVAYGALLGSPLLAVP----PRGWVNLHFSLLPAWRGAAPVQAAIAAGDTITGATTF
FMT_MYCPA         CCAVVAYGALLRDELLAVP----PHGWINLHFSLLPAWRGAAPVQAAIAAGDIITGASTF
FMT_MYCUA         CCAVVAYGALLGDALLGVP----PQGWVNLHFSLLPAWRGAAPVQAAIAAGDAVTGATTF
FMT_MYCS2         CCAVVAYGALLSQRLLAVP----RHGWINLHFSLLPAWRGAAPVQAAIAAGDTVTGATTF
FMT_MYCSS         CCAVVAYGALLSERLLAVP----PHGWINLHFSLLPAWRGAAPVQAAIAAGDAVTGATTF
FMT_MYCGI         CCAVVAYGALLREELLAVP----ALGWVNLHFSVLPAWRGAAPVQAALAAGDEVTGATTF
FMT_MYCVP         CCAVVAYGALLGDALLAVP----AHGWVNLHFSVLPAWRGAAPVQAALAAGDEVTGATTF
FMT_MYCA9         CCAVVAYGALLKPELLAVP----RLGWVNLHFSLLPAWRGAAPVQASIAAGDEITGATTF
FMT_NOCFA         CCPVVAYGALLPQAALDIP----RHGWINLHFSLLPAWRGAAPVQAAINAGEEITGATTF
FMT_NOCSJ         CCPVVAYGALLPQAALDIP----VHGWVNLHFSALPAWRGAAPVQHAIWAGDEVTGATTF
FMT_ACIC1         LAVVVAYGALVPEPALAIP----RHGWVNLHFSILPSWRGAAPVQHAILHGDEVTGATTF
FMT_KINRD         ACPVVAYGALVPRAALEVP----RFGWLNLHFSLLPAWRGAAPVQRAVMNGDDVTGACVF
FMT_PAEAT         VAAIVAYGGIVPKAALGVP----THGWVNLHFSLLPAWRGAAPVQRSIIAGDDVTGAATF
FMT_ARTS2         AAAIVAYGGLIPRAALDVP----RHGWINLHFSLLPAWRGAAPVQRAVMAGDDITGAVTF
FMT_RENSM         VAAIVAYGALVPPAALTIP----DYGWINLHFSLLPAWRGAAPVQHAVINGDDVTGAVTF
FMT_CLAM3         LGVIVAYGGLVREPLLSTP----ARGWINLHFSLLPRWRGAAPVQRSIMAGETVTGASVF
FMT_CLAMS         LGVIVAYGGLVREPLLSTP----ARGWINLHFSLLPRWRGAAPVQRSIMAGERVTGASVF
FMT_LEIXX         VGVVVAYGGLVHEPLLSLP----RRGWVNLHFSLLPRWRGAAPVQHALIAGDRETGAAVF
FMT_CUTAK         VAVVVAYGGLIPADLLAVP----RHGWINLHFSLLPRWRGAAPIQRAIMAGDEETGACVF
FMT_BIFAA         AAAVVAYGKILKQDVLDAL----PMGWYNLHFSLLPQWRGAAPVQRSIWAGEKVTGATVF
FMT_BIFLD         IAAVIAYGNILPKNVLDAV----PMGWYNLHFSNLPKWRGAAPAQRAIWAGDPTTGADVF
FMT_COREF         CLPVVAFGQLITRDLLDVA----PHGWVNLHFSLLPAWRGAAPVQAAIRAGDQLTGATCF
FMT_CORGB         CLPVVAYGQLITKDLLDVA----PHGWVNLHFSLLPAWRGAAPVQASIREGDQITGATTF
FMT_CORDI         CVPVVAYGNLITEDLLQAV----PHGWINLHFSLLPRWRGAAPVQAAIAAGDTSTGATTF
FMT_CORJK         AAAVVAYGNLIPKDILDVF----EHGWVNLHYSLLPRWRGAAPVQAALAAGDETTGASIF
FMT_CORU7         AVAVVAYGNLIPADLLDAV----EHGWVNLHYSLLPRWRGAAPVQAAIAAGDQETGATIF
FMT_RUBXD         --VVAAYGQILRPDTLYAA----RHGAYNVHASLLPAYRGAAPVERAIMDGERETGVTVI
FMT_BACFN         LQIVVAFR-MLPEVVWNMP----RLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTF
FMT_BACTN         LQIVVAFR-MLPEVVWNMP----RLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTF
FMT_BACV8         LQIVVAFR-MLPEIVWNMP----RLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTF
FMT_PARD8         LQIVVAFR-MLPEVVWNMP----RLGTFNLHASLLPQYRGAAPINWAVINGDTETGVTTF
FMT_AZOPC         LQVVVSFR-LLPEVVWNMP----SLGTFNLHASLLPQYRGAAPINWAIINGEKETGVTTF
FMT_PORG3         LQIVVAFR-MLPRSVWQMP----PMGTINLHGSLLPMYRGAAPINHAIRHGDTETGVTTF
FMT_CHLCH         VIVVAAFR-ILPPAVYSQA----RLGAFNLHASLLPAYRGAAPVNWAIMNGEEETGVTTF
FMT_CHLPD         VIVVAAFR-ILPPEVYGQA----KLGAFNLHASLLPAYRGAAPINWAIINGEKESGVTTF
FMT_CHLL2         VIVVAAFR-ILPPAVFSIA----RLGAFNLHASLLPAYRGAAPINWAIIRGEKVTGVTTF
FMT_PELLD         VIVVAAFR-ILPPAVYGAA----RLGSFNLHASLLPAYRGAAPINHALMQGDRESGVTTF
FMT_CHLPM         VIVVAAFR-ILPPAVYGAA----RLGAFNLHASLLPAYRGAAPINHALIEGERESGVTTF
FMT_CHLPB         VIVVAAFR-ILPPAVYELA----RLGSFNLHASLLPRYRGAAPVNWTIINGDRETGVTTF
FMT_PROA2         VLVVAAFR-ILPPAVYEQA----RLGAFNLHASILPRYRGAAPVNWAIINGERESGVTTF
FMT_CHLTE         VIVVAAFR-VLPPEVLELP----PLGTFNLHGSLLPAYRGAAPVNWAIINGDAETGVTTF
FMT_CHLAB         VFIVVAYGAILKQMVLDIP----KYGCYNLHAGLLPAYRGAAPIQRCIMDGVVQSGNTVI
FMT_CHLCV         VFIVVAYGAILRQVVLNIP----KYGCYNLHAGLLPAYRGAAPIQRCIMDGVTQSGNTVI
FMT_CHLPN         VFIVVAYGAILRQIVLDIP----RYGCYNLHAGLLPAYRGAAPIQRCIMEGATESGNTVI
FMT_CHLMU         VFVVVAYGVILKQELLDIP----KYGCYNLHAGLLPAYRGAAPIQRCIIAGETLSGNTVI
FMT_CHLTA         VFIVVAYGVILKQELLDIP----TYGCYNLHAGLLPAYRGAAPIQRCIMDGGVLSGNTVI
FMT_PARUW         LFVVVAYGEIIKQHLLDMP----KRACINLHASLLPKYRGAAPIQRSIIEGEKETGVTIM
FMT_BORAP         LMLVFSYGKIFKKEFLDIFPKG----CINVHPSLLPKYRGVSPIQSAILNGDCVSGITIQ
FMT_BORBP         LMLVFSYGKIFKKEFLDIFRMG----CINVHPSLLPKYRGVSPIQSAILNGDCVSGITIQ
FMT_BORHD         LMLVFSYGKIFRQEFLDIFPMG----CINVHPSLLPKYRGPSPIQTAILNGDTVGGITVQ
FMT_BORRA         LMLVFSYGKIFKQEFLDIFPVG----CINIHPSLLPKYRGPSPIQTVILNGDSVSGITVQ
FMT_TREDE         LLVCFAYGKIFGPKTMALFPLG----GINIHPSLLPRWRGPAPVPAAILAGDKLTGITIQ
FMT_TREPS         VLVCFAYGKIFGPRFLALFPRG----AINVHPSLLPRWRGSTPVPAAILAGDCETGVTLQ
FMT_LEPBL         LYVVFAYGSILPKEVYECPPLS----SINLHGSLLPDLRGASPVQTALWKGYSASGITIQ
FMT_LEPIC         LYVVFAYGSILPKEVYAHSTLT----SINLHGSLLPDLRGASPVQTALWKGYTKTGITIQ
FMT_ELUMP         YGIAVAYGQILKQHIIDIPKLG----IVNIHFSLLPKFRGAAPVQHTLFAGETKTGVTAF
FMT_UNCTG         TGVAVAYGKLIPKVVFDIPKYK----TFNIHFSLLPKYKGAAPVQHALCRGETETGISSF
D1B5G6_THEAS      VLFVVDCSFFIREPLLSFPTMG----CINLHPSLLPQLRGAAPIQRALWMGLDVTGVTMF
FMT_COPPD         VAIVVDFGFYIPKQLFQADKPV----MVNIHPSLLPKYRGPNPIRRAICSGELETGVTLI
FMT_THEAB         LGIVVAYGKLLKPPFLNAIPF------YNIHASLLPKYRGAAPIQRALENGESVTGITIF
FMT_THEM4         IGIVVAYGKLLKPPFLNTLEF------YNVHASLLPSYRGAAPIQRVLENGEKRTGITIF
FMT_FERNB         IGIVVAYGRLLRKPFLDAIPL------YNVHTSLLPKYRGPAPMQRAIENGERVTGVTIF
FMT_THEMA         VIIVASYGKILGEKVLSLPRLG----CYNIHPSLLPKYRGASPIQRVLENGEERTGVTIY
FMT_PSELT         IGIVVAYGGLIKKKFLDLIPFG----YYNIHPSLLPKYRGAAPINRALENGEKMTGVSLF
FMT_MESFL         FIVTCAYGQFVPTKILDLP----KIDSINVHGSLLPKYRGGAPIQYAIKNGDSKTGISIM
FMT_MYCMS         FLITCAFGQFIPTKILKLA----KIDSINFHGSLLPKLRGGAPIQYAIKNGDKKTGITIM
FMT_UREP2         IIITCAFGQFINQGIIDIP----KYKIVNIHASLLPKLRGGAPIHYAILNGELKTGITLM
FMT_UREU1         IIITCAFGQFINQGIIDIP----KYKIVNVHASLLPKLRGGAPIHYAILNGDLQTGITLM
FMT_MYCPE         AFVTCAFGQFIPDSILSIP----EFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLM
FMT_MYCPU         FFLTAAYGQYIPEKILNLP----KIASLNVHGSLLPKYRGAAPIQHALLNGDDETGISLI
                            .                 * * . **  :*       :       .    

FMT_BACVZ         YMVEKLDAGDMISKIEVEIDETDNVGTLHDKLSIAGAKL------LSETVPNVISGNIKP
FMT_BACSU         YMVEKLDAGDMISKVEVDIEETDNVGTLHDKLSVAGAKL------LSETVPNVIAGSISP
FMT_BACLD         YMVEKLDAGDMLAKVEVDIEETDNVGTLHDKLSKAGAAL------LSETVPRIIDGSVTP
FMT_BACP2         YMVERLDAGDMISKVEVEIDELDNVGTLHDKLSVAGAAL------LKDTVPNVLSGSISP
FMT_BACCN         YMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHL------LSKTVPLLVQGKLEP
FMT_BACMK         YMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHL------LSKTVPLLIQGKLEP
FMT_GEOTN         YMAEKLDAGDMLTQVEVPIEETDTVGTLHDKLSAAGAKL------LSETLPLLLEGNLAP
FMT_BACHD         YMAEKLDAGDILTQVTVPIADDDHVGSLHNKLSEAGAAL------LAKTIPPLIKGELQS
FMT_OCEIH         YMAEKLDAGDILTQVEVPIEQDDHVGTMHDKLSLAGANL------LSETLPSLFNNEITP
FMT_STAAW         YMVKKLDAGNIISQQAIKIEENDNVGTMHDKLSVLGADL------LKETLPSIIEGTNES
FMT_STAEQ         YMVKKLDAGNIISQQSIRIEEEDNVGTMHDKLSFLGAEL------LKKTLPSIIDNTNDS
FMT_LYSSC         YMAEKLDAGDIISQRAIPIELDDHTGRVFDKLSMVGRDL------LKDTLPSIINRTNNR
FMT_LISMF         YMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAEL------LMDTLPDFLAGKITA
FMT_BACSK         YMAEKLDAGAVLSQQAVAITDEDDVQTMHDKLSAVGADL------LEKTIVALEQGTIEA
FMT_LACBA         FMEKKMDAGAVLAQRAIPITDQDDVGTMFAKLSDLGRDL------LLETLPKLLAGELTP
FMT_PEDPA         YMVKKMDAGEMLATAKIPITDQDDVGTMFEKLSLLGRDL------LLDTLPQLIEGNVQP
FMT_LACPL         YMVKKMDAGDMLAQRAIPIEKNDDTGTMFDKLSLVGRDL------LLETLPKLIAGEITA
FMT_LACF3         YMVKKMDAGDIISQASLPITKQDDTGTMFEKLSLLGRDL------LLDTLPKLLAGDITP
FMT_LACS1         YMVKKMDAGDMLAQAELKIESTDDTGTIFEKMSILGRDV------LLETLPKIISGNVEA
FMT_LACCB         EMVKKMDAGDMFAQAKLPLTRADDTGTVFAKLSLLGRDL------LLETLPKIIAGTATR
FMT_LACSS         HMAKKMDAGDMIEQASIPIEATDDTGSLFDKLSYVGRDL------LLKTLPGIIAQTAPR
FMT_ENTFA         EMVKKMDAGAILSQRAIPITKQDDVGTMFEKLSILGKEL------LLETLPKLIAGEITP
FMT_LACAC         EMVKKMDAGDIYAQEAIKIEPEDNAGTLFSKLSILGRDL------LLKTLPSIIDGSVKK
FMT_LACJO         EMVKKMDAGDIFAQKALPITDEDTSGTLFDKLSILGRDL------LLETLPKFIDGTVTR
FMT_LACDB         EMVKEMDAGDMYAQASLPIRPDETSGEVFEELAPLGRDL------LLETLPKIASGEIVK
FMT_STRA5         EMVAKMDAGDMVSKASVEITDEDNVGTMFDRLAVVGRDL------LLDTLPGYLSGDIKP
FMT_STRT1         EMVKEMDAGDMVSQKALPILDQDNVGTMFEKLAVLGRDL------LLETLPAYIAGEIKP
FMT_STRGC         ETVKEMDAGDMISRRSIPITDEDNVGTLFEKLAIVGRDL------LLDTLPAYLSGDIQP
FMT_STRP4         EMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDL------LLDTLPAYIAGDIKP
FMT_STRS2         EMVKEMDAGDMISSDSIAIEESDNVGTLFEKLAVVGRDL------LLQTLPAYIAGDLKP
FMT_STRSV         EMVKEMDAGDMIASKATPIEETDNVGTLFEKLALIGRDL------LLDVLPAYRAGQIIP
FMT_STRMU         EMVKEMDAGDMIAKASTPITDADDVGTMFEKLAIIGRDL------LLQTLPGYLSGKIEP
FMT_STRPM         EMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDL------LLDSLPAYLSGELKP
FMT_LACLA         EMIRKMDAGDMIAQDSTPILEDDNVGTMFEKLALVGRDL------LLETLPKYLSGQLKA
FMT_ALKMQ         YMDVGLDTGDMLLKKEVLIGADETAGELRDRLMALGADT------LIKTLNQVQRG----
FMT_ALKOO         YMDVGLDKGDMILKEEVEIGAEETAGELHDRLMHLGAQV------LRKTIGLIENN----
FMT_CLOD6         YMDEGLDTGDMILKTEVNLDENITAGELHDKMMNIGAET------LKETLRLIEEG----
FMT_CLOB8         LMDVGLDTGDMILKDEVEITNNMTTGELHDILMVRGADL------LVKSIEGISKG----
FMT_CLOBB         LMDVGLDTGDMLLKEEVEIHEDMTSGELHDILMISGGEL------LLKTIEGLYNG----
FMT_CLONN         LMDVGLDTGDMLMTQEVDINDSMTAGELHDILMIQGGDL------LVDTINKMVSG----
FMT_CLOPS         LMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGEL------LVRTIKGILNN----
FMT_CLOTE         FMDVGLDTGDMLLKDEFKIEDNTTAGELHNKLMESGGEL------LVKTINGLVED----
FMT_CLOAB         IMAEGLDTGDMLLKDEVDIKRDMTAGELHDILMNRGADL------LVKTIDEFSKG----
FMT_HUNT2         YTDAGMDTGDMLLKAEIEISDDMTAGELHDKLACLGAEV------LRETLKKIEDS----
FMT_CALS4         LMDKGLDTGDMLLKRSIAIEEDDDAQTLHDKLANLGAEV------LSETLKKLKEG----
FMT_THEYD         IIDEGLDTGPILLQKEISINDEDNAETLSEKLSVVGAEL------IIETIDKMRKG----
FMT_AQUAE         LVNEEMDAGDILAQEKIPIEEEDNFLTLSEKLAKSGAKL------LVNTLRLWFEG----
FMT_HYDS0         LMSSKMDEGDILSVESIPIEQEDNYEKLSNKLSIKGAKL------LKDTILSWVSG----
FMT_FUSNN         YVEEELDAGDVILQEETEISDEDTFLSLHDRLKDMGADL------LLKAIELIKKG----
FMT_SULSY         EIIKELDAGDVYACREVEITEDDDIISLHDKLAEEGARL------LIKVLDKIEKG----
FMT_DICT6         KMEKGLDTGPVYAIKKIPILPDDDKGTLSIKLANLGADL------LLEVLPLIKEG----
FMT_DICTD         KMERGLDTGPVYAIRKIPILPDDNRGTLSIKLAHLGAEL------LLEVLPLIKDG----
FMT_CARHZ         FMDEGLDTGDIALQEKVAINQEITGGELRKILAEIGADL------IIEALKRLREG----
FMT_SYNWW         FMDEGLDTGDIIMQEAIAVDDNINHGELEKILADMGADL------LLQVVDRLVQGE---
FMT_ANAPZ         QINEFMDAGDIYLQEVTEIGEKENILDLSRRLSVMGSRM------LLKVLDSIGSIQP--
FMT_ANAMM         QLNERLDAGDIFLQESTPIGSRENIVALSERLSSMGGRM------LLKVLDNLDTMRS--
FMT_EHRCJ         QMNELLDEGDILLQRDIPIDEQDNIDTLSKKLAHLGSSM------LIEVLDNIDNLVP--
FMT_EHRCR         QMNELWDEGDILLQRDIPIDEQDNIDTLSQKLSNLGSSM------LIEVLNNIDHLVP--
FMT_EHRRW         QMNEGWDEGDILLQKKLSIDEQDNIETLSSKLSNLGGAM------LVEVLNNIDNLVP--
FMT_WOLPM         QLDEGLDSGTILKQEKFLIEKNDNYKTLHDKLSKLGSDL------LLKVLNEIEKQLP--
FMT_WOLPP         QLDEGLDSGPILKQKKFLIEKSDNYKTLYDKLSELGSDL------LLKVLNEIEKQVP--
FMT_RICCK         RMDTGLDTGDILMKEDFDLEERTTLKELHNKCANLGAEL------LINTLVNIDNIVP--
FMT_RICTY         RMDSGLDTGDILLKEDLNLEKRITLDELSNRCAHLGAEL------LIQTLANIDNIVP--
FMT_RICBR         QMDAGLDTGDILMKEDFDLPKKITLQELHDKCANLGAEL------LIKTLANIDKIVP--
FMT_ORITB         QMDQGVDTGDIILCQKFHLAKNICFSELHDQCAKVGAKL------VVKAINYIHTLPR--
FMT_BLOFL         QMNSNIDTGDILHSTPCKISPKDTSYTLSKKLACIGSIA------LLKTIEKIILGT---
FMT_BLOPB         QMDLGIDTGDILHIMPCKIFPKDTSCTLSNRLVNIGSAM------LSQVLDQFILGT---
FMT_WIGBR         KMNDEIDTGPILYKRVCSIQDTDTTETLLNKLSIIGKAA------IIQLLHQISIGK---
FMT_BUCAI         QMNDEIDSGNIMHSITCSISSKDTTKTLSLKLIKIGIEA------LLEVLEKIILNT---
FMT_BUCAP         KMNEKMDAGTIINSVKCNILPNDTTETLTFKLIEIGIQV------LLKTLYYINKNI---
FMT_BUCBP         KMNNNIDTGDIIYSSSCIINKSDTSVTLQNKLKILSCQG------LIQVLKNFKSSY---
FMT_FRAP2         QMDAGLDTGDILNTLEVEIQDTDTSQSLHDKFAKLSIKP------LLETLENIDTIK---
FMT_FRATN         QMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKP------LLETLEKIEIIK---
FMT_PROM9         KMNEGLDTGDLLLEEKIKIDNNDNLITLTEKLSILSAKL------FLNATSLLEENI--N
FMT_PROMS         KMNEGLDTGDLLLEEKIKIGNEDNLNTLSEKLSILSAKL------FLKAASLLEENF--Y
FMT_PROM2         KMSEGLDTGDLLLEEKIKIDNTDNLNTLTEKLSILSAKL------LLKAVSFLEKNI--N
FMT_PROM5         RMEEGLDTGDVLVEKQIKIEKEDNLQTLTKKLSDLSSEL------LLKAISKIEQNK--N
FMT_PROMP         RMEEGLDTGDVLVEKQIKIENNDNLKTLTKKLSDLSSEL------FLRAISDIEQNK--N
FMT_PROMA         AMEEGLDTGAVLLEKKLKLKLLENAEQLSQRLKDLSCNL------IIEGIEILEKVR--E
FMT_PROM4         LMEEGLDTGPILLQKEFPIDVLRNSYQISSDLSSLSATT------IIEALELIRTSSHFT
FMT_SYNPW         AMEEGLDTGPVLLEQRLSINLLENAHQLGERLSRLSADL------MLQAMPVIEAAGPGL
FMT_SYNSC         AMEEGLDTGPVLLEQRTPIELLDTSIALAERLSALTAEL------MVQAMPLIEAAGTGP
FMT_SYNPX         AMEEGLDTGPVLLERRLSIGLQDNAHALAEKLSGLTAEL------MVEAMPLIEAVGAGP
FMT_SYNS3         AMEEGLDTGPVLIERNLPIGLLDNGHTLAERMSVLTAEL------MVEAMPLIESAGQGS
FMT_SYNS9         AMEEGLDTGPVLLEQRLPISLDQNSHDLGEKLSQLTATL------MVEAVDLILKAGVGT
FMT_SYNR3         AMEPGLDTGPVLLERALDVQLLENAAGLAERLSHLTAEL------FVEALPRIEAAGPGP
FMT_PROMM         AMEEGLDTGPVLVQERVAIGLLENANQLSNRLSSITAKL------FLESMPRIAAAGPGI
FMT_PROMT         SMEEGLDTGPVIEQESTVIKDSDNLEILTNRLSVMSSKL------LLKSLEKIKLTKGLN
FMT_PELUB         KIGEKLDTGPVGNIYRIKIKDSDNAETISTKLSILASEK------IIENVENI-------
FMT_CAMJ8         LMEEGLDTGAVLESLECDIKDK-NSSEVFELLANLAAKL------ILSTLLNFDKIIP--
FMT_WOLSU         RMEEGLDCGEVLGCSFVEIKEEWGVSRLFEELANRAAAL------TLKVLKRFSEIRP--
FMT_CAMFF         RMGVGLDDGDILGFSVIEIPNL-KSSQLFCELAKMAAKL------TIKILNEFESISP--
FMT_HELAH         LMDLELDSGDILGSASFLREGYLNLETLSLKLAHMGATL------LLSTLKNFHSITP--
FMT_HELPY         LMDVELDSGDILESASFLREDYLDLDALSLKLAHMGAAL------LLSTLKNFSSITR--
FMT_SULDN         LMNEGLDTGDILKIKEIEVDADEMSESLFSRLTEVASDL------TIDVLENFVQYTP--
FMT_CALS8         KMDEGLDTGDILLQEGIEIEQNDDVITLSKKLSELGAKL------LIETLKNISNIVP--
FMT_ECOLI         QMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQG------LITTLKQLAD-GTAK
FMT_SALDC         QMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQG------LITTLKQLAD-GTAA
FMT_KLEP7         QMDVGLDTGDMLYKLSCPITAEDTSGSLYDKLAELGPQG------LLATLAQLAN-GTAR
FMT_ENT38         RMDVGLDTGDMLYKLACPITAEDTSATLYDKLADLGPQG------LIETLQQLAD-GKAQ
FMT_CROS8         QMDKGLDTGDMLRKLSCPITADDTSASLYDKLAQLGPQG------LLATLEDLAA-GRAV
FMT_YERE8         QMDVGLDTGDMLHKIECDIQPEDTSATLYDKLAQLGPQG------LLVTLQQLAE-GSAQ
FMT_YERPY         QMDIGLDTGAMLHKIECAIQPEDTSATLYDKLAQLGPQG------LLITLQQLAA-GTAL
FMT_SERP5         QMDVGLDTGDMMHKIACPIEADDTSASLYDKLAQLGPQG------MLTTLQQMAA-GTAK
FMT_ERWT9         QMDIGLDTGDMLHKLSCPIEAADTSATLYDKLADLGPAG------LLTTLAQLAD-GSAR
FMT_PECAS         QMDVGLDTGAMLHKIACPILPQDTSATLYDKLAALGPRG------LLETLERLAD-SSAV
FMT_SODGM         QMDAGLDTGAMLHKAVCAIQHDDTSASLYDKLAQIGPNA------LLSTLTQIAA-GRAV
FMT_PHOLL         QMDIGLDTGDMLYKARCPITPEDTSASLYEKLANIGPDA------LLKTLSLITS-GKSQ
FMT_PROMH         QMDVGLDTGDMLYKASCPITHQDTSASLYAKLAELGPKA------LINTLDLIIS-GELK
FMT_ACTP2         QMDIGLDTGDMLHKVTTPIAADETSASLYAKLAELAPPA------LLEVLNGLES-QAFK
FMT_HAEDU         QMDAGLDTGDMLHKVSTKIEADETSASLYMKLAKLAPPA------LLAVLDGLTE-QQFK
FMT_ACTSZ         QMNEGLDTGDMLHKVYCEITPQETSATLYQKLAQLAPSA------LIEVLDHLED-GSFQ
FMT_MANSM         QMDEGLDTGDMLHKVYCDITAEETSASLYHKLATLAPPA------LIDVLDELES-GKFI
FMT_HAEIE         QMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSA------LIDVLDNLES-GKFT
FMT_PASMU         QMDEGLDTGDMLYKVYCDIAQDETSTSLYAKLMEIAPPA------LLHVLDGLDK-GKFV
FMT_HISS2         QMNEGLDTGDMLHKVCCDITPTETSTSLYTKLANIAPKA------LLEVLDGLEQ-GLFK
FMT_VIBPA         QMDIGLDTGDMLKIATLPIEATDTSASMYEKLAELGPEA------LIDCLADIAA-GKAV
FMT_VIBVY         QMDIGLDTGDMLKIATLPIDASDTSATMYDKLAKLGPVA------LVECLADIAA-GTAI
FMT_VIBC3         QMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQA------LLECLQDIAQ-GTAV
FMT_ALIFM         QMDIGLDTGDMLKIATLPIEATDTSASMYDKLAELGPVA------LVDCLSDIAD-GSAI
FMT_PHOPR         QMDEGLDTGDMLTIATLPIEPTDTSATMYDKLAGLGPNA------LIDCLSEISA-GTAI
FMT_AERS4         QMDVGLDTGAMIRKVTCPIAANETSTSLYDKLAELGPQA------LVDTINAMAA-GETA
FMT_SHEAM         QMDVGLDTGDMLLKTHLPIEDDDTSASLYEKLAGQGPAA------LLDALAALSE-GTLS
FMT_SHEON         QMDVGLDTGDMLLKTYLPIEDDDTSASLYEKLALQGPDA------LLQALEGLAN-GTLA
FMT_SHEDO         QMDLGLDTGDMLLKTSLPIEDADTSASLYEKLAVQGPQA------LLEALDGLNA-GKLK
FMT_SHEFN         QMDIGLDTGDMLLKTHLPIEATDTSASLYEKLAEQGPKA------LVQALIGLSD-GSLK
FMT_SHEPA         QMDIGLDTGDMLLKTLLPIEDNDTSSTLYEKLAEQGPTA------LVEALAGIAE-GTLP
FMT_SHEPW         QMDIGLDTGDMLLKTQLKIEDTDTSATLYEKLADQGPSA------LVEALAGIAA-DTLP
FMT_SHESH         QMDIGLDTGDMLLKTRLPIEDNDTSASLYEKLALQGPDA------LIEALTGLAK-GELT
FMT_SHEWM         QMDIGLDTGDMLLKTQLPIEDSDTSASLYEKLAEQGPEA------LVEALTGLAK-GELA
FMT_SHELP         QMDIGLDTGDMLLKTHLPIEDRDTSASLYEKLAEQGPSA------LIQALKGLAE-GSLT
FMT_PSYIN         QMDEGLDTGDMLAKVSCPIERDETSASLYEKLALQAPDV------LVDTINKLVK-GELK
FMT_PSEHT         QMNEGLDTGDMLHISRCPISATETSASLYTKLADLGPGA------LIDTINNLAN-GKIT
FMT_COLP3         QMDKGLDTGDMILSAECEIENTDTSASLYEKLANLGPTA------LVNTLTIMAE-PDYQ
FMT_PSEA6         QMDKGLDTGAVLSELRLAITPIDTSATLYTKLAELGPKG------LLETLASLGD-LTPQ
FMT_IDILO         QMEAGLDTGPVLHEERCAISPDETSASLYHKLESLGPEA------LTKVLKDLDG-YQSQ
FMT_PSEE4         RMEAGLDTGPMLLKVVTPISAEDTGGTLHDRLAAMGPGA------VVQAIAGLAD-GSLQ
FMT_PSEPF         RMEAGLDTGPMLLKVVTPISAEDTGGSLHDRLAEMGPPA------VVQAIAGLAA-GTLE
FMT_PSE14         QMEAGLDTGPMLLKAVTPITAQDTGGTLHDRLAELGPPA------VLQAIAGLAD-GSLV
FMT_PSEA7         QMEAGLDTGPMLLKVATPIAADDSGGSLHDRLAALGPKA------VVEAIAGLAA-GTLR
FMT_PSEMY         QMEAGLDTGPMLLKVSTPISAEDTGGSLHDRLARLGPQA------VLQAIDGLAA-GTLI
FMT_PSEU5         QMEAGLDTGPMLLKVNTPISDEDTGGSLHDRLALLGAHA------VVKAVDALAA-GTLT
FMT_CHRSD         QMDAGLDTGAMLLVRETPITATTTGGELHDRLAPLGGEA------IVEALDALAT-DGLT
FMT_HAHCH         QMEAGLDTGPMLLKTVTPISADDTGRTLHDRLAQMGGEA------IVKALALLQE-DKLQ
FMT_ALCBS         QMEAGLDTGPMLLSESLPIGDSETGGELHDRLAAQGARL------LVTVLQDLEK-YLAN
FMT_ACIAD         KMAAGLDTGDMMFKTYCPIEASDTSASLYEKLAAQGAEA------ICTVLECEQQLQKFL
FMT_ACIBS         QMAAGLDTGDMMYKTYCPITSEDTSATLHDKLAAQGATA------ICAVLESEETLQKYL
FMT_COXB1         QMNEGLDTGDMLAKSACVISSEDTAADLHDRLSLIGADL------LLESLAKLEK-GDIK
FMT_METCA         RIEPRLDAGPMLGKRSCSIGDDDTTASLHDRLAGLGAEM------LIELLPGLAA-DRLT
FMT_LEGPC         QMDVGLDTGPMLCKATCPVTSSDTAGSLHDKLAKMSVKP------LLDVLEALAS-NSAQ
FMT_ACIAC         QMDAGLDTGAMLLIEKTAIAPRETTATLHDRLADLGGRL------IVEAME-LAACGGLA
FMT_ACISJ         QMDAGLDTGDMLLLEKTAISPADTTATLHDRLAQLGGRL------IVEALE-MAACGGLK
FMT_DELAS         QMDAGLDTGDMCLVERLPITADDTTASLHDKLADLGGRL------IVEALE-MSACGGLP
FMT_POLNA         QMDAGLDTGDMLLVEKLAIQATDTTATLHDKLAALGGQM------IVQALE-LAAAGQLE
FMT_VEREI         QMDAGLDTGAMLLSQGSAIAPTDTTATLHDRLAALGADL------IVQALEKMAAGADLP
FMT_METPP         QMDEGLDTGDMLLSERESIRSDDSTATLHDRLSALGGRL------IVEALE-AAACGGLV
FMT_RHOFT         QMDAGLDTGAMLQAQAIPIGAGDTTGSLHDRLAELGAQL------MLQVLA-QAVHGSLQ
FMT_BORA1         QMDDGLDTGDMLLERTVPIGAETTAAVLHDELARVGAEA------IVAALA-DLPA--LA
FMT_BORPD         QMDEGLDTGDMLLEHRVPIGAADTAAQLHDALAAAGGQA------IVQALA-ALQAGNLP
FMT_BORPE         QMDAGLDTGDMLLERAVPIGAQQTAAQLHDELARVGGQA------IVDALA-ALAQGGLA
FMT_PARP8         QMDAGLDTGAMISEVRTAIAGTDTTATLHDRLAEAGAKL------IVDALVELERSGKLA
FMT_PARXL         QMDVGLDTGAMISETRTAISGDDTTATLHDRLAQDGAKL------IVEALVELERTGRLA
FMT_BURM1         QMDAGLDTGAMIQASRIAIAPDDTTATLHDRLAADGARL------IVDALARLERDGTLA
FMT_BURTA         QMDAGLDTGAMLHDARVAIAPDDTTATLHDKLAAAGATL------IVDALVELERAGALA
FMT_RALPJ         QMDAGLDTGDMIAMERVPIGLTDTTGTLHDTLAALGGRM------VVEALAKLAQDGKLH
FMT_HERAR         QMELGLDTGPMLLMESLPIAADDTTASLHDKLARLGGEM------IVEALLKLEK-GELT
FMT_JANMA         QMELGLDTGPMLAMQRLPITADDTTASLHDKLATLGGEM------IVQTLRRMEQ-GDLP
FMT_CHRVO         QMDVGLDTGDMLSIHPVAIAADETAATLHDKLAACGAQA------IVETLGRLDR---IV
FMT_THIDA         QMAAGLDTGAMLAKTVVPIADADTAATLHDALAVAGAAA------IVSALSAYDT---LV
FMT_AROAE         QMDEGLDTGPMLMKHAVPIGPADTTGALHDRLAALGAQM------IVEALRRLPSG-ELV
FMT_NEIM0         QMDAGLDTGDVVSEHRYAIRPTDTANEVHDALMEIGAAA------VVADLQQLQSKGRLN
FMT_DECAR         QMEAGLDTGPVLLRGAFPIAATDTTATLHDRLAELGARL------VVEALGKLP----LP
FMT_METFK         EVVPALDAGAMILRGTLPITEHDTAQTLHDGLAEIGAEL------MLQAMDKLEREGRLE
FMT_POLNS         QMDAGLDTGDTVLVVELDIARDETSASLHDRLAGLGADL------IVNALDVLQQGKTMI
FMT_POLAQ         QMEAGLDTGDVVLTADLAIASDETSSSLHDRLAALGAGL------IVDALSLLQDGKGLS
FMT_NITEC         QMDQGLDTGAVLLKRAFLIEPHDTAATLHDKLADLGGKC------IVETLTLLDQ-DKLT
FMT_NITEU         QMNQGLDTGAVLLKRSLPIEPYDTTATLHDKLADLGGKC------IVEALTLLDQ-GRLI
FMT_NITMU         QMDRGLDTGPILLVRSITIAKDDTAGTLHEKLGQLGAAC------IVEALALLQQ-GKII
FMT_STRM5         QMEAGLDTGPVLLHQELPIATTDTGGQLHDKLAELGAQV------LSDGLGLLRAGIKPV
FMT_XANC8         QMEAGLDTGPVLLSQRVEIGEQETGGQLHDRLAALGAQV------LSDGLGLLRAGIRPV
FMT_XYLFA         QMEAGLDTGPVLMSLKTPINAYETSGQLHDRLAEMGAQL------LSDGLGLLRAGLRPV
FMT_HALHL         QMDEGLDTGPMLARKATPISADETAGSLHDRLARIGADL------LVAHLPEILAGAITP
FMT_GLUDA         QMDEGLDTGAMLLTGRVALTPATTASTLHDDLAAMGGRL------IVAALANSETA----
FMT_GLUOX         QMDEGLDTGAVLLEEATPISATDTASTLHDRLSEIGGRL------VVRALAE-QPK----
FMT_ACICJ         QMDEGLDTGATLLAEAVPIGPEDTMVDLLDRLADLGAAL------VIKVLDG-NFP----
FMT_GRABC         RMEEGLDTGPMLLKRAVPITETTTTPELHDALATAGAEA------ILHVLET-QPD----
FMT_AGRFC         KMEKGLDTGPVALTAKVAIDENMTAGELHDSLMLAGARL------MRQAMAKLEAD-DLP
FMT_RHILW         KMDKGLDTGAVALTRKVEIGPNMTAGELHDRLMQVGAKA------MAEAMVKLEMN-DLP
FMT_RHIME         KMDKGLDTGPVALAQSVPIDGMMRAGELHDRLMQVGAVL------MTEAMARLESG-ELP
FMT_SINMW         KMDKGLDTGPVALARSVPIHATMTAGELHDRLSEVGAKL------MTEAMARLEAG-ELP
FMT_CHESB         KMDEGLDTGPIAMTEKIAIGPDMTAGELHDVMKLAGAGL------MVAAIAALEQG-ELA
FMT_OCHA4         KMDAGLDTGPVAMAEKVAITPDMTAGELHDRLSMIGADL------MIRALGALERE-SLA
FMT_RHILO         RMEEGLDTGPVGLLEKCAIDPDMTAGDLHDRLMRVGAAL------MVEALARLAKN-TLT
FMT_BRADU         KMDVGLDTGDVAMAERLAITDTMTAADLHDRLSRLGADL------MVRAMAALDRG-GLQ
FMT_BRASO         KMDVGLDTGDVAMAELLAITDAMTASDLHDKLSRIGADL------MVRAMAALERG-GLT
FMT_NITHX         KMDAGLDTGDVAMAERIAVTDAMTASDLHDALALLGADL------MARAMAALARG-GLQ
FMT_NITWN         KIDAGLDTGDVAMAERVPITDAMTASDLHDTLAPLGADL------MARAMDALERG-ELR
FMT_RHOP2         KMDVGLDTGDVAMAERIAITDAMTVTDLHDALARLGADL------MVRAMAALERG-GLQ
FMT_RHOPT         KMDAGLDTGDVAMAERIAITDAMTVTDVHDQLARLGADL------MVRAMAALERG-GLQ
FMT_RHOPB         KMDIGLDTGDVALTGRIALTDAMTASDLHDALAPLGAEL------MVEAMAQLERG-ELT
FMT_OLICO         KMDVGLDTGDVAMTDRLQITDAMTAQDLHDALAPRGARL------MAQAMVALEQG-SLN
FMT_METS4         RMEPGLDTGPVAMLERVAISPEMTAGDLHDRLMPLGADL------MHRALGALERG-GLT
FMT_PARL1         QMEEGLDTGPVLLAERVAIAPDETAGGLHDRLSHIGASL------MVRALAALSRG-GLA
FMT_CAUVC         RMSEGLDEGPILMSQQVAIADDDTAASLHDKLAAVGARL------LPVALAAIERE-VVQ
FMT_CAUSK         RMSEGLDEGPVLMGEQVRIDALETAGTLHDKLAAVGSRM------LPVALAAIERG-GAR
FMT_PHEZH         RMTEGLDEGPVLSTATVRIDALETAATLHDRLAAAGAGL------IVETLAQIAAG-RAV
FMT_RUEPO         QMEAGLDTGPVLLRSRTPIRAEETTGALHDRLSAMGADL------IVEALARLPE---LT
FMT_RUEST         QMEAGLDTGPVLLRKETEIGGEETTAALHDRLSLMGARM------IVDALATLPD---LK
FMT_DINSH         QMEAGLDTGPVLLREAVAIGAEETTGGLHDRLSALGARL------IVEALARRAE---LV
FMT_ROSDO         QMEAGLDTGPVLAREAVDIGPEETTAQLHDRLSALGAAL------IVDTLARLDQ---LE
FMT_JANSC         QMEAGLDTGPVLLRRETSIGAEDTTGTLHDRLSAIGAKA------IVDALSQLDE---LT
FMT_RHOS1         QMEAGLDTGPVLMCEKTHIGPEETVQDLHDRLSDMGARL------ILGALGALDD---LV
FMT_RHOS5         QMEAGLDTGPVLMCEKTHIGAEDTVQDLHDRLSGMGARL------ILGAIEALDD---LV
FMT_PARDP         QMEAGLDTGPVLAEARTTIGAEDTTADLHDRLAEMGAAL------IVETLHRLP----LP
FMT_NOVAD         QMERGLDTGPMLARIETPVD-GKTAGDLTAELAVKGAAL------MVQVLADLA---SYP
FMT_SPHWW         QMERGLDTGPMLATVETPVD-GKTAGELTDELARSGAAL------MVEVLADLP---AHP
FMT_SPHAL         QMDAGLDTGAMRLIETTPVA-RKSAGLLTHELAEMGALM------MRRVLSELH---AFP
FMT_ZYMMO         QMDRGLDTGAMLKIEKTPIA-DKNAGALSDEIAHIGAKL------MVEVLAQPE---QYP
FMT_MAGSA         QMDAGLDTGAMLSRESILLAPDTTAPWLHDMLAAMGARM------IVETLARLEDDEPPA
FMT_BARQU         KMDEGLDTGSIALSRSIPITDNTTADELSNKLSHIGAEL------MIEMLSTLEKG-QLK
FMT_BART1         KMDEGLDTGSIVLSRSIPITDTTTTDKLSNELSYIGAEL------MIETLSTLEKG-QLK
FMT_BARHE         KMDEGLDTGPIALSCAIPITDNTTTNELAHKLSHIGADL------MIEMLSALEKG-QLK
FMT_BARBK         QMNEGLDTGPIALSRSIAITENITAAELSDKLSHMGAEL------IVEALSALEKG-QLT
FMT_MAGMM         AMEEGLDTGPMYSTVVQSIDNHTTGGQLHDQLMAAGGGL------LVETLARIKHEGLTP
FMT_SYMTH         WMDEGMDTGDVCLTARVPIGPDTTGGELHDELARVGAEL------LLETVRRVEAGDAPR
FMT_BDEBA         KMVKKLDAGDIIGIRRVKITPDMNALQLHDVLAQLGAEL------LQVELMDYVRGNLAP
FMT_TRIV2         LMDAGMDTGAMLLKATTPIGLLDNADDVAQRLSVIGGDL------LIETLYKLQQQ-EIQ
FMT_TRIEI         LMDVGMDTGPMLLKSIIPIGLLDNAVSIAEILAKDGADL------LLETLLRLEDK-EIE
FMT_GLOC7         LMDEGMDTGAMLLKAYTPIQLLDNADKIATTLANQGADL------LIETLLKLEQG-ELN
FMT_MICAN         LMDAGMDTGPMLLKAYTPIALFDNAEQVGATLGQMGADL------LLETLSKLDRA-EIT
FMT_SYNP2         LMDEGMDTGAMLLKAETPIDLWDNAHDLAVKLATSGAAL------LTETLIQLAQG-KIT
FMT_SYNY3         LMDEGMDTGAMLLKTTTPIGLMDNLTAIGDRLARSGAEL------LVQTLKDLDAG-QLQ
FMT_SYNP6         QMDVGMDTGPMLLRWTTPIALDDNSQTLGDRLATAGAEL------LLQTLRQLDQG-HLT
FMT_THEEB         LMDAGLDTGPMLLKRKVRIHLEDNATTLSAKLSETGADL------LLDTLQQLPQ---LQ
FMT_GLOVI         LMEAGLDTGPMLKKIAVPIDEDITGEQLLAQLAHLGAGL------LLETLREFDR---IT
FMT_SYNJA         LMDEGMDTGAILLQAKLPIEPEQTGLELASQLAQRGAEL------LVETLVKLEKG-ELT
FMT_DEIRA         QTDEGMDTGPVLLQEELPIRPEWTSVELSAALSEQAAAL------IVRALRTLET---LT
FMT_THET8         RLDEGLDTGPLYAVWRTPILPDEDAVALGNRLRDKGVEL------LLEVLERLPE---LT
FMT_ROSCS         VIEAKMDAGPILAQRVVPLPPDARTGSLTRELFAIGADM------LLETLDAYATGAITP
FMT_ROSS1         LIDAKMDSGPILAQRTVPLPPDARTGPLTQELFTIGADV------LVETLDAYARGAITP
FMT_CHLAA         LLDPSMDSGPILAQAVVDLPPTARAGQLTDELFRIGADL------LVQVLPRYARGEIEP
FMT_HERA2         KLTAKMDAGPILGQMVMPLANDARAGEWTAQLMRQGGEL------LAQVLPAYAAGQIQA
FMT_DEHMB         KLEAGLDTGPVYSRSMVAIRPEDTTPILADKLAFIGGCM------LLELLSQIPSLP-EP
FMT_AKKM8         HIVRKLDAGDIIAQISTPLEGSETGGTLHDKLARMTPDV------LLPVIHSIEKGTATR
FMT_DESVV         QVVKQLDAGPMLLQKALGIGCDETSGQLHDQLAELGGRL------LVETLARLRAGTIMP
FMT_MYXXD         VMDEGLDTGPVLAMKRMAIAPDETSASLYPKLAALGGEV------LREFLPAYLSGELKP
FMT_SORC5         QMDEGMDTGPVYAVRRTPIGPDTTADELAIDLGALAARV------VREDLRRAVDGELAP
FMT_ANASK         QMDEGLDTGDVLLQRALEIREDDTSETLAPRLAALGGEA------LVEALRLLEAGAIVP
FMT_KORVE         KIDAGLDTGDMLLQAEMPIAPEDTSESLAPRLAELGAEL------LVETLARLEGGVIAA
FMT_SOLUE         RIDAGLDTGDMLLKRDTEIGPEENAMELGARLAVLGADL------LVKTLAGLEAGTIVP
FMT_GEOBB         MMDVGLDTGDMLLKRSTPIGADEDTQSLHDRMSQLGAEL------LAETLDRLARGELVP
FMT_GEOUR         MMDVGLDTGDMLVKRSTPIDPDENTQSLHDRLSVVGAEA------LAETLDLLTAGKLVR
FMT_GEOMG         QMDAGLDTGDMLVKRSISIGPDEDAQSLHDRLSLLGAET------IDETLDRLQVGTLTR
FMT_GEOSL         MMDAGLDTGDMLVKRAIPIGPDEDAQSLHDRLSQLGAET------IDETLDLLLAGKLVR
FMT_GEOLS         LMDVGLDTGPMLLKKTTPIAPDEDIQSLHDRMSQLGAEL------LGETLDGLKTGRIVP
FMT_PELPD         LMDTGLDTGPMLLKRSTPIDENEDIVSLHDRMASLGAEL------LAETLDGLREGRIEP
FMT_SYNAS         YMDEGLDTGDILLQEETPIPPEENFGILHDRLSNLGADL------LLRAVRLLEAHQAPR
FMT_DESPS         QMDEGMDTGDILLRKIIIPSPDETAGTLFDKLAELGTSA------LLETIEGLKKGTIRA
FMT_DESRM         FMDKGMDTGDMILKSSVSIGPSDTVGAIHDKLASDGAKL------LIETIHLLEEDCAPR
FMT_PELTS         FMDEGLDTGDMILQEAVAITEEDTAGTVHDALAVLGARL------LVQTLELVGQGMAPR
FMT_MOOTA         WMAPQLDAGDIILQEKLPIPPEATTGEIHDRLAEVGAGL------LVHTLELIAASRAPR
FMT_HELMI         LMSEGLDEGDMLLKRSLAIGPDDTTGQVHDALAELGARL------LVETLAAMEAGRLQP
FMT_NATTJ         EMCDKMDAGDILNYESVDIGKTDTTGDVYKQIITVGPQL------LIETMDLLEKNQVTP
FMT_METI4         WMDEGIDTGDILMSDKLLVRSTDTAETLHHRLAELGARL------IIQSLEAIRAGKAPR
FMT_RHOBA         HMTPRLDGGPIVASRTTPIRDDETSGELEVRLSEIGVDATREAIGLLRTIESLDSHGPLG
FMT_FRAAA         QIEPAMDSGPVFGVVTERVRPTDTSGDLLDRLADSGAHL------LAAVMDGIDDGTLQA
FMT_FRACC         QIEPAMDSGPVYGVLTERVRPTDTSGDLLDRLAEAGAGL------LVAVMDGIADGTVRP
FMT_FRASN         EIEPALDSGPVYGVLTERIRPTDTSGDLLDRLAVAGARL------LEAVMDGIEDGTLQA
FMT_SACEN         RLVPELDAGPVYGVVTEEVRDTDTSGVLLERLSVSGAKL------LVATLDGIADGTLRA
FMT_SALTO         QLEEGLDTGPVYGTVTDEVRPADTSGDLLERLAHSGAEL------LIAVLDAIEEGSARA
FMT_STRCO         LIEEGLDSGPVYGTVTETVRPTDTSGDLLTRLAFAGAGL------LAATMDGIEDGSLEA
FMT_STRGG         LIEEGLDSGPVYGVLTEEVRPTDTSGDLLTRLAFAGAGL------LAATMDGIEDGTLHA
FMT_STRAW         LIEEGLDSGPVFGTVTEEIRPTDTSGDLLTRLAFAGSGL------LVATMDGVEEGKLKA
FMT_THEFY         QIERELDAGPVYGTVTEPIGPRDTSGDLLERLAKSGAEL------LVRTIDGIAKNELVP
FMT_MYCBP         QIEPSLDSGPIYGVVTEVIQPTDTAGDLLKRLAVSGAAL------LSTTLDGIADQRLTP
FMT_MYCLE         QIEPSLDSGPVYGVVTETIQPTDTAGDLLERLAVSGATL------LSSTLDGIADAILTP
FMT_MYCPA         RIEPALDSGPIYGVVTEAIRPTDTAGELLARLAVSGAEL------LSATLDGIADSTLTP
FMT_MYCUA         QIEPSLDSGPVYGVVTETIRPTDTAGDLLGRLAVSGAEL------LSATLDGIAEGALTA
FMT_MYCS2         QIEPALDSGPVYGVVTETVRDTDTAGDLLERLSDSGAEL------LERTIDGIADGSLTA
FMT_MYCSS         LIEPALDSGPVYGVVTETIRANDTAGELLTRLAESGAHL------LESTLDGIADGRLQA
FMT_MYCGI         QIELSLDSGPVYGVVTETIRPTDTAGDLLGRLAESGAGL------LEATMDGIEDGTLTA
FMT_MYCVP         QIERSLDSGPVYGVVTETIRPTDTAGDLLERLSVSGAGL------LEATMDGIEDGTLTA
FMT_MYCA9         LIEPALDSGPVYGVVTERISPNDTAGALLGRLAESGAGL------LESTMDGIEDGALVA
FMT_NOCFA         QIEAGLDSGPVYGVVTEKIDVTDTAGTLLERLAETGARL------LETTLDGVEDGTLQA
FMT_NOCSJ         RIVKELDAGPTYGVMTERIRPTDTAGDLLARLAEGGAGL------MVATLDGIEDGSLEA
FMT_ACIC1         RLEPDLDTGPIYGTVTEPIRPDDTAGDLLNRLARTGARL------LLDTVDGIAAGVLAP
FMT_KINRD         QLEEGLDTGPVHASFAEPVGPTDTAGDLLSRLAVRGAGV------LVEVLDAIEAGTAHA
FMT_PAEAT         QLEEGLDTGPVFGTLTETVRPEDTAGDLLERLSISGAVL------LSQTLSAIDAGQAAP
FMT_ARTS2         LLEEGLDTGPVFGTLTESVRPDDTSGELLERLSHSGAAL------LAQTLSAIEAGRAVA
FMT_RENSM         QLEAGLDTGPVFGTVTEFIRRDDTGSALLTRLSHSGSVL------LTQTLSAVAAGTATA
FMT_CLAM3         RLERGMDTGPVFAVEERPTGAHETAGDVLHALAMQGADL------LVRTVDGIAAGSAVA
FMT_CLAMS         QLERGMDTGPVFSMEERPTGDHETAGHVLDALAVQGADL------LARTVDAIGAGTAVA
FMT_LEIXX         QLVPELDAGDVFGELRRLIRPDETAGELLDDLARSGARL------LADTVAALADGTAVA
FMT_CUTAK         QLVESLDAGPVYRTMTVPIGPMTTAGELLDELAHTATPL------VIEALEDIEAG-VEP
FMT_BIFAA         RIVRAMDAGPILAQSTVEIGAHETAGELLGRLAEDGSHL------LAASLQALADDQIAP
FMT_BIFLD         KVGEGLDDGPIVASLTIELTGRETSGELLDRLAEEGAPM------YVDALAAVGEGTATF
FMT_COREF         RIDEGLDTGVILSTLEETIQPTDTADDLLTRLAYAGADL------LVDTMTGLEAGTISP
FMT_CORGB         RIDEGLDTGVILSTIEDTIQPTDTADDLLTRLAYSGGDL------LVETMTGLEQGTITP
FMT_CORDI         RIDKGLDTGQILGVIHEPIQSTDTADDLLTRLAYSGADL------LVNTMDNLAQGIATY
FMT_CORJK         RIEEGLDTGPVAAQLTQKIGLEDTADDLLASLTYAGREL------LADTLVAMDEGKAEL
FMT_CORU7         RIEQGLDTGPMLSKKAYEIGIRETAEEVLIELTNSGKSL------LADTLVELGEGSATP
FMT_RUBXD         RMDEGLDTGPVALQRRVPIPPDMTGGELADLLARVGAEA------LVEVLDRLESGTLNL
FMT_BACFN         FLKHEIDTGEVIQQVRIPIADTDNVEIVHDKLMHLGGRL------VIETVDAILEGKVKS
FMT_BACTN         FLQHEIDTGKVIQQVRVPIADTDNVEVVHDKLMILGGKL------VLETVDAILNDTVKP
FMT_BACV8         FLKHEIDTGEIIQQVRVPIADTDNVEIVHDKLMYLGGDL------VLETVDAILNGSVKP
FMT_PARD8         FLTHEIDTGKIIRQRHLPIADTDDVETVHDALMAMGARL------VTETVDLLLDGKTDA
FMT_AZOPC         FLDYEIDTGKIIAQECIPIKETDNAGTIHDELMYLGAKL------VVKTTNDILSGTVKL
FMT_PORG3         RLRHEIDTGEVLLQEKLPIGHEETFGELYERMATLGASV------LVHTVDLFLEGEPVS
FMT_CHLCH         FLQQRVDTGTIIMQQKTAIAPEENATELIVRLANIGADV------VVETLRRIAAKNAAT
FMT_CHLPD         FLQKTVDTGNVIMQEKIPVLPDDNASILSVKLSHLGAEL------VVKTLRSIQAGTVEV
FMT_CHLL2         FLQEKVDTGSMILTENVTIAEDDNATRLAEKLSVKGAAL------VVETLHLINAGNVSV
FMT_PELLD         FLQQQVDTGNIILKRSTPVGSDENATELALRLSFIGAEA------VLATLRLIAEGRADV
FMT_CHLPM         FLQRQVDTGNIILKKSTPINSMENATQLAERLSQIGAEA------VVETLRLIAEGTVEV
FMT_CHLPB         FLGRKVDTGNIILQQRTPVAPEETAGELTERLADIGAGV------VLKTLKRIRDGEAEP
FMT_PROA2         FLRKSVDTGNMILQEKTPVYPEENAGELAARLAEIGAGA------VVKTLELIRDGRVEP
FMT_CHLTE         FLQKSVDTGNIITMDRTPIGPDENAFELLKRLSEIGAGT------VERTLTMIADGAVMP
FMT_CHLAB         RMDAGMDTGDIANVSFVPVGPDMTAGELAEALASQGGEI------LIKTLQQISDGTITH
FMT_CHLCV         RMDAGMDTGDIAGVSYVPVGPDMTAGELAEALSAQGGEI------LIKTLQQISDGTISH
FMT_CHLPN         RMDAGMDTGDMANITRVPIGPDMTSGELADALASQGAEV------LIKTLQQIESGQLQL
FMT_CHLMU         RMDAGMDTGDIANVNHVAIGEDMTAGELAEALAGSGGEL------ILKTLQEIEAGTVRH
FMT_CHLTA         RMDAGMDTGDIANVNYVAIGEDMTAGGLAEALAASGGEL------LLKTLQEIEAGTVRH
FMT_PARUW         HMVKKMDAGDMIKKVSVQITSEMTYGELEQALCQIGKHA------LLEVIKQFDRGEPSR
FMT_BORAP         NMALKMDSGNILVQKNFKIKSCDTSYDISKLVSSLSPNL------VLEALEKIGKGFLGI
FMT_BORBP         SMALEMDSGNILVQKKFKIRSYDTSYDISKLVSSLSPSL------VLEALEKISKGFLGI
FMT_BORHD         KMALEMDSGNILSQSQFEIKSFNTSADIFRYVSLNSFNL------VLEALSKLDKGNIGI
FMT_BORRA         KMTLEMDSGNILAQSQFEIKSFNTSVDIFEYVSLNSFDL------VIEALNKLLKGDIGI
FMT_TREDE         TLAQKTDCGSILGQLEIPLNDSETTESLLADCADKCCPL------LRDVLSDFENKLKQA
FMT_TREPS         YIGEEMDAGDILAQSRVQLDGTETTGALLSRLSLVAADL------VDDVLVGVERHTLAP
FMT_LEPBL         YIGEKMDEGDILLSQKIDIIPEDNTETLMNKITDAGTES------ILRLLKAYDGKPFPA
FMT_LEPIC         YIGEKMDEGDILLTKEVEIAPEDNTGTLMDKITDAGIES------ILQLLKTYDGKPFPS
FMT_ELUMP         WIDKGMDTGPVFAYKETDILPSEDAKTLFTKLISLGGIL------LEDVIEYIRLGQIVK
FMT_UNCTG         YIEEGLDTGGIIIQEKLNISIKDNAETLLNKLILLGIDV------MNKTLELFRCGKCDA
D1B5G6_THEAS      RLVEEMDAGPILMRVPHPVDPDDHFGSLLPKLARLASRM------TGDFLDAPD--SFSP
FMT_COPPD         KISEKMDEGDIYLQERVLIDPDDDYVSLTPKLQHVSMEL------LKKFFLELKQGNLRA
FMT_THEAB         KIGEGMDDGPIALKKEISVGEFETFGSLYEKLLSLGKEA------LLEFLNNYPP---NL
FMT_THEM4         KIGEGMDDGPIALKKEVEVGEFETFGELYEKLLDLGKKA------LIEFLNNYPI---EL
FMT_FERNB         KISEGMDEGDIALQRAFELEECEPFGSVYEKFIKYGTEL------LQEFLRNYPV---TL
FMT_THEMA         KMVKELDAGPIALQKEISVDPFETFDQLEKRLIELSKEM------LIEFLEKLKTGNIEL
FMT_PSELT         KLTEKLDAGPIVLQVEISVDCFETFDSLENRMIEAGKKI------LCDFLKNPES--FEL
FMT_MESFL         KMVKKMDAGDYYIQESIDIEETDDTGIMFEKLAKLGQKM------IKENLLKIYNNELPP
FMT_MYCMS         QMVKQMDAGDYYVQESIDILDSDDSGSLFEKMGHLAYSM------CKKYLVDIYNHKFEL
FMT_UREP2         HTIKKMDAGNILFQRSLEINDCTTTKSLTLELANLSALM------IKEHFLELVKPNLVG
FMT_UREU1         HTIKKMDAGNILFQRSLAINEQTTTKILTLELANLGALM------IKEHFLELVKSDLVG
FMT_MYCPE         RTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDI------VLNDLEKVFNLEYPP
FMT_MYCPU         YMTKKMDAGNILKIAKIKLNGNENADDLFLQMSKIASKN------IVLWLEQIYQKDFSE
                        * *                                                   

FMT_BACVZ         IK--------QDESK---------------ATYAPNIKREQERIDW-AKPGEEIYNQIRG
FMT_BACSU         EK--------QDEEK---------------ATYAPNIKREQELLDW-SRTGEELYNQIRG
FMT_BACLD         EK--------QDEQK---------------ATYAPNIKREQELIDW-SKPGEVLYNQVRG
FMT_BACP2         IP--------QNEDA---------------ATYAPNIKREQERLDW-TKTGEELYNQVRG
FMT_BACCN         IK--------QDEEK---------------VTFAYNIKREQEKINW-AKTGEEVYNHIRG
FMT_BACMK         IK--------QSEAE---------------VTFAYNIKREQEIIDW-TKTGEEVYNHIRG
FMT_GEOTN         IP--------QEEEK---------------ATYAPNIRREQERIDW-AQPGEAIYNHIRA
FMT_BACHD         IP--------QDDQL---------------ATFAPNITREKEEIDW-RKEGERIYNQIRG
FMT_OCEIH         KK--------QDESL---------------VTFASNITREQERIDW-SKTANEIINQIRG
FMT_STAAW         VP--------QDDTQ---------------ATFASNIRREDERINW-NKPGRQVFNQIRG
FMT_STAEQ         IP--------QDDAL---------------ATFASNIRREDERIDW-NMSAQAIHNHIRG
FMT_LYSSC         TV--------QDETQ---------------VTFASNISREQERIDW-TNDATTLYNQVRG
FMT_LISMF         IP--------QDPEK---------------VTFARNISREQEKIDW-TKPGRTIFNQIRG
FMT_BACSK         VA--------QDEDK---------------ATFAPNIKREQEVLDW-QKPARALFNQVRG
FMT_LACBA         VP--------QDESQ---------------VSFSPTIKPEEERVDI-NLSARMIDCKVRA
FMT_PEDPA         VK--------QDEEQ---------------VSFSPNISPEEEEIDI-NLPARLVDAKVRG
FMT_LACPL         VP--------QDESQ---------------VTFAPNIQPEQEVLDFFTKTAVEIDNQVRG
FMT_LACF3         VK--------QDESQ---------------VVFSPNITREQETIDF-TLPADRIDDLVRG
FMT_LACS1         VK--------QDENK---------------VVFSPNIKPEEEILHL-NLEAKEIDWKTRA
FMT_LACCB         TP--------QDPDK---------------VTFSPTITKEQEHLNI-HLPAKALDQWIRA
FMT_LACSS         TP--------QDEVQ---------------VTFAYNITKEQEQLDI-NQPAEQLLNQIRA
FMT_ENTFA         IP--------QVEEE---------------ATFSPNITREQERIDW-QKTAEAIDNQVRG
FMT_LACAC         TP--------QDPDK---------------VVFSPNITKEQERLSI-DMTAEQANNMIRA
FMT_LACJO         TA--------QDEDK---------------VVFSPNISKDQEKINL-SMTAKEANNLIRA
FMT_LACDB         KP--------QDPSQ---------------VVFSPTISKAEERISL-KLTAKEAKNLIRA
FMT_STRA5         IP--------QNEEE---------------VSFSPNISPDEERIDW-NKSSRDIFNHVRG
FMT_STRT1         VP--------QDASQ---------------VTFSPNISPEEERLDW-NKSGRDIFNQIRG
FMT_STRGC         EA--------QDPSQ---------------VTFSPNIRPEEERLDW-NMTNRQLFNQIRG
FMT_STRP4         EP--------QDTSQ---------------VTFSPNIKPEEEKLDW-NKTNRQLFNQIRG
FMT_STRS2         VA--------QNPEQ---------------VTFSPNIQPEEEVLDW-NKTARQLFNQIRG
FMT_STRSV         QP--------QDPSQ---------------VTFSPNISPEEERIDW-SKTNRQIFNQIRG
FMT_STRMU         QA--------QDDSQ---------------ATFSPNISSQEEKIDW-SKSARDIFNQVRG
FMT_STRPM         IP--------QDHSQ---------------ATFSPNISPEQEKLDW-TMSDQEVFNHIRG
FMT_LACLA         QA--------QNEDE---------------VTFSPNISPEEEKIDW-NKSAREIFNKVRG
FMT_ALKMQ         --------TLVGEKQND-----------LESSYAAMLDKGLGQINW-NQSAEAIRNLIRG
FMT_ALKOO         --------EITAIPQNH-----------SESTYAPILTKDLGKIDW-SQSAIEIKNLIRG
FMT_CLOD6         --------NAPREVQNH-----------EEFSYAPIMNKSLGNIDF-SKSAREIHNLVRG
FMT_CLOB8         --------DIVPEKQ-G-----------NETFYAKMLDKNIANIDW-NKSAEEIHNLVRG
FMT_CLOBB         --------SIKPIKQ-E-----------GETFYAKMLDKELAHINW-NDDAYDIHNLVRG
FMT_CLONN         --------EITPIKQDD-----------SKTCYASMLDKKMACIDW-SKSASEIHNLIRG
FMT_CLOPS         --------EITPEKQNE-----------EETCYAPMLNKEIAKIDW-SLSAQDIHNLVRG
FMT_CLOTE         --------SIEPEKQKD-----------EESCYASMLDKKMAKINW-NLESEDIKNLIKG
FMT_CLOAB         --------NIKPEKQGE-----------PETDYAAMLSKDTGKINW-NDKSERIYNLIRG
FMT_HUNT2         --------TLQRIPQPH-----------EQATYAPMLDKTVGCINW-SKSARDVHNLVRG
FMT_CALS4         --------KLIPEKQKD-----------EEATYAPIITKEMGHIDW-KSPACRIRNLIRG
FMT_THEYD         --------IITPKPQ-T-----------GEITYAPQLKKDDGKINW-NNSARKIFNLVRG
FMT_AQUAE         --------KVKPVPQNH-----------EEATYAPPVQKEEYRICW-KASAESVRDRIRG
FMT_HYDS0         --------SIKPIPQNH-----------QEATYAMPILKEELRICF-KTSAFSIHNKIRG
FMT_FUSNN         --------EVKAQKQDK-----------KLVTFVKPFRKEDCKIDW-TKTSREIFNFIRG
FMT_SULSY         --------EIDKKPQDH-----------EKATYAKPIEKSEGKIDF-SRSAKEIFNQIRA
FMT_DICT6         --------KLIPVPQDE-----------SLASYAPKLTKEEEIINW-NMDGEKICCQIRA
FMT_DICTD         --------KLSPVPQEE-----------SLATYAPKLSKEEEIIDW-NMRGEKIWCQIRA
FMT_CARHZ         --------GLPRVPQDH-----------QLATYAPPLKKEDEIIHW-ADSAEKIRNQIRA
FMT_SYNWW         --------KLPRVVQDD-----------SQASYAARISKEDEIINW-SEPAYAIHNRIRA
FMT_ANAPZ         ------------IKQDE-----------SGVTIANKL--EEFRIDF-EEAADVICRRIRA
FMT_ANAMM         ------------VSQDD-----------AGATYAAKP--SEFCVNF-NDAADYICRQVRA
FMT_EHRCJ         ------------IKQNN-----------DDATYAHKI--IDFHIDF-NEAADVICRKVRA
FMT_EHRCR         ------------IKQNA-----------NDATYTNKI--IDFHIDC-NEEAQVICRKIRA
FMT_EHRRW         ------------VAQNE-----------DNATYTNKI--EDFHIDI-NETAEVACRRIRA
FMT_WOLPM         ------------LKQND-----------NDACYADKV--EDYKIYA-SDACEVAYRKVKA
FMT_WOLPP         ------------LKQSD-----------NDACYADKV--KDYKIYA-SDACEIAYRKVKA
FMT_RICCK         ------------IKQSS-----------DGITYAHKLTKQEGKINW-QDSAYSIDCKIRG
FMT_RICTY         ------------VKQSS-----------NGVTYAHKLTKAEGKINW-YESAYSIDCKIRG
FMT_RICBR         ------------KPQSN-----------EGVTYTHKLTKEEGRVNW-QDSAFSINCKVRG
FMT_ORITB         ------------IPQSQ-----------DRASYAHKLSKSESKINW-YESAYTIDCKIRG
FMT_BLOFL         ---------CKNIPQDT-----------SNITYAYKLNKKEAHINW-NKSAIEIERRIRA
FMT_BLOPB         ---------FTLIPQDS-----------TYATYAHKLNKQEARINW-NLSAIQLERCIRA
FMT_WIGBR         ---------YNLQYQNN-----------SIATYAKKINKKEAKINW-NLPAINIDRNIRA
FMT_BUCAI         ---------VIYKKQNE-----------KNVILSKKIYKKDALLDW-NLSAEKLERLIRA
FMT_BUCAP         ---------VVEKEQNE-----------KHATFSKKISKKDALLNW-NTEAYLLERLIRA
FMT_BUCBP         ---------FPIRQSN-------------LATYSNKINKEDAKLIW-LKSAIQLERSIRA
FMT_FRAP2         ---------PQPQQGE--------------PTYAHKITKQEGLIDF-TKSAKEISCHIRA
FMT_FRATN         ---------PEPQQGE--------------PSYAHKITKQEGLIDF-TKSAWQISCHIRA
FMT_PROM9         KN---TNYQLTKQNTLG-----------REITYARMIEKSDYKVDW-GNEAIKISRKIKA
FMT_PROMS         KN---TKSQLTKQNSLG-----------REITYARMIEKSDFRVDW-GNQAIAISQKIKG
FMT_PROM2         KK---INSKLTKQNTLG-----------REITYARMIEKSDFKVDW-GNEAIKISRKIKA
FMT_PROM5         KD---INHLLKKQKDLQ-----------RKLKYARMINKSDYIIDW-ANNSTDIYRKINA
FMT_PROMP         RD---INLLLKKQTDFK-----------RELKYARMINKLDYIINW-ENSATDIYRKINA
FMT_PROMA         QSQSLSKLNLTKQEDIN-----------RTYSYARLLMKEDYLINW-NDSGYNIHKQILG
FMT_PROM4         KNLVEIYPKLIKQDVVN-----------CDPIYAKRLTKKEFQIDW-KRLSEEIHRTIMG
FMT_SYNPW         EAERWSRLQVRHQPEEG--------------TYARMLSKEDFQLNW-GDSALTIHRKVMG
FMT_SYNSC         EDERLAKLNVRVQAEGS--------------TYARMLEKQDFQLDW-SASALSIHRKVMG
FMT_SYNPX         TDERLHRLGVQHQAEAS--------------CYARMLCKQDYQIDW-SNSALAIHRQVMG
FMT_SYNS3         EPERRARLKVMNQSDRS-----------GDASYARMLTKQDHQIDW-SASALNIHRKVMA
FMT_SYNS9         EPERLERLNVRYQGQEM--------------SYARMLKKEDFQIKW-GDPALRTHRRVMG
FMT_SYNR3         EAERLSRLAVTPQSDEG-------------VSLARLLSKDDYRIDW-SERALAIHRKVMG
FMT_PROMM         ESERWKQLEVIKQEEIE-----------GDPTYARMLSKKDHILDW-NQSAMDLHRRVMG
FMT_PROMT         KSSRLKQLNAIEQRNLN-----------GIPSYARQITKEDNLIDW-NQDARKILKKIQG
FMT_PELUB         -----FEDKLTFKEQDD-----------TSATYASKIEKSEGEIKW-NDNAESIIGKING
FMT_CAMJ8         ------------KKQEE-----------SLATLCRKIKKEDGLIN--LQNARELYQKYLA
FMT_WOLSU         ------------LPQVG-----------ADSSYCRKIRKEEGLVG--FVNAKELYDQFRA
FMT_CAMFF         ------------IAQFH-----------ALSSKCGKVHKEDGLIDIKLQTPKIIESKFRA
FMT_HELAH         ------------KPQDH-----------ASATFCKKITKADGLVG--FKDAKSLFLKSLA
FMT_HELPY         ------------KSQDH-----------MQASFCKKITKSDGLVG--FKDAKSLFLKSLA
FMT_SULDN         ------------KIQDD-----------SLSSHCKKITKQDGEVE--FDNATAIFNKYRA
FMT_CALS8         ------------VKQDA-----------TKATYAPPIDKKEGQISW-DMSAVQIYNRFRA
FMT_ECOLI         PE------VQDETLV----------------TYAEKLSKEEARIDWSL-SAAQLERCIRA
FMT_SALDC         PE------AQNEALV----------------THAEKLSKEEARIDWSL-SAAQLERCIRA
FMT_KLEP7         PE------VQDESLV----------------CHAEKLSKEEARIDWSL-SAAQLERCIRA
FMT_ENT38         PE------VQDEAFV----------------TYAEKLSKEEAQLDWSL-SAAQLERCIRA
FMT_CROS8         PE------KQDDAQA----------------TYADKLSKEEARLDWTL-SAAQLERCIRA
FMT_YERE8         PE------VQDEAQV----------------TYAEKLSKEEAKLDWSL-SAVQLERCIRA
FMT_YERPY         AE------VQNETQA----------------TYAEKLSKEEAKLDWTL-SATQLERCIRA
FMT_SERP5         RE------VQDESLV----------------TYAEKLSKEEARLDWNL-PAVQLERCVRA
FMT_ERWT9         PQ------VQDESLV----------------SYAEKLSKEEARLDWSL-SAQQLERCIRA
FMT_PECAS         AE------AQNDAFA----------------TYAEKLSKEEARLNWLL-SAEQLERCIRA
FMT_SODGM         AE------SQDNALA----------------TYADKLSKEEARLDWRL-PAAQLERCIRA
FMT_PHOLL         PE------TQNENLV----------------TYAEKLSKEEARINWEL-SATHLERCIRA
FMT_PROMH         AE------KQDDSLA----------------NYAEKLSKEEAKINWSL-SAQQIERCIRA
FMT_ACTP2         AE------KQDDALS----------------NYAEKLSKEEAKLDWNL-TACQLERNIRA
FMT_HAEDU         PE------KQDNQLA----------------NYAEKLSKQEAKLDWNL-PAYQLAQNIRA
FMT_ACTSZ         PQ------VQDDSQS----------------CYADKLTKEEAKLDWTL-PAAQLERNIRA
FMT_MANSM         AE------KQEDSKS----------------NYAEKLSKEEAKLDWSL-SAAQLERNIRA
FMT_HAEIE         AE------KQDDSQS----------------NYAEKLSKEEAQLDWSL-PAVQLERNIRA
FMT_PASMU         SE------KQDDIES----------------CYAEKLSKEEAELNWHV-SAEQLERHIRA
FMT_HISS2         AE------VQDESLS----------------NYAEKLSKEEAKLDWSL-SAEQLERCIRA
FMT_VIBPA         PV------KQDDELA----------------NYAKKLNKEEARINWND-DAAHIERCVRA
FMT_VIBVY         AI------KQDDERA----------------NYAKKLSKEEARINWQD-DAEHIERCVRA
FMT_VIBC3         AV------KQDDGLA----------------NYAHKLSKEEARINWSD-AATHIERCIRA
FMT_ALIFM         AQ------KQDDELA----------------NYAKKLSKEEAKIDWTM-DAIAIERCVRA
FMT_PHOPR         AE------KQNDELA----------------NYAKKLNKEEAKIDWAM-EATAIERCIRA
FMT_AERS4         AE------EQDDALA----------------NYAEKLSKEEARIDWSM-EAVAIDRCIRA
FMT_SHEAM         AE------KQDEALA----------------NYAEKLSKEEARLDFAK-PAKNLWQEVRA
FMT_SHEON         AE------KQDETLA----------------NYAEKLSKEEARLDWTK-SATQLWQEVRA
FMT_SHEDO         GE------PQDPALA----------------NYAEKLSKEEARLDWNK-SAKQLWQEIRA
FMT_SHEFN         AQ------KQDETLA----------------NYAEKLSKEEARLDWNK-SAKQLWQDIRA
FMT_SHEPA         AE------KQDESLA----------------NYAEKLSKEEARLDWSK-PASALWREIRA
FMT_SHEPW         AE------KQDESLA----------------NYAEKLSKEEAQIDWSK-SAEALWREIRA
FMT_SHESH         AE------KQDESLA----------------NYAEKLSKEEAELDWSK-SALELWREIRA
FMT_SHEWM         AE------KQDEALA----------------NYAEKLSKEEAELDWNK-SAAQLWREIRA
FMT_SHELP         PE------PQDEALA----------------NYAEKLSKEEAQLDWRK-PAEQLWREVRA
FMT_PSYIN         AE------KQDPQLA----------------CYAKKLSKSEALIDWSK-DAVFIERCIRA
FMT_PSEHT         PE------PQNDAAA----------------NYAKKLSKDEANIDWSM-SAAQIERNIRA
FMT_COLP3         ASNH--NIAQDDELA----------------TYAKKLDKTEAELNWQF-SADELHRKIRA
FMT_PSEA6         A--------QDNTLA----------------TYAEKLSKQEAKIDWTM-TAAQLERNVRA
FMT_IDILO         AK------PQSDANA----------------TYAKKLTKQEGKIDWTQ-PAAFIERCVRA
FMT_PSEE4         GE------VQDDTLA----------------TYAHKLNKDEARIDWNR-PAVELERLIRA
FMT_PSEPF         GE------VQNDELA----------------TYAHKLNKDEARIDWSR-PAVELERLVRA
FMT_PSE14         GE------VQDDSLA----------------NYAHKLNKDEARLDWTR-PADELERLIRA
FMT_PSEA7         GE------VQDDALA----------------TYAHKLNKDEARLDWSR-PAVELERQVRA
FMT_PSEMY         GE------LQDDAQA----------------NYAHKLNKDEARLDFSR-PAVELERLIRA
FMT_PSEU5         PE------VQDDSLA----------------TYAHKLSKDEARVDWTR-PAVELERLIRA
FMT_CHRSD         AT------PQPSEGV----------------TYAAKLSKAEAELDFTR-PAHELAARVRA
FMT_HAHCH         AE------RQQDDLA----------------TYAHKLQKEEARIDWSE-PASLIQRKIAA
FMT_ALCBS         AT------PQPDEGI----------------TYAHKLSKAEARLDFRL-PTGALYNRIRA
FMT_ACIAD         AER----EVQDENQT----------------VYAHKLVKAEAQIDWTQ-DAIQIDRNIRA
FMT_ACIBS         AER----EVQDESLT----------------VYAHKLVKSEARIDWSM-NAVQVDRNIRA
FMT_COXB1         LE------KQDEASA----------------TYASKIQKQEALINWRK-SAVEIARQVRA
FMT_METCA         GE------IQDESQV----------------TYAEKIEKSEARLDWQK-DATSLSRRVRA
FMT_LEGPC         FE------LQNNELA----------------TYAGKINKEEARINWHQ-SAVEIDRKIRA
FMT_ACIAC         AT------PQPAEGV----------------TYAHKIEKAESAIDWKL-PAAAIDRRVRA
FMT_ACISJ         PT------PQPAEGV----------------TYAHKIDKAESTIDWNQ-PAEVIARRVRA
FMT_DELAS         RT------PQPAEGV----------------NYAHKIEKAESQIDWRQ-DAEAIARRLRA
FMT_POLNA         PV------RQPAEGV----------------TYAHKIEKSEAAVDWTQ-PVASIDRHIRA
FMT_VEREI         AL------AQPAQGV----------------AYARKIEKSESSIDWSL-PAQRIGQRIRA
FMT_METPP         RR------PQPAEGV----------------TYAHKIDKAEAAIDWSR-PAEEIERRVRA
FMT_RHOFT         PV------AQAAQGV----------------TYAPKIEKHEAAIDWTQ-PAAVIAQRIRA
FMT_BORA1         PR------KQPEQGV----------------TYAAKLDKAEAALKLDE-SAELLARRIRA
FMT_BORPD         AR------PQPADGV----------------TYAAKLDKAQAALDCAQ-PAALLARRVRA
FMT_BORPE         PR------RQPDAGV----------------TYAAKLYKAEAALDCSL-PAAVLARRVRA
FMT_PARP8         SI------PQPAAGA----------------TYAEKIAKHEAALDWRR-PAAELARQVRA
FMT_PARXL         AT------PQPAEGV----------------TYAEKIGKHEAALDWRR-PAAVLARQVRA
FMT_BURM1         AT------PQPADGV----------------TYAEKIGKHEAALDWRK-PADVLARQVRA
FMT_BURTA         AT------PQPDDGI----------------TYAEKIGKHEAALDWRK-PATVLARQVRA
FMT_RALPJ         AT------PQPAEGI----------------TYAEKIAKDEAALDWSR-HAAALLRQVHA
FMT_HERAR         AT------PQPEAGA----------------NYAAKIAKEEATLDLRQ-SAQELARKIRA
FMT_JANMA         AE------PQP-DGA----------------NYAAKILKEEATLDFTQ-PAEQLARKIRA
FMT_CHRVO         PR------KQPEDGV----------------TYAQKLSKAEAEVDWAL-PAEQVARAIRA
FMT_THIDA         PQ------TQDEREA----------------SYAAKLSKEEARLDWQQ-PAEALARAVRA
FMT_AROAE         AM------PQPAEGA----------------TYAGKIGKAEAVIDWQC-DASSVARAVRA
FMT_NEIM0         AV------KQPKEGV----------------TYAQKLSKEEARIDWSE-SAAVIERKIRA
FMT_DECAR         AE------PQPADGV----------------TYAQKIEKAEAMIDWSK-SAAELDRHIRA
FMT_METFK         AE------PQDESLV----------------TYAQKLQKAEAVIDWRK-NADELSRQVRA
FMT_POLNS         RS------PQAIKGI----------------TYAEKILKSEAEIDWTL-SAQEIDQRIRA
FMT_POLAQ         RT------PQPALGV----------------TYAEKILKAEADLDWSL-SAREIDARIRA
FMT_NITEC         PT------LQDNASA----------------CYAAKIRKSEAEIDWTR-DSTHIDRMIRT
FMT_NITEU         SE------PQNEVDA----------------CYAAKIRKIEAEIDWTC-DAAYIDRMIRT
FMT_NITMU         AT------PQNDLAA----------------TYASKLEKTEAEIDWRM-DAENIDRAVRA
FMT_STRM5         AR------PQPEQGV----------------TYAHKLDKAEARLDWVL-DAGALARTVRA
FMT_XANC8         AQ------PQPAEGV----------------TYAHKLDKAQARLDWAQ-PAEELARRVRA
FMT_XYLFA         PQ------PQLAAGV----------------TYAHKLGKVEAQLDWEQ-PAERLACRVRA
FMT_HALHL         -E------PQPDDGV----------------TYAAKLTNDESWLDPTE-PAEQLERRVRA
FMT_GLUDA         AI------PQPAEGA----------------TYAARLTREDGRIDWTR-DAVDIDRQVRA
FMT_GLUOX         PV------PQPEDGV----------------TYAERLTRDHGRIDWTR-SAAEIDRQIRG
FMT_ACICJ         PV------PQPEGGV----------------TYAPKLSKADAEIDWSA-SAAVILRRIRA
FMT_GRABC         GE------NQDDALA----------------CYAPKLSRADGLLDWSQ-PAALLARRVRA
FMT_AGRFC         LV------TQAEEGV----------------LYAAKIDKGETRIDFSR-PAQDVHNHIRG
FMT_RHILW         LT------PQPQDGV----------------LYAAKIDKAETRIDFAR-PALDVHNHIRG
FMT_RHIME         LA------PQAQEGV----------------AYAAKISKEETRIDFSR-PAAEVHNHIRG
FMT_SINMW         LT------PQPQEGV----------------VYAAKISKEETRIDFSR-PAAEVHNHIRG
FMT_CHESB         LT------PQPATGV----------------TYAKKIIKEETRVDWSR-PAEEVHNHIRG
FMT_OCHA4         LQ------PQAEEGV----------------TYAAKIDKAEARIDWSK-PAQDVHNTIRG
FMT_RHILO         FT------AQAAEGV----------------TYARKIDKSETRVDWTR-PAAEVHNHLRG
FMT_BRADU         LK------KQSEDGV----------------TYAAKIDKAEARIDWTK-PARAVLRHIHG
FMT_BRASO         LT------KQAEDGV----------------TYAAKIEKAEARIDWTK-PAHAVLRHIHG
FMT_NITHX         LT------KQSEHGV----------------TYAAKIDKAEARIDWSR-PARDVLRHIHG
FMT_NITWN         LT------KQSEQGVA------------STVTYAAKIDKAEAHIVWSN-PAREVLRHIHG
FMT_RHOP2         LA------RQSEHGV----------------SYAAKIDKAEAKIDFAR-PAQAVLRHIHG
FMT_RHOPT         LT------KQSEDGV----------------TYAAKIDKAEAKIDFAK-PAWAVLRHIHG
FMT_RHOPB         FT------KQPEQGV----------------TYAAKIDKAEARIDWAK-PAHAVLRHIHG
FMT_OLICO         LK------PQGEEGV----------------TYAAKIGKAEAKIDWAR-PAHDVLRHIHG
FMT_METS4         FT------PQPAEGV----------------VYAHKITNEEARLDWTA-PAARLHDRVRG
FMT_PARL1         AA------PQPEEGV----------------TYARKIEKAEARIDWRR-PANELDCHIRG
FMT_CAUVC         ET------PQAEDGV----------------TYAKKIKSAEARIDWTR-PAAEIDRHIRG
FMT_CAUSK         ET------PQSEEGV----------------TYAKKIKAAEARIDWTR-SAAEVDRHIRG
FMT_PHEZH         ET------PQAEAGV----------------TYAKKIRPKEARIDWTR-PGPEVDRKIRG
FMT_RUEPO         PE------PQPEDGV----------------TYAAKIDKAEARVDWTR-PAVAIDRQIRG
FMT_RUEST         AE------PQPEAGV----------------TYASKIDKAEAQIDWSV-AAEEVDRKIRG
FMT_DINSH         PE------PQPEVGV----------------TYAAKIDKAEARVDWSR-PAVEVDRLIRG
FMT_ROSDO         AV------PQPEDGV----------------TYAAKIDKAEAQVDWDQ-PAEDVDRLIRG
FMT_JANSC         PK------PQPDDGV----------------TYATKIDKSEAKVDWTA-PAPHINRQILG
FMT_RHOS1         PR------PQPDAGV----------------TYAEKIAKAEAGIDWTR-PAAEIDRQIRG
FMT_RHOS5         PQ------PQPEEGV----------------TYAEKIAKAEAGIDWSR-PAAEIDRQIRG
FMT_PARDP         AE------PQPAEGV----------------TYAQKIDKAEARIDWGR-PAAQVDRQIRG
FMT_NOVAD         AV------VQPEQGV----------------TYAHKIDKAESRLDFTR-DAVDVERQVRA
FMT_SPHWW         PV------VQPEEGV----------------TYAAKIDKAESRIDFAE-AAGQIERQVRA
FMT_SPHAL         PV------PQPDEGV----------------TYAAKIDKSEARLDFLV-SAVQVERQVRA
FMT_ZYMMO         PV------KQPESGE----------------SYAAKIDKSEALIDFSK-GAVQAERQIRA
FMT_MAGSA         AT------PQPAEGV----------------TYAHKLAKEEGLLDWRR-NAVELDRKVRA
FMT_BARQU         LT------PQSGENI----------------TYASKIKKEETRIDWTK-PAEFIHRQIRA
FMT_BART1         LI------PQSKEGI----------------TYAAKIKKEETRIDWKK-PAEFIHRHIRA
FMT_BARHE         LT------AQSGENI----------------TYASKIKKEETRIDWTK-PAEFIHRYIRA
FMT_BARBK         LT------PQSLEGV----------------SYASKIKKEETQIDWTK-SAEVIHKYICA
FMT_MAGMM         QI-------QPEQGV----------------TYAAKLKKEEGLVDWSQ-PAIQIQRAVQA
FMT_SYMTH         IP-------QPAEGV----------------TYAAKLEPADEVIDWAR-PAEELYNQIRA
FMT_BDEBA         TP-------QDESKV----------------TLAKKIEKMESQIDWST-SAKAIDGKIRG
FMT_TRIV2         PI------PQDNAAAT----------------YASLIQKQDYGLDWSR-SALQLHNQIRG
FMT_TRIEI         PI------PQDNSLAT----------------YAPLIQNSDYEIDWSR-SALDIHNQIRG
FMT_GLOC7         PE------SQNSELAT----------------YAPLIQKEDYLINWTR-HALQIHNQVRG
FMT_MICAN         PI------PQNNDDAT----------------YAPLIQKSDYLIHWQD-SGRRIHDRVRG
FMT_SYNP2         PI------PQDPDQAT----------------YAPLIQKEDFQLDWQK-GAIALHNQVRG
FMT_SYNY3         PI------PQTETEAT----------------YAPLLKKGDFVINWHR-SALEIHNQVRG
FMT_SYNP6         AI------SQNEAEAT----------------YARLLQKEDFQLSWDQ-SALELHNRIRG
FMT_THEEB         AE------PQNDAEAT----------------YAPLIQKSDYAIDWGR-SALALHNQVRA
FMT_GLOVI         PE------PQDDSLSS----------------YAPLIDKGQYLVDWGQ-SARQIRNQIRA
FMT_SYNJA         PI------PQDDSRAT----------------YAPLLKKQDFQLDWQR-PAQALHNQIRA
FMT_DEIRA         PQ------PQDEAQAT----------------HAPLLVKEDGFVRWAD-PAQAVLDRFRG
FMT_THET8         PR------PQ-EGEAS----------------YAPPLSKEEGRLDFGE-SAEALYRRHRA
FMT_ROSCS         HP-------QDHARA----------------TFTKLLSREDGIIDWSQ-PALRIERMTRA
FMT_ROSS1         QP-------QDHARA----------------TFTKLLTRDDGIIDWTQ-PAVRIERMTRA
FMT_CHLAA         RP-------QDHSRA----------------TVTKMLKKEDGRIDWSL-PAIVIERMTRA
FMT_HERA2         QI-------QDDSQA----------------SYTQMISKNDGLINWNL-PALVIERMTRA
FMT_DEHMB         QV-------QDNTQA----------------SYFGMVTKEMGLINWQT-SAVEIERRVRA
FMT_AKKM8         IR-------QQEIL----------------ATYAPKLLRADGKIDWTR-PAEEIGRMIRA
FMT_DESVV         IP-------QDDAL----------------ATYAAKLTKADGLVDWNR-TAVEVHAQVRG
FMT_MYXXD         VP-------QPSEG----------------MVLAPIIEKDQGRLDFTK-PAVELERRLRA
FMT_SORC5         TP-------QDHEA----------------ATHAALLKKEDGRIRWER-SARQIHDHIRG
FMT_ANASK         VR-------QDAAQ----------------ATLARILEKEDGRIAWTS-PARRVSDRLRG
FMT_KORVE         VP-------QNHAE----------------HTLAPILKKEDGQIDFHR-SAQEILNRLRG
FMT_SOLUE         EK-------QDDSQ----------------ATLAPLLKKEDGRIDWAQ-PALAIHNRVRG
FMT_GEOBB         EK-------QDDAL----------------TCYAPMMKKEDGLIDWSR-DAQAIKNQVRG
FMT_GEOUR         EK-------QDDAL----------------TCYAPMLKKEDGLIDWSK-EPQTIKNLVRG
FMT_GEOMG         EK-------QDDAL----------------TCYAPMLKKEDGLIDWKQ-EPQQIKNLVRG
FMT_GEOSL         EK-------QDDSL----------------TCYAPMLKKEDGLVDWTR-EPVQVKNQVRG
FMT_GEOLS         EA-------QDDSQ----------------SCYAPLLKKEHGLIDWQK-PAVTIHNQIRG
FMT_PELPD         QP-------QNDSL----------------SCYAPLLKKEHGLIDWQR-PARQIHNQVRG
FMT_SYNAS         NP-------QEDSL----------------SSYAPMLKKEDGLIRWSE-EVSTIANRIRG
FMT_DESPS         EA-------QDHAQ----------------ATEAPMLSKNDGLIDWSR-TATELESLIRG
FMT_DESRM         IP-------QNHKL----------------ATYAPMLRKEHELIHWDL-SAKDIHNHVRG
FMT_PELTS         VP-------Q-QGI----------------PSYAPPLKTEDELIRWDR-TARDIFNQIRG
FMT_MOOTA         LP-------QDEAL----------------ATYAPPLKPEEEVIHWEQ-PAQVIYNQIRG
FMT_HELMI         QP-------QDGSQ----------------ASYAPMLARADEQVDWSA-PAEAVHNRVRG
FMT_NATTJ         LK-------QDENQ----------------VSYAPKLKKEDEYLDFSKYTNTEVFNRVRG
FMT_METI4         IP-------QNNAL----------------ASYAKKIKKEQALIDWTK-DRHEIDAMIRA
FMT_RHOBA         EP-------QDPAK----------------VSKAPRLSKAEAQIDWSA-TGREIDCLVRG
FMT_FRAAA         VP-------QPAEG----------------VSFAPKLTAQDALIDWTL-PAVAVDRLTRA
FMT_FRACC         VA-------QPAEG----------------ISFAPKLTAEEARIDWTK-PAIAVDRLARA
FMT_FRASN         RP-------QPSDG----------------VSLAPKLTVEDVRVDWSA-PAAAVDRLVRA
FMT_SACEN         EE-------QPADG----------------VSYAPKVEVEDARVDFTA-PARAVDRLVRS
FMT_SALTO         EP-------QPNDG----------------VSLAPKLTVADARVRWGD-PAFAVDRRVRA
FMT_STRCO         VP-------QPAEG----------------VTLAPKITVEDARVDWTA-PALRVDRVVRG
FMT_STRGG         VP-------QPHEG----------------VTLAPKITVEDAQVQWSA-PALRVDRVVRG
FMT_STRAW         VP-------QPADG----------------ITLAPKITVENAHVDWST-PALRVDRVVRG
FMT_THEFY         RP-------QGSEG----------------VSYAPKLTPDDARVDFTA-PALRVDRLIRA
FMT_MYCBP         RP-------QPADG----------------VSVAPKITVANARVRWDL-PAAVVERRIRA
FMT_MYCLE         RQ-------QPVDG----------------VSFAPKITVEQARVCWDL-PAPVVERRIRA
FMT_MYCPA         RP-------QPAEG----------------VSIAPKITVEQARVRWDL-PAPVVERRIRA
FMT_MYCUA         RP-------QPADG----------------VTLAPKISVEQARVRWEL-PVPIIERRIRA
FMT_MYCS2         VP-------QPSEG----------------ITVAPKITVESARVRWDL-PAHVVDRRIRA
FMT_MYCSS         VP-------QPADG----------------VTVAPKITVDEARVRWDL-PAHVVDRRIRA
FMT_MYCGI         VP-------QPAEG----------------VSIAPKVSVDDARIRWEL-PAHVVDRRIRS
FMT_MYCVP         VP-------QPPEG----------------VSVAPKVTVDDARIRWEL-PAHVVDRRVRS
FMT_MYCA9         VP-------QAVDG----------------VSIAPKITVEQARIRWEL-PAHAIDRHIRA
FMT_NOCFA         VP-------QPTEG----------------VSYAPKVTPEDGRIRWDQ-PALAVNRRIRA
FMT_NOCSJ         RP-------QQAEG----------------VSYAPKVEVEDARVDWSR-PAVVIDHQVRA
FMT_ACIC1         RP-------QPTEG----------------VSYAPKITPADARISWSS-PAFHVDRLIRA
FMT_KINRD         VP-------QPAEG----------------VSLAPKITVEEARVDWAA-TATEIDRRVRG
FMT_PAEAT         QP-------QIGE-----------------VSHAPKLTLDDGRLDWQQ-PALALNRRARG
FMT_ARTS2         VP-------QSGD-----------------VSLAPKLGIDDGRIDWHE-PALAIGRRARG
FMT_RENSM         IE-------QTGP-----------------VSLAPKLTIEDGRIDFSV-PALAVSRRIRG
FMT_CLAM3         RP-------QEGE-----------------PTLAPKTSIADGRIDWAR-PADAVLAQIRG
FMT_CLAMS         RP-------QEGE-----------------PTLAPKTTIDDGRVDWAR-SADEVLARIRG
FMT_LEIXX         TP-------QSGE-----------------PVAAPKLGIADAKLDLTR-PADEVYARFRG
FMT_CUTAK         TP-------QSVEG----------------VTIAPQIHPDDVRVTVTA-AAQEIDNLVRG
FMT_BIFAA         VE-------QPAGA----------------YEVAQKITVEDAHIRFDV-PVFAADRQIRA
FMT_BIFLD         TA-------QPAEG----------------LEYAHKITVEDARISWTD-EAEAIDRQVRA
FMT_COREF         RE-------QTGE-----------------ATYAPKITTVDARIDWTV-PAEVIDRHIRA
FMT_CORGB         RA-------QEGE-----------------ATYASKITTQDAQIDWSK-PAEVIDRHIRA
FMT_CORDI         SE-------QIGT-----------------ATYAPKITTEDARIQWTH-PAEAVDKHIRA
FMT_CORJK         SG-------QDDAQ----------------ATHAPKIHPADAQIDWSQ-PAEVIQRVARA
FMT_CORU7         QP-------QPEEG----------------ATHAPKLHPADARIDFSA-PAKVIQRRARA
FMT_RUBXD         TR-------QDSSR----------------ASYAPRITRQDQEIDWSR-DARRVHDQVRA
FMT_BACFN         IP-------QEE-MAVA-----------GELRPAPKIFKETCRIDWNQ-PVKRVYDFIRG
FMT_BACTN         IA-------QED-MAVV-----------GELRPAPKIFKETCRIDWNS-PVKKVYDFIRG
FMT_BACV8         VP-------QESLIRQE-----------TELRPAPKIFKETCRIDWNK-GVKQIYDFIRG
FMT_PARD8         IP-------QEEFYKDA-----------AELRPAPKIFKDTCHIDWNQ-PVKNIYDFVRG
FMT_AZOPC         IS-------QDETNLGK-----------QKLKIAPKIFREVCKIDWNK-TTREIHNFIRG
FMT_PORG3         IP-------QEQ-LPGY-----------VGARPAPKIFKDDCRIDWDK-PAEEVHNFIRS
FMT_CHLCH         AP-------QDD----------------SLASRAPKLTRINTRINWEQ-PVATLHNFIRG
FMT_CHLPD         QA-------QDD----------------AFFSRAPKLTRENTRIRWNQ-PVAVLSDFIRG
FMT_CHLL2         KK-------QDD----------------SLASKAPKLTKENTRIRWNS-RSAELCDFIRG
FMT_PELLD         SL-------QDE----------------SMASKAPKLTRQNTRIDWNR-SAADLHNFIRG
FMT_CHLPM         SA-------QDE----------------SLVSKAPKLTRENTRIDWNQ-SAEDLHNFIRG
FMT_CHLPB         TI-------QDD----------------AMATRAPKLTSETTRIDWAE-PVDAICDFVRG
FMT_PROA2         LL-------QND----------------TLATRAPKLSTENTRIDWVQ-PVDALCDFIRG
FMT_CHLTE         EK-------QDE----------------RFATKAPKLNRENTRIDWNQ-PVQRLHDFIRG
FMT_CHLAB         TP-------QEA----------------SKASIAPKLSKEEGFILWDH-PAEKVYAQIRG
FMT_CHLCV         TP-------QDS----------------SKASIAPKLSKEEGFVLWNH-PAEKVYAQIRG
FMT_CHLPN         VS-------QDA----------------ALATIAPKLSKEEGQVPWDK-PAKEAYAHIRG
FMT_CHLMU         IP-------QDS----------------AKATLAPKLTKEEGLVKWDA-PASQVYAHIRG
FMT_CHLTA         VP-------QNE----------------AMATLAPKLTKEEGGIHWDA-PASQVYAHIRG
FMT_PARUW         QI-------QDS----------------HLATFAPKIELEDCELDWNQ-SAQHLHDLVRG
FMT_BORAP         P--------QKSSE----------------ATFCSFFKKESGFVDFNLSAFE-IKNRINA
FMT_BORBP         P--------QKSSE----------------ATFCSFLKKELGFIDFNLSSFE-IKNRINA
FMT_BORHD         E--------QDSRQ----------------ATYCSFFNKQHRILDFNLSAFE-IKNKINA
FMT_BORRA         V--------QDKNN----------------ATYCSFLGKEHRTIDFKLSAFD-IKNKINA
FMT_TREDE         RP-------QEEAK----------------ALYCSMLKKEDGLIDWSKPAEE-IERKIRA
FMT_TREPS         AA-------QDHSQ----------------ATFCGKLCREMGLADWSNPAVV-LERKIRA
FMT_LEPBL         IP-------QNHAK----------------ATYCGKIKSEDRILDWSLGAEE-LHNRIRA
FMT_LEPIC         VP-------QAHDK----------------ATYCGKIKSEDRILDWSLKSEE-LHNRIRA
FMT_ELUMP         IP-------QTKNIFTPQEDGSMFKEELPLPTYAPMIKKEDTILDFNNFGAETFFNRVRG
FMT_UNCTG         AS-------QTGD-----------------PSFAPSLKKIDGLVNWNKRAGE-IYNQFRG
D1B5G6_THEAS      VP-------QEGS-----------------PSYAPRISNQETRVDWGDGASR-VRDMIRA
FMT_COPPD         FP-------QLGD-----------------PSYAPKFTPDELWIDWQKPAHD-IQNQVRA
FMT_THEAB         YP-------QE-----------------GVPTYAPKISKEDLELDFSADYVT-VKNKIRA
FMT_THEM4         IP-------QE-----------------GKVSFAPKITKEDLKLDFSKDVTF-VKNKIRA
FMT_FERNB         TP-------QDH----------------SKATYAPKIEKKDLYVDFSKPAVE-VRNKIRA
FMT_THEMA         KE-------QDH----------------SRATYAPMIKKEDLIVDFSKDAES-VKNKIRA
FMT_PSELT         RE-------QDH----------------SQASYAPKITPADLFVDFRKDSEA-VKNKIRA
FMT_MESFL         IA--------QNEDE---------------VTFSKNISTEEEKINWNDLSV-NVWNHIRS
FMT_MYCMS         IK--------QNEDE---------------VTFCKNISSEEEKINWNNTSL-DIFNLIRS
FMT_UREP2         IQ--------QDENS---------------VSFAYNIQKDQNIINFDQPAF-FINRFVNA
FMT_UREU1         IQ--------QDEND---------------VSFAYNIQKNQNIIDFNKPAF-FVNRFVNA
FMT_MYCPE         IK--------QDESK---------------VSFAYNISKDDEKINFEKNAV-EIVNLIRG
FMT_MYCPU         IV--------QDEEK---------------VSLSPKLLKEDALLEVDKLSVKDFINKVRA
                                                                              

FMT_BACVZ         LNPWP--VAYTT-LNGQN-----------MKVWASEKVAAKTEA----------------
FMT_BACSU         LNPWP--VAYTT-LNGQN-----------LKIWASKKIAAPTTA----------------
FMT_BACLD         LNPWP--VAYTV-LNGQT-----------LKVWAAKKCQALKQA----------------
FMT_BACP2         LNPWP--VAYTE-WNGAH-----------LKVWEAKKVPLEVQE----------------
FMT_BACCN         LNPWP--VAYTT-LAGQV-----------VKVWWGEKVPTANDA----------------
FMT_BACMK         LNPWP--VAYTT-LAGQV-----------IKVWWGEKVSITEKA----------------
FMT_GEOTN         FHPWP--VTYTT-YDGNV-----------WKIWWGEKVPAPSLA----------------
FMT_BACHD         LHPWP--VAYTL-WNGKP-----------MKIWWAEKVSSPKKE----------------
FMT_OCEIH         LHPWP--VAFTT-YEGKV-----------MKIWWGQELSKSSKSG---------------
FMT_STAAW         LSPWP--VAYTT-MDDTN-----------LKIYDAELV-ETNKIN---------------
FMT_STAEQ         LSPWP--VAYTT-MNEKN-----------LKLFSAFIV-KGKKGN---------------
FMT_LYSSC         LHPWP--VAYTT-FEDGN-----------FKVWWATIG-KSKHDT---------------
FMT_LISMF         LSPWP--VAYTT-LEEKP-----------FKIWEATYE-ETKEDG---------------
FMT_BACSK         MRPWP--VAYTL-VNGNR-----------LKVWEAKEI-AGEHEC---------------
FMT_LACBA         LRPFP--TAHIY-LNGVR-----------TKLWHVTVL-DQKTDL---------------
FMT_PEDPA         LRPFP--VAYFM-MEGKR-----------TKIWKTKVI-DQTTDL---------------
FMT_LACPL         MRPAP--IAYAV-LDGKR-----------TKFWDVTPLADEVVTQ---------------
FMT_LACF3         LRPAP--VGNMV-IDGLR-----------TKVYDVTPL-TETTDL---------------
FMT_LACS1         LRPAP--GAYFKNFKGKR-----------TKLWSIKPL-EEKTEF---------------
FMT_LACCB         LRPDV--GGYVY-LNGQR-----------TKLWAITPL-SAGSTL---------------
FMT_LACSS         LRPQP--GAWLA-VNGQR-----------TKIWQATVA-ETTTDQ---------------
FMT_ENTFA         MRPWP--TAFTT-YQGTN-----------WKIWAVTPL-TETTTS---------------
FMT_LACAC         LNPDP--GAYLM-INGQR-----------FKVWEAEVA-SDSSSL---------------
FMT_LACJO         LNPDP--GAYFM-LGGKR-----------FKVWKAKPL-TEKTSF---------------
FMT_LACDB         LNPDP--GAYLV-IKGQR-----------LKVWKAEVA-DDNTSL---------------
FMT_STRA5         MYPWP--VAHTL-LEGNR-----------FKLYEVTMSE---GKG---------------
FMT_STRT1         MYPWP--VAHTL-LNGKR-----------FKIYEGDLVE---GQG---------------
FMT_STRGC         MNPWP--VAHTL-WQGER-----------FKIYEAELAD---GEG---------------
FMT_STRP4         MNPWP--VAHTF-LKGDR-----------FKIYEALPVE---GQG---------------
FMT_STRS2         MYPWP--VAHTY-WQGER-----------FKIQEAVEAE---GEG---------------
FMT_STRSV         MYPWP--VAHTL-LQGQR-----------FKIYEADMMA---GSG---------------
FMT_STRMU         MNPWP--VAHTL-LDGKR-----------FKIYAVEVVN---GAG---------------
FMT_STRPM         MNPWP--VAHTF-LEGQR-----------LKIYEAQLAE---GEG---------------
FMT_LACLA         MNPFP--VAHTT-WNGER-----------FKIYETKVVDDSVGNL---------------
FMT_ALKMQ         TIPWP--MAYTTYLGNR------------VKIWKSRIEESEVSG----------------
FMT_ALKOO         TIPWP--TAFTFYEGQV------------MKIWKSTVIESELQE----------------
FMT_CLOD6         VNPWP--SAYTTYNDVI------------MKVWKTKVLDEKSTK----------------
FMT_CLOB8         LNPWP--IAYTDYKNER------------MKIYETEVLKEKSNK----------------
FMT_CLOBB         LNPWP--IAYTEYKGER------------MKLYKTKVLDKEVSN----------------
FMT_CLONN         LNPWP--VAYTHYDDKV------------MKIYKSHVLNENSKK----------------
FMT_CLOPS         LNPWP--VALTSYDDIT------------MKVHQTRVEKGESNK----------------
FMT_CLOTE         LNPWP--LAYTYYKGTM------------MKIYEAEIIDKKEDF----------------
FMT_CLOAB         LNPWP--LAYSSYNDKV------------MKIHEAKILDAAPEG----------------
FMT_HUNT2         TNPWP--VAFTYYKGQK------------MKVWVTSVLDEENHNF---------------
FMT_CALS4         LKPWP--GCYTFYDGKM------------LKIWKAEVV-EHFGNE---------------
FMT_THEYD         TYPWP--CAYSFLKDER------------VKIIKTEVLEGNAAP----------------
FMT_AQUAE         L--YP--NAYTTFRGNR------------IKILKARVV---DLEG---------------
FMT_HYDS0         V--YP--NAYGVSGDRN------------IKILKTNIVE-KDLNL---------------
FMT_FUSNN         MNPIP--TAFSNLNGTI------------IKIYETKINDKVYNNA---------------
FMT_SULSY         LKVWP--KAYAKFRDEE------------VKILDAKIVE-CNLNA---------------
FMT_DICT6         LSPEP--GAMTFFRGKI------------LKVFKANFEKRFFDEDV--------------
FMT_DICTD         LSPEP--GAMTFFRGKI------------LKIFKADFEEKIFNEEI--------------
FMT_CARHZ         LNPVP--GAYTVFRGKK------------IKIWKAKVGEFSGKKP---------------
FMT_SYNWW         LNPQP--GAYSYINGTK------------VKIFASKVRSEAGSGVI--------------
FMT_ANAPZ         L--YP--KMYFMLDGSR------------VRVLEAESYEFAEMN----------------
FMT_ANAMM         F--YP--RMFFFLDGKR------------VKLLEADNYELAGAQ----------------
FMT_EHRCJ         L--YP--RAFLLFNGKR------------LRILKTSYYSDSSVQDL--------------
FMT_EHRCR         L--YP--KAFLFFNDKR------------LRILKANYCPDSDLQNL--------------
FMT_EHRRW         L--YP--RAFVFFNGKR------------LRILQASYYYDDNISSL--------------
FMT_WOLPM         F--YP--KAFIKIENKR------------IRILDADFEALASEQ----------------
FMT_WOLPP         F--YP--KAFIKVENKR------------IKILDAEFEAFTSGQ----------------
FMT_RICCK         MNPWP--GVYFSYDDKI------------IKILEAEYLNVDHHFTP--------------
FMT_RICTY         MNPWP--GAYFSYNDKI------------IKILEAEYLNYNHHFIP--------------
FMT_RICBR         MNPWP--GVYFKYNDKT------------IKILEAEYSDEEHNFTP--------------
FMT_ORITB         MNPWP--GTFFTHNNCN------------IKVLKAKIVNNSHNLQP--------------
FMT_BLOFL         FNPWP--VSYFKIKNQY------------IRVWNAEI-NKNSINTDQYNDF---------
FMT_BLOPB         FNPWP--ISFFQIKNDR------------IRVWDAEVSNQNINNYSSSTSI---------
FMT_WIGBR         FNPWP--VSYFWISGKY------------IRAWKAKIDINNIFISD--------------
FMT_BUCAI         FNPWP--ICYF-LSQNKN-----------IKVWQSEVIPITQNNRS--------------
FMT_BUCAP         FNPWP--VCYF-IVNQIA-----------IRVWQAKIIPTVMKSAC--------------
FMT_BUCBP         YNPWP--ICYFKINNQLS-----------IKVWSANVIIHFNQHKYQ-------------
FMT_FRAP2         FTPWP--SAFFMLEGEQ------------VKVGDFEILEKSA-NDE--------------
FMT_FRATN         FTPWP--GAYFILDDEA------------IKVGEFEILYQNTDNRK--------------
FMT_PROM9         LYP----RANTTFRGKN------------LKIIKIKVLSS--DEINNEKYCLMSNYSK--
FMT_PROMS         LYP----RANTIFRGKN------------LKILKIKVLSS--DEIKNEKYLFMSDYSR--
FMT_PROM2         LYP----RANTNFRGKN------------LKILKIKVLTS--DEIKNAKYHLMSNYSK--
FMT_PROM5         LYP----RVSTTFKKKN------------LKIIKIKILTT--DEIQNKNYKIVSDKFK--
FMT_PROMP         LYP----RANTTYKRKN------------LKIIKIKILTT--HEIHNKNYKILSNVFK--
FMT_PROMA         LYP----NCYTYINSKR------------LKVLESIPINNKYDEFLDFRYKDIILKSQS-
FMT_PROM4         LYP----AAYTSLNGKR------------IKLHNSIPLTPSFSTYISNNYDSYIIDYIS-
FMT_SYNPW         LYP----GAVTVWKDRR------------LKVLATEPLIERLADDLSDEARALVGRWNT-
FMT_SYNSC         LHP----GAFTQLHDKR------------LKVLRTEPLIERLQDQLSTEGRSLVGQWPT-
FMT_SYNPX         LYP----GAQTSWNGKR------------LKLTQTEPLIDRLKDQLSPEAQELVGQWPT-
FMT_SYNS3         LYP----NAVTLWNDKR------------LKLLHCEPLIDRLREELPAEVHPLIGRWPT-
FMT_SYNS9         LYP----SAMTGWRNKR------------LKVLETEPLIERLSDEISEEARALLGRWRT-
FMT_SYNR3         LFP----GAHCSWRGKR------------LKLLATEPLVARLADQLSPQAAALSQRQWP-
FMT_PROMM         LYP----NAFSSWNNKR------------LKVQATEPLDEELKSKLSEEVRPLLGRWQD-
FMT_PROMT         LYP----NAYTLYNGKR------------IKILDAIISCDNNQSKESQDIKNQSKSNR--
FMT_PELUB         LYPSP--GAFFIFKDER------------YKILKAELGNK--------------------
FMT_CAMJ8         FTPWP--GVFLENGLKF------------LELELVD----ELKQNA--------------
FMT_WOLSU         YKVWP--GIFLRSELKL------------KEITLLS----ETGEH---------------
FMT_CAMFF         YYPWP--GLYLENGVKI------------WDMEISN----LKGEN---------------
FMT_HELAH         FKTWP--EIFLENNLKL------------LGVELVE----NEKSH---------------
FMT_HELPY         FKSWP--EIFLENGLKL------------LEVELVE----NEKSH---------------
FMT_SULDN         FTPWP--GIYLTSGLKL------------KKIELFE----KESQN---------------
FMT_CALS8         LKIWP--GIFTIYKGKL------------LKIHEMEIAKLDNLENV--------------
FMT_ECOLI         FNPWP--MSWLEI------------EGQPVKVWKASVID--TAT-------N--------
FMT_SALDC         FNPWP--MSWLEI------------DGQPVKVWQASVIE--DAT-------Q--------
FMT_KLEP7         FNPWP--MSWLEI------------DGQPVKVWRASVIA--EAA-------H--------
FMT_ENT38         FNPWP--MSWMTI------------DEQPVKIWKASVIN--REA-------K--------
FMT_CROS8         FNPWP--VSFFMI------------DEQPVKVWKASVIR--QQS-------H--------
FMT_YERE8         FNPWP--VSYFVV------------DEQPIKVWQAQVLA--TVD-------N--------
FMT_YERPY         FNPWP--VSYFIV------------DEQPIKVWQAQVLP--AGE-------D--------
FMT_SERP5         FNPWP--VSYFTI------------DDQPVKVWQATVLA--QNA-------D--------
FMT_ERWT9         FNPWP--ISYFVI------------DEQPVKVWKASVLP--AVN-------G--------
FMT_PECAS         FNPWP--VSYFIV------------DEQPVKVWKAEVIA--KSH-------G--------
FMT_SODGM         FNPWP--ISYFSL------------AEQPIKVWAAGVDDG-QTS-------S--------
FMT_PHOLL         FNPWP--MSFFEM------------EGQPIKVWKAEAIE--EQT-------S--------
FMT_PROMH         FNPWP--MSFFML------------DDQPVKVWEAQVIAS-DNT-------N--------
FMT_ACTP2         FNPWP--ISFLTL-EVD-------GVEQSVKVYQANVLP--HQ--------A--------
FMT_HAEDU         FNPWP--MSFLTV-EVE-------GVEQHVKVYQATVLA--HQ--------Y--------
FMT_ACTSZ         FNPAP--TAFLTL-NLN-------GNEERIKIYQADVLP--HQ--------E--------
FMT_MANSM         FNPAP--VAFLTV-PVN-------EAEERIKVYRAEVLP--HQ--------N--------
FMT_HAEIE         FNPWP--IAYFSTEDRD-------GNAQTLKVYQAEVLP--HQ--------D--------
FMT_PASMU         FNPWP--VSYFSTRDLQ-------GNTQVIKVYKAAVLP--HV--------D--------
FMT_HISS2         FNPWP--MSYFVTQDSQ-------GTLQTLKVYQASVLP--HQ--------N--------
FMT_VIBPA         FNPWP--MSHFEA------------AENSIKVWQSRVAE--QTS-------D--------
FMT_VIBVY         FNPWP--MSHFEV------------AENSIKVWQSRVEA--SSH-------D--------
FMT_VIBC3         FNPWP--MSHFEV------------AENSIKVWQARVET--RAV-------T--------
FMT_ALIFM         FNPWP--MSHFSV------------EDKAIKVWQSRVES--YTG-------D--------
FMT_PHOPR         FNPWP--MSYFAV------------AEQNVKVWHAVVEA--ENQ-------G--------
FMT_AERS4         FNPWP--ISWFEV------------AGQTIKVWQAEVIN--SDH-------G--------
FMT_SHEAM         FNPWP--VSYFEH------------QGQTIKVWQTSVLA--EPS-------T--------
FMT_SHEON         FNPWP--VSYFEH------------QGNTIKVWQTQVST--TSS-------T--------
FMT_SHEDO         FNPWP--VSYFEY------------QDSTIKVWQASYNP--QPN-------S--------
FMT_SHEFN         FNPWP--VSYFEH------------QQSVIKVWQADYSA--ELC-------S--------
FMT_SHEPA         FNPWP--VSHYEH------------EGNTIKVWQSSVSD--ETS-------S--------
FMT_SHEPW         FNPWP--VSHYQH------------AGNTIKVWQSHVSE--KTS-------T--------
FMT_SHESH         FNPWP--ISHFTH------------QDASIKVRESAVSN--LSS-------D--------
FMT_SHEWM         FNPWP--ISHFSH------------QDASIKVREAHVSQ--SKS-------Q--------
FMT_SHELP         FNPWP--ASHFPH------------QDAAIKVWQASVSI--EAA-------K--------
FMT_PSYIN         FNPWP--VSYFVL------------DDKVIKVRQAGLLA--TKS-------E--------
FMT_PSEHT         FNPWP--VCFTQM------------GGQPVKIYQAHVVEQSSSQ-------P--------
FMT_COLP3         YIPWP--VAQFTFTESE-------GKQHRLRIWQASVQE--YRG-------N--------
FMT_PSEA6         FDPWP--VAYF---EAN-------GAAIKVRSAEVQQTP--ICD-------N--------
FMT_IDILO         FNPWP--MSWCQSEHLK-------AGQNTVKIHAAELIQ--GAS-------N--------
FMT_PSEE4         FNPWP--VCHSTL------------DGESVKVLAANLSTGKG------------------
FMT_PSEPF         FNPWP--ITHSTL------------NGEALKVLAATLAEGKG------------------
FMT_PSE14         FNPWP--ICHSTL------------NEETLKVLAADLAEGQG------------------
FMT_PSEA7         FTPWP--VCHSSL------------AGASLKVLGASLGHGSG------------------
FMT_PSEMY         FHPWP--ICHTTL------------NGDALKVHAAELGEGSG------------------
FMT_PSEU5         FNPWP--ICHSTL------------NGETLKIHAAQLGEGRG------------------
FMT_CHRSD         FNPWP--VAWTRL------------AGEPLRLWLAEAEAEAERP-------G--------
FMT_HAHCH         FNPWP--VCFTED------------NGQTIRIWAASASADMSK-----------------
FMT_ALCBS         FNPFP--VSWVPL------------NGQPMRIWRASESPQPAQA-------N--------
FMT_ACIAD         FNPWP--VAFIPLD-----------DKNNLRVWESTVSKL-IAP-------D--------
FMT_ACIBS         FNPWP--VAFIQLD-----------ENNALRVWYSTISNQ-NKA-------D--------
FMT_COXB1         FNPTP--IAFTYF------------EGQPMRIWRATVVD--EKT-------D--------
FMT_METCA         FNPWP--VAETTL------------EGTVLRIWSAQVLD--PAP-------D--------
FMT_LEGPC         FNPWP--VAYTLA------------EELMLRIHQAKATD--IMS-------T--------
FMT_ACIAC         FDPFP--GASTQCSA------------ETIKVWGCEPLQVPP-------PEG--------
FMT_ACISJ         FDPFP--GAATTLGA------------DAIKVWSCEIDSCSR-------TLD--------
FMT_DELAS         FNPFP--GGATQYGD------------ESIKVWEAHADPAIA-------VGT--------
FMT_POLNA         MTPFP--GASAQIGS------------DTVKLWSSEIDSCSC-------PPD--------
FMT_VEREI         FDPAP--GASTTCNG------------TSIKLWGYAIDGATIDGQRG--VPR--------
FMT_METPP         FDPFP--GASFQQAG------------ETVKLWRAAVAPQRG------------------
FMT_RHOFT         FNPFP--GATAVLNG------------ETLKIWLADVAPGVP-------PVS--------
FMT_BORA1         FNPVP--GASLRLPGL----------NEPVKVWQAEALPESS---------P--------
FMT_BORPD         FNPVP--GATLRLPGL----------DEPVKVWRAQALDASA---------A--------
FMT_BORPE         FNPVP--GATIRLPGL----------DDPVKVWRAQALEQAA---------G--------
FMT_PARP8         FDPFP--GGA-ATL-D----------GAVLKLWSAAAVDAS---------CK--------
FMT_PARXL         FDPFP--GGV-GTLED----------GTSIKIWAAIPADTK---------AG--------
FMT_BURM1         FDPFP--GGV-ATL-D----------GAAIKIWAAEPATGR---------GD--------
FMT_BURTA         FDPFP--GGA-GTL-D----------GVTLKLWAADAMPAR---------GD--------
FMT_RALPJ         FNPFP--GAS-AAL-D----------GVAIKFWQAEVLADRP--------AE--------
FMT_HERAR         FNPFP--GAM-GIC-N----------GTPVKFWQAQALECS---------NQ--------
FMT_JANMA         FNPFP--GAA-ATC-D----------GTLIKFWHAQAVPAS---------NQ--------
FMT_CHRVO         YNPAP--GAFTQLGG------------EPLKLWMASAEP-----------GS--------
FMT_THIDA         FNPVP--GAWTLLAG------------APFKILRAEAAPQGE--------AD--------
FMT_AROAE         FNPFP--GAVASLRQ------------VPLKIWFAEPVA-----------GH--------
FMT_NEIM0         FNPVP--AAWVEYQG------------KPMKIRRAEVVAQQG------------------
FMT_DECAR         FNPFP--GAQALFRG------------QTVKLWQASPVAGRG------------------
FMT_METFK         FNPFP--VAHSTLKG------------ETCRIWMAQAVSGTA------------------
FMT_POLNS         FNPFP--GASSKLNG------------YAIKLWNSRLADSQAF------SMV--------
FMT_POLAQ         FNPFP--GAISNLNA------------ETIKLWKSRLADEDAY------SEA--------
FMT_NITEC         FNPYP--GAFTSLHG------------SMIKLWQANII-------NR--SDT--------
FMT_NITEU         FDPHP--GAFTHLQG------------NTIKLWQARIVSHV----NH--NSS--------
FMT_NITMU         FNPRP--GMHSTVNG------------ISMKVWQTSVD-------IA--ETD--------
FMT_STRM5         FNPWP--IAEASL------------AGERVRIHGAVALDLAHGQ----------------
FMT_XANC8         FNPWP--VAEAIL------------AGERVRLHGAVALDLAHQQ----------------
FMT_XYLFA         FQPWP--VAEVVL------------CGERVRIHEALALDLDHSQ----------------
FMT_HALHL         LAPVP--GARLQL------------GETPVRVLAARACAGRPED----------------
FMT_GLUDA         LTPWP--GTFTTLD------------GTVLKIGAATPIDG---------PRD--------
FMT_GLUOX         LTPWP--GAFTTLD------------DVVLKIGAATPLPAE--------SHS--------
FMT_ACICJ         FRPWP--GTETRLD------------GEALKIIRAEPAAG-----------Q--------
FMT_GRABC         LNPWP--GTFSG----------------SLKILAAHAVTE----------AS--------
FMT_AGRFC         LSPFP--GAWLEMDIG--------GKPERVKVLASELASGM-------------------
FMT_RHILW         LAPFP--GAWFELEIG--------GKPERVKVLGSELAEGQ-------------------
FMT_RHIME         LSPFP--GAWFELDIA--------GRRERVKVLASEMSEGE-------------------
FMT_SINMW         LSPFP--GAWFELDIA--------GRRERIKVLGSEISQGE-------------------
FMT_CHESB         LSPLP--GAWCEMPAG--------DKAERVKLLRSTLSEGS-------------------
FMT_OCHA4         LSPFP--GAWCEMEIN--------GAVERVKLQRSALGEGS-------------------
FMT_RHILO         LSPFP--GAWSEIDIG--------GRMERLKLLRSTLSDGLSPS-----EDL--------
FMT_BRADU         LSPFP--GAWAELAGV--------SENARVKILRCELAKGS-------------------
FMT_BRASO         LSPFP--GAWSEITID--------GEAVRLKILRCALARGT-------------------
FMT_NITHX         LSPFP--GAWCEMLVD--------GEQVRVKILRCGVVKGP-------------------
FMT_NITWN         LSPFP--GAWCEMPVD--------GEAVRIKILRCELAEGA-------------------
FMT_RHOP2         LSPFP--GAWCELPID--------GEAVRVKILRCALADGR-------------------
FMT_RHOPT         LSPFP--GAWCELPIE--------GQPVRIKVLRCAIADGR-------------------
FMT_RHOPB         LSPFP--GAWCELPIE--------GEAVRVKILRCELAKGS-------------------
FMT_OLICO         LSPFP--GAWFEVAID--------GAPVRIKVLRCELVKGS-------------------
FMT_METS4         LSPFP--GAFFLADLG--------RGPERVKVLRARSAEGS-------------------
FMT_PARL1         LTPFP--GAFFEIARG--------GETIRVKILRAKPVAKS-------------------
FMT_CAUVC         LSPFP--GAWFEAPSE--------KGPVRVKALLSRVEAAS-------------------
FMT_CAUSK         LSPFP--GAWFEAPSE--------KGSVRVKALLSRVEDGE-------------------
FMT_PHEZH         LSPFP--GAWFELPTE--------KGPVRVKALLSAFEDAE-------------------
FMT_RUEPO         LSPFP--GAWTEIA------------GERVKLLASRLDEGQ-------------------
FMT_RUEST         LSPFP--GAWFEVD------------GQRLKVLASRLAEGT-------------------
FMT_DINSH         LSPVP--GAWCEIA------------GERVKLLGSRLAEGS-------------------
FMT_ROSDO         LSPFP--GAWTLLG------------DTRVKLLGSRIAEAS-------------------
FMT_JANSC         LSPFP--GAWTMAG------------GKRLKLLQSRVANGT-------------------
FMT_RHOS1         LSPFP--GAWTLLN------------GERVKLLRCRLAEGQ-------------------
FMT_RHOS5         LSPFP--GAWTMLG------------GERVKLLRCRLAEGQ-------------------
FMT_PARDP         LSPFP--GAWCLIG------------GERVKLLRSRLAAGS-------------------
FMT_NOVAD         FSPAP--GAFFELE------------GERYRVLAAEVLGVAG------------------
FMT_SPHWW         FNPAP--GAWFEHQ------------GERIRILACEAVDRHGP-----------------
FMT_SPHAL         FNPAP--GAFFELE------------GERYKVLAAEVVHPAETV-----AG---------
FMT_ZYMMO         FAPKP--GAFFLYN------------EERIRILEAHVQNQAG------------------
FMT_MAGSA         LNPWP--GVWFEMA------------GERIKVLEAAVTPGSG------------------
FMT_BARQU         LSPFP--GCWCNMNIA--------GREERVKILGSRLTKGPS------------------
FMT_BART1         LSPSP--GCWCNMNIG--------GREERVKILESRLATGTS------------------
FMT_BARHE         LSPFP--GCWCNMNIA--------GREERVKILGSRLTTRPS------------------
FMT_BARBK         LSPYP--GCWCTMTIG--------GKPERVKILGSRLATGDS------------------
FMT_MAGMM         FDPWP--CAFTLWQ------------GKPLKLFAASVVVGH-------------------
FMT_SYMTH         LNPWP--GAYTNGP------------RGRLKIWRASVVPNPEPG----------------
FMT_BDEBA         FVYGP--GTYTFLQ------------GKKLKLHRATVTRDGGS------IGS--------
FMT_TRIV2         F--YP--NCTTTFR------------NQPLKITASFPLGAAYNDELP--PEL-QKMLQKL
FMT_TRIEI         F--FP--NCFTSFR------------GQSLKVMATIPVGTEYWSELP--PEL-QKLEKVW
FMT_GLOC7         F--YP--NCFTTFR------------EQPLKILATAPLGEAYWEHLP--SNIAQKIQPQW
FMT_MICAN         F--YP--HALTTFR------------GQPLKVMATIPLEDL--GQLP--PEL------QT
FMT_SYNP2         F--YP--NCLTTCR------------DKPLKVLETIPLVPECFAQYP--AAY-----EPL
FMT_SYNY3         F--AP--ACHTAWG------------EQILKIISTVPLGAEFFPLLP--EKY-QDLATAY
FMT_SYNP6         L--YP--GASLPVQ------------GDRLKVLASLPLGLGL--LLS--AAY-----ADW
FMT_THEEB         F--YP--YAYTQWQ------------GTALKILQTWPLIPEVAAKLP--EPL-----QSY
FMT_GLOVI         F--YP--YTHTFHR------------GSRLRLLAAELTSTG-------------------
FMT_SYNJA         F--SP--DCFTGLQ------------GQRIKIVRSAAPQLH---PPP--AEL--------
FMT_DEIRA         VAAWP--QTTAFFG------------GKRLKLAGLTLGQGK-------------------
FMT_THET8         VQPWP--GSYFFHR------------GQRVKALRLRPEPGE-------------------
FMT_ROSCS         YDPWP--GATTTWR------------GAPLKIIAARVRSDRHSD----------------
FMT_ROSS1         YDPWP--GATTMWR------------GAPLKIIAARVIADRCAD----------------
FMT_CHLAA         YDPWP--GAYTFWR------------GQPLRIIKAAVASADGTN----------------
FMT_HERA2         YDPWP--GTAVKLN------------DQPFKILRAKAHTSWSGT----------------
FMT_DEHMB         FFPWP--GVFTTFN------------QKTLKILEAKPR-NLGLG----------------
FMT_AKKM8         YDPWP--GTFTNYWNRK------------KRIRNMKIFPG---FSILPE-----------
FMT_DESVV         VTPWP--AAYFTLRREG------------QKDVRVTIEPGT--IGPLLE-----------
FMT_MYXXD         FTPWP--GAFTTLGGKL------------LKVHRAQARG---------------------
FMT_SORC5         MTSWP--GAFTTIDGKA------------LKVLAAHVESEADQ-----------------
FMT_ANASK         FTPWP--GAFTTLEGRT------------LKVLEARPGADAEA-----------------
FMT_KORVE         FTPWP--GAFTQFRGKG------------FFIHQARAVA---------------------
FMT_SOLUE         LQPWP--GAQTTFRGQP------------LHIWKSRPVT---------------------
FMT_GEOBB         MTPWP--GAYSFLDDKL------------LKVFRVQTASGS-------------------
FMT_GEOUR         MTPWP--GAFSFLDGKM------------LKIYRVGTAGGE-------------------
FMT_GEOMG         FTPWP--GAYTTLDGKT------------LKLYKVSVATEC-------------------
FMT_GEOSL         FTPWP--GAYTFLDGKT------------LKLYRVAVAGET-------------------
FMT_GEOLS         LSAWP--GAVTSLGGAP------------LKLYRSSIGQGA-------------------
FMT_PELPD         LAAWP--GAQTLLNGHA------------LKLFRTRVADGA-------------------
FMT_SYNAS         LSPAP--GAYTFLNGKT------------LKIFAAAGIEQSV------------------
FMT_DESPS         MDPWP--SAFCFLEGKR------------LRLFMPEVSYQKT------------------
FMT_DESRM         MNPWP--GTYTIWDNKI------------LKIWQTTI-------PAHQN-----------
FMT_PELTS         MNPWP--GARTYFSGKV------------LKIWRAAV-------VEEEG-----------
FMT_MOOTA         LNPWP--GAYTLRSGER------------LKIYGARL-------TDPSA-----------
FMT_HELMI         MNPWP--GAFTMDEGKI------------LKILRGRLRHEGLPLPDPTG-----------
FMT_NATTJ         LNPWP--GAFTKFEGKR------------LKIWETKVHN-----SSSFN-----------
FMT_METI4         FNPWP--VAFTTVWIGG------------EKK-ILKIFKVII----SHR-----------
FMT_RHOBA         MQPWP--VAFTHTVVNE------------NKPPLRVAIRGVR----TET-----------
FMT_FRAAA         AAPAP--GAWTVFRDRR------------IKIGPVRLGAQN-------------------
FMT_FRACC         ATPAP--GAWTTFRDRR------------LKIGPVRLGAVSGRPAGPVA----------L
FMT_FRASN         ATPAP--GAWTTFRDRR------------VKLGPVRPAPAG-------------------
FMT_SACEN         VTPDP--GAWASFRDER------------LKLGPVSIVDED-------------------
FMT_SALTO         CSPAP--GPWTTFRDER------------VKLGPVTLVAGG-------------------
FMT_STRCO         CTPAP--GAWTTFRGER------------LKLVQAVPLPDR-------------------
FMT_STRGG         CTPAP--GAWTVFRGER------------LKLIQATPVLDR-------------------
FMT_STRAW         CTPAP--GAWTVFRGER------------LKLIQVVPVPER-------------------
FMT_THEFY         CTPAP--GAWTRFRGTR------------IKLGPVEPLPDA-------------------
FMT_MYCBP         VTPNP--GAWTLIGDLR------------VKLGPVHLDAAH-------------------
FMT_MYCLE         VTPNP--GAWTLVGKLR------------VKLGPVRFDSGAVEVP---------------
FMT_MYCPA         VTPNP--GAWTVISDLR------------IKLGPVRLGAAS-DLP---------------
FMT_MYCUA         VTPNP--GAWTLIGDLR------------VKLGPVYLDAAV-------------------
FMT_MYCS2         VTPNP--GAWTMIGELR------------VKVGPVTVDQAAEAD----------------
FMT_MYCSS         VTPNP--GAWTVIGDAR------------VKLGPV----APESA----------------
FMT_MYCGI         VTPNP--GAWTMAGELR------------IKVGPVTVPDDG-------------------
FMT_MYCVP         VTPNP--GAWTMIGDQR------------IKVGPVTVAGDG-------------------
FMT_MYCA9         MTPEP--GAWTNIGGTR------------VKVGPVGVATDE-------------------
FMT_NOCFA         VTPAP--GAWTLVGGNR------------LKLGPVELVEEQ-------------------
FMT_NOCSJ         CTPAP--GAWTTVAGER------------LKLGPVTHADAHG------------------
FMT_ACIC1         VTPEP--GAWTTLAGRR------------IVLGPVRLAEPQHAPGATDDG---------S
FMT_KINRD         CTPEP--GAWTTFRGER------------FKVGPVVPVPDP-------------------
FMT_PAEAT         VTPEP--GAWTTLDGQR------------VKLEPVALRPEV-------------------
FMT_ARTS2         VTPEP--GAWTTLDGQR------------VKLEPVALRTDA-------------------
FMT_RENSM         VTEEP--GAWTVLAGQR------------FKVAAATLRPDR-------------------
FMT_CLAM3         VTPEP--GAFTSVDDVR------------VKVHRAAELRDA-------------------
FMT_CLAMS         VTPEP--GAHTSVDDVR------------LKIHRAAALRDA-------------------
FMT_LEIXX         VTPEP--GAWALLDGER------------FKIH-AVRPTAA-------------------
FMT_CUTAK         VSPTP--GAWAELDGKR------------FKILRTRCLEAGDGVP---------------
FMT_BIFAA         CTPNP--GAWCELHAHA--------DAEPATLHVLRAQPADMSNP---------------
FMT_BIFLD         CTPHP--GAWTELFAEGPIADNDEPAAKPLTLHILAAQPADQSNP---------------
FMT_COREF         HTPGP--GAWTMLDDAR------------LKVGPLVTVTDLPDV----------------
FMT_CORGB         HTPGP--GAWTTLVDAR------------LKVGPISHSGEVEVA----------------
FMT_CORDI         VTPGP--GAWSLLGDQR------------FKIGPVSVAEE--------------------
FMT_CORJK         HTPAP--GAWTLLDGQR------------YKIGMLLP-SDPADV----------------
FMT_CORU7         HTPAP--GAWCTLDGQR------------YKFGLMLPVAEGEEF----------------
FMT_RUBXD         LSPHI--GARTRHPEVE----------GPLKIWRTRVHREAG------------------
FMT_BACFN         LSPYP--AAWSELVNPEGEA-------VVVKIFESEKL--PKVHTLA-------------
FMT_BACTN         LSPYP--AAWSELVSPEGEA-------VVMKIFESEKI--YEAHQLP-------------
FMT_BACV8         LSPYP--AAWTELCVADGTR-------QVLKIYETEKV--FASHEMN-------------
FMT_PARD8         LSPYP--AAWTELISEDGKR-------LALKIYQAEKR--PAEHNFP-------------
FMT_AZOPC         LSPYP--GAWTELTCVKGMT-------FPFKIFETEKAD-CHDYSLP-------------
FMT_PORG3         ISPAP--TAWTKLHRPGMES-------IVLKIYRTQVIEREPRHRGR-------------
FMT_CHLCH         LALKP--SAWTTFNDKT------------LKIFRTTLSTPEHDHPSA-------------
FMT_CHLPD         LAMKP--AAWTTVQNRT------------MKIFRAIPFTEEITSSIE-------------
FMT_CHLL2         LAMKP--AAWTTMDGKT------------LKVYKAVPLESPISLPERG------------
FMT_PELLD         LSMRP--AAWTTLGGKS------------VKIFRSAAAPQMSPSSPC-------------
FMT_CHLPM         LAMRP--TAWTTLGGKN------------FKIFQSAPAPAVPATSCG-------------
FMT_CHLPB         LSPKP--SAWTVFNHRK------------VKIYRVAPGMFQLPEQDEQQ-----------
FMT_PROA2         LAPRP--AAWAIFNHKK------------VKIFKASVADFHQPEAEEQS-----------
FMT_CHLTE         LALKP--AAWTTFGGKS------------LKIYKAKACAIETAPDE--------------
FMT_CHLAB         VTPAP--GAWTLYSYQGKPA-------RRLVIRKASLSSSQGVYGH--------------
FMT_CHLCV         VTPAP--GAWTLYSYQDKPA-------KRLVIRKASLASNKGIYGN--------------
FMT_CHLPN         VTPAP--GAWTLFSFSEKAP-------KRLMIRKASLLAEAGRYGA--------------
FMT_CHLMU         VSPAP--GAWTRFLSQGKEP-------RRLGILSARMESSSGSHS---------------
FMT_CHLTA         VSPAP--GAWTRYLSQGKGA-------RRLGVLSARMESFSGNYGD--------------
FMT_PARUW         VNPYP--GAWCYVKVNGEQ--------KRLKISRTRVIPYP--SNC--------------
FMT_BORAP         CNPWP--LARARLDYGD------------IIFHRADFLKIDLYKEKK-------------
FMT_BORBP         CNPWP--LVRAKLDYSD------------IIFHRADFWEIDLYKERK-------------
FMT_BORHD         CNPWP--LARAKLDDDE------------IIFHRADFIRTNDYSDQA-------------
FMT_BORRA         YNPWP--LARARLDNNE------------IIFYRADFISTNDYDDQV-------------
FMT_TREDE         FTPWP--GCFTFKNSEK------------ISIIEANLYEDASNEMTKN------------
FMT_TREPS         FTPWP--GLFTYKDGER------------IAILQARSCESSFVPLAP-------------
FMT_LEPBL         LYPDA--IATTRFREKR------------IGILKTKLSSLSIESNPE-------------
FMT_LEPIC         LYPDM--IATTTFRDKR------------MNILKTKPSSLSLEINPT-------------
FMT_ELUMP         LACGPHAKVITKINGKEDL----------LQIIKASLLEKNKQCPPNM------------
FMT_UNCTG         LYLWP--GIYSTISQGKLV----------GKRIKFREIEVFDSDSINK------------
D1B5G6_THEAS      LSPSP--CAWSTLGG---------------RRIRILKASVDQYPPISS------------
FMT_COPPD         LA-DV--GAKTTLGS---------------KLVKIFKVRISGMEDSLP------------
FMT_THEAB         YDPIP--GVRSVLKGK--------------IVKLFQVFYVEADENI-K------------
FMT_THEM4         YDPLP--GVRVLFKRK--------------IVKLFGVFSVLENSS--R------------
FMT_FERNB         YDPTP--GVRTFLNDI--------------EVKLYGACEIESNSQENI------------
FMT_THEMA         YDSRP--GARAFLGNV--------------EVKLFGVTAIDSSGD---------------
FMT_PSELT         YDSRP--GARTFFHGE--------------QVKLFGAVAIEKCHSG--------------
FMT_MESFL         LSPWP--IAHTFKGEER------------YKIQKVQIL---NNNVEA-------------
FMT_MYCMS         LSPSP--ISYTTINNQR------------YKIKSSKVIDLDNQNKNA-------------
FMT_UREP2         MYDKP--IAIMQYNGVS------------IKVYQVKIT---NQKSCQ-------------
FMT_UREU1         MYDKP--IAIMEYNDVL------------IKVHQIKIT---NQKSTQ-------------
FMT_MYCPE         LSETP--GAYCFINDKK------------MKLFKAVST---NSKSNN-------------
FMT_MYCPU         FSLNP--GAYLIKDGKR------------VKIFRATTS----------------------
                                                                              

FMT_BACVZ         ---------APGTVIRTEQNGIVVASGNST-----ALLITELQPAGKKRMKGEDFVRGK-
FMT_BACSU         ---------EPGTVVAVEKEGIIVATGNET-----ALLLTELQPAGKKRMKGEDFVRGA-
FMT_BACLD         ---------EPGEIVTVEKDGIVVATGNDT-----ALKLTEVQPAGKKRMKAEDFVRGA-
FMT_BACP2         ---------EAGKVIELQKEGPVIGTGNKQ-----GLLLTGVQPAGKKKMSGEDFLRGA-
FMT_BACCN         ---------QPGTIVEIQEDGFIVVTGNET-----GIKITELQPAGKKRMSSSQFLRGA-
FMT_BACMK         ---------EPGTIVALEEDGFVVATGNET-----GVKITELQPSGKKRMSCSQFLRGT-
FMT_GEOTN         ---------SPGTILSLEEDGIVVATGSET-----AIKITELQPAGKKRMAASEFLRGAG
FMT_BACHD         ---------APGTVIALEENGFLVATGDET-----ALKVTDLQPAGKKRMLARDFLRGAG
FMT_OCEIH         ---------NIGEIIEKDTDGFYVQCGNNT-----VVKVSEIQPAGKKRMLVEDYLKGSQ
FMT_STAAW         ---------EPGTIIETTKKAIIVATNDNE-----AVAIKDMQLAGKKRMLAANYLSGAQ
FMT_STAEQ         ----------PGTIIEATKHELIIATGSDD-----AIALTEIQPAGKKRMKVTDYLSGVQ
FMT_LYSSC         ---------IPGTVVAIAKDHFEVAAGNGT-----TLALYDVQPAGKKRMTAEEYLRGTG
FMT_LISMF         ---------EPGAILA-DKTTLKIVAGDGT-----LIVPTVIQPAGKPKMDVHSFMTGAG
FMT_BACSK         ---------EPGEILATTKQGIDVACGNGT-----ILRLTVVQPAGKKAVLANQLLQGA-
FMT_LACBA         ---------QPGAVVSRDKHHLAIATGEQG-----VLSLDELQPAGKPKLSITDYLNGTT
FMT_PEDPA         ---------KPGQVVSKTKHELLVATGEHG-----VISIEELQPAGKQKMTITDYLNGVG
FMT_LACPL         ---------APGQVVRKTKHELVIAAADHT-----AIAINQLQPAGKPKMTITDYLNGAA
FMT_LACF3         ---------QPGQVVRVEKHALIIAAGAGT-----TYQINSLKPAGKPKMDITDYLNG-H
FMT_LACS1         ---------APGYVVNVDKHELKVSAYNGT-----VYSIIELQPAGKQKMDITSYLNGVG
FMT_LACCB         ---------PAGSIVERDKHRLVMVAGQQT-----TFQVDELQPAGKAKQSIADFLNGPG
FMT_LACSS         ---------AAGVVVALNKKDFELAAGNGT-----VLKITEIQPAGKAKMPVQSYLNGVG
FMT_ENTFA         ---------APGTIIQRSKKALWIACGEGT-----VLQIDRLQPAGKGQLTIQEFLNGVG
FMT_LACAC         ---------EAGTVVAN-KGRFAISFADNT-----VLNLLEVQPSGKKRMNIKNFLNGQG
FMT_LACJO         ---------PAGTLVTN-KKKFVISMADGS-----QLELLEVQPTGKKKMNIKDYLNGQG
FMT_LACDB         ---------PAGHLLTN-QGRFAISFAGNT-----VLNLLEVQPNGKKAMAIKDFLNGQG
FMT_STRA5         ---------SPGQVIAKTKNSLTVATGDG------AIELKSVQPAGKPRMDIKDFLNGVG
FMT_STRT1         ---------QAGHIIEKTKKSLVVATGQG------AISLKSVQPEGKPRMAIADFLNGVG
FMT_STRGC         ---------QPGEILEIGKRQLLVATGEG------ALVLKTVQPAGKPKMTISDFLNGAG
FMT_STRP4         ---------NPGEILSICKKELIVATAEG------ALSLKQVQPAGKPKMDIASFLNGVG
FMT_STRS2         ---------SVGRVIARSKKELIIATGQG------ALSLKTVQPAGKPKMTIADFLNGAG
FMT_STRSV         ---------QPGQILSISKKELVVAAGKG------ALSLKTVQPAGKPKMAIVDFLNGLG
FMT_STRMU         ---------NPGEIIEKTKKALIVAANQD------ALSLKLVQPAGKPKMSITDFLNGLG
FMT_STRPM         ---------LPGQVIVKTKKSLVIAAGQG------ALSLLVVQPAGKPKMAIADFLNGLG
FMT_LACLA         ---------QAGEIVEKTKKSLKVATGEG------LLELLFVQPAGKPKMDIVSFLNGLG
FMT_ALKMQ         ---------KPGEILKVEKS-GIFVKTGQG-----TLVIERIQFSGKKPLDVREYLAGNT
FMT_ALKOO         ---------VPGKIIDVKKD-CILVATGQN-----ILSIEEIQFSGKKRMGVRDYLVGNA
FMT_CLOD6         ---------DVGTIIDVSKD-GIKVSTIDN-----VLLIEEIQMPNKKRMLVGEYIKGNT
FMT_CLOB8         ---------EPGTIIDVSKN-GVKVSCKED-----VLLIKRVQFPNGKPLTIEQYINGHE
FMT_CLOBB         ---------KPGTIIEVNKD-GVKVVCGKN-----VLIIEKVQFPNGKPLTIEQYINGHS
FMT_CLONN         ---------EPGTVINVSNK-GIKVACGEG-----ILVVEEIQFPGKKPLKVEQYIRGNS
FMT_CLOPS         ---------EPGTIIAVDKT-GIKVSTGKD-----ILVIEKLQFPNSKQLFVEQFINGNT
FMT_CLOTE         ---------SPGFIIDVSKG-GIKVATKDG-----ILLLKKIQFPSKKPMYVEEYIRGNK
FMT_CLOAB         ---------EPGLITNVDNN-GIEVNSSDG-----KILITKIQFPGKKSMNVGEYIRGNN
FMT_HUNT2         ---------TPGTILKVGKD-GLVVACGVG-----KVVIKEVQFDSSRRMTVEEYICGHK
FMT_CALS4         ---------PPGSVLKS-KD-ELIVKCGEN-----ALRILEIQQEGSRKMGIREYLIGHN
FMT_THEYD         -----------GLIIKA-KN-ELIVGTQEG-----LLRILLIQPEGKKIMTAKEFISGRK
FMT_AQUAE         ---------YPGEI-QDTKR--LIVACGEK-----SLEILELISPKGKKMRGEDFMRGYR
FMT_HYDS0         ---------KPGELFYDGKS--LFVGTGDL-----PLEILEIMSLKGKRVSGKEFAMGYL
FMT_FUSNN         ---------TCGEVVEYLKGKGIVVKTSDG-----SLIISSAKPENKKQMSGVDLINGKF
FMT_SULSY         ---------LPGEIIKADEKEGIVVKTGDG-----CLLLKIIQFPNSKPITTQDAIRGYK
FMT_DICT6         ---------INGTIIEQDRKKGIGVKVENG-----ILWLLELQPEGKKKMNFLEFMNGYR
FMT_DICTD         ---------INGTIIEQNKKRGIGVKVNNG-----ILWLLELQPEGKKRMSFLEFMNGYR
FMT_CARHZ         -----------GEIIFADRKNGFLVATGER-----GLQILELQPEGGKKMSWESFLNGYR
FMT_SYNWW         -----------AEVIEVD-KNTFQVQTGEG-----ILEVLEIQKAGKKRMPTSEFLKGFT
FMT_ANAPZ         -------------IGDVINNELHIRCGGNT-----ALVPLVVQQESKKPCDIKSFLCRFR
FMT_ANAMM         -------------IGDVVNDELHIQCGNGT-----VLAPKIVQPESKKPCDIRSFLRGFR
FMT_EHRCJ         ------------KPGAVIDSHMNIKCK-DG-----VLVPLVVQMEGKNPCNIDDFILGYN
FMT_EHRCR         ------------KPGTVINSHMHIKCK-NG-----VLIPLIVQLEGKNPCSINDFIHGYS
FMT_EHRRW         ------------KPSSILNSGMHIKCKGNT-----ILVPLVVQMEGKTLCSIKDFVCGYN
FMT_WOLPM         --------------GKIVNDNMHISLK-GG-----TLIPKVVQMEGRNPCSIEDFIRGLK
FMT_WOLPP         --------------GEIINDNMHISLK-GG-----TLIPKVVQMEGRNPCDIKDFVRGLK
FMT_RICCK         ------------GTVI---SDKLEIACGSG-----ILQVKKLQQESKKALNIEEFLLGTR
FMT_RICTY         ------------GTVI---SNKLEIACGSG-----ILRVTKLQQESKKALNIEAFLRGTN
FMT_RICBR         ------------GTII---NKNLEIACGKG-----ILMIKKLQQEGKKVLNIEEFLRGFK
FMT_ORITB         ------------GTVKIANNDKLLVACQEH-----FLELLSLQLPGRKELSSDQFLCGYH
FMT_BLOFL         ----------QPGTILKTHPNGIYVITGSG-----IIILTVLQISGKKKIHVKDLMNAYS
FMT_BLOPB         ----------LPGTILAAHPNGIYVVTGSG-----ILILTMLQISGKKITSVRDLLNAYK
FMT_WIGBR         -----------PGKILNVNSDGIHVGTGKG-----ILILEVLQLSGKKRSFVKESLCLYK
FMT_BUCAI         -----------VGEIISYNKNGIQINTSHQ-----ILNIKKLQFPGKKIIDVKNVIISKK
FMT_BUCAP         -----------VGEIVAFNKNGIQINTAHQ-----ILNLQKIQFPGKKIINVEKIISSKK
FMT_BUCBP         -----------IGEIILINKHGMQIKTSKN-----ILNITTVQLPGKKIMHANNLCNSKN
FMT_FRAP2         -----------VTAIIDITKNGFDIATNDK-----IIRFKQLQFPNKKMLNIADILNGKD
FMT_FRATN         -----------AGTIIDIDRSGFDIATSDK-----IIRFRQLQFPNKKMLNIVDILNGKD
FMT_PROM9         ----------PGIILAVLENEGIIISTKTD-----PIILLEAKLEGKNISSKKQLIQQLK
FMT_PROMS         ----------PGIILAVIEDEGIIISTKTD-----PIILLEAKLEGKNISSKKQLIQQLK
FMT_PROM2         ----------PGIILAVIENEGIIISTKTD-----PIILLEAKIEGKNISTKKQLIQQLK
FMT_PROM5         ----------PGYVIGLIENKGIIISTKTD-----PILLLEAKLEGKNISKQKQLLQQLN
FMT_PROMP         ----------PGLIIGLIKNVGIIITTKTD-----PILLLEAKLEGKKVSSQNQLIQQLN
FMT_PROMA         ------IINNNGLIIDIIENIGIIVQTKDV-----PLLITKVKLEGKKESSQNALIQQLT
FMT_PROM4         ------TSSYPGEILAVIPKLGFIVGTASY-----PILILNGQMEGRNSVSADILAKQID
FMT_SYNPW         ------GAHPPGQVLHS-ADSGLVVSTHGC-----PILIREAQLEGKARSHGQALIQQLQ
FMT_SYNSC         ------GGHPPGTILAMIEDLGLVVSSSGC-----PLLIREAQLEGKARSTAPALLQQLK
FMT_SYNPX         ------GGHAGGTVLACIQDLGLVVSSSGC-----PLLIREAQLEGKSRSRGQALVQQMA
FMT_SYNS3         ------GGHPPGTVLESVKGLGVVVSTSGC-----PILVRAAQLEGKGRSDGDSLIQQLN
FMT_SYNS9         ------GEDHPGTVLGCINNVGIVVSTSGC-----PILIREAQLEGKGRCRAQGLVQQLA
FMT_SYNR3         ------SAE-PGSILEAVRGVGLVLATSGC-----PILLRQAQLEGKAASSGDSLIQQLS
FMT_PROMM         ------GEHEPGKILACESDLGLVVSTKTC-----PLLIRQGQLEGKSKALGEVLIQQLQ
FMT_PROMT         ---------IPGEIFMINKQIGIKIMTNDF-----PVLIKYAQLEGKKATDSYTLSIQSN
FMT_PELUB         ----------SGEIGEVMSNDLEISCGNQK-----SIKIIEIQRQGKKPQNINEFVLGSQ
FMT_CAMJ8         ----------RMGEILELEKESFLLACKQG-----VLRIKKLQESGKKALDGRTYLNGKR
FMT_WOLSU         ----------HMGEILAINKEGVVVGCKEG-----SLRILMVQAPSKKEVDAVSYVNGKR
FMT_CAMFF         ------------GYVLSIDYDGFTIGVNGG-----SIKIKSLQESGKKMVNAKDYINGKR
FMT_HELAH         ----------REGEILRIDERGVLVGCLKG-----SVRIARLQAVGKKPLKAKDYLNGRR
FMT_HELPY         ----------KEGEILEIDEKGVLVGCLKG-----SVRIARLQAVGKKPLKAKDYLNGKR
FMT_SULDN         ----------ESGRILDIQKDSIIVGCKKG-----SIKVITLQPESKNEMSALSYINGKR
FMT_CALS8         ----------QNGTILGINETGILVKVKDG-----VIKLKELQLEGGRKMSARDFVNGYK
FMT_ECOLI         --------AAPGTILEANK-QGIQVATGD-----GILNLLSLQPAGKKAMSAQDLLNSRR
FMT_SALDC         --------SLPGTILAATK-QGIQVATGK-----GILNLLSLQPAGKKAMSAQDLLNSRR
FMT_KLEP7         --------AEPGTIVAATK-QGIQVATGD-----GILSLESLQPAGKKAMSAQDLLNSRR
FMT_ENT38         --------AEPGTIIEATR-EGIQVATAD-----GILNLESLQPAGKKAMSAQDLLNSRR
FMT_CROS8         --------ATPGTILDAGK-QGIQVATTD-----GILNLESLQPAGKKPMSAQDLLNSRR
FMT_YERE8         --------AAPGTIIHADK-HGIQVATAD-----GVLNITQLQPAGKKAMSAADLLNSRR
FMT_YERPY         --------AEPGTIIHADK-HGIQVATAD-----GVLNITQLQPAGKKAMSAADLLNSRR
FMT_SERP5         --------AEPGTIIHADK-HGIQVATAE-----GILNLTQLQPAGKKPMSAQDLLNSRR
FMT_ERWT9         --------HQPGEILQANK-QGIQVVTAD-----GVLNIEELQPAGKKAMKAQDLLNSRR
FMT_PECAS         --------SQPGTILQADK-QGIQVAAAD-----GILNIQELQPAGKKVMSAQDLLNSRR
FMT_SODGM         --------HAPGTILAADK-AGIHIATGA-----GVLTLTQLQPAGKKAMSVQDLLNSRR
FMT_PHOLL         --------VEPGTVLKADK-EGIYIATAD-----GILNITQLQPAGKKAMSAANLLNSKR
FMT_PROMH         --------QIPGTLLKADK-TGIYIVTGE-----GILNITKLQPSGKKPMASADFLNSKR
FMT_ACTP2         --------KAAGTVLQADK-NGIQIATQE-----GVLNITQLQPSGKKPMSVQDFLNGRA
FMT_HAEDU         --------HAVGTVLQVDK-NGIQIATSE-----GVLNITQLQPQGKKPMSVQDFLNGRA
FMT_ACTSZ         --------KAAGTVLACDK-KGVQIATAD-----GVLNITRLQPSGKKPMSVQDFLNGRA
FMT_MANSM         --------SAAGTVLAFDK-KGLRIATAE-----GVLNIQQLQPSGKKPMSVQDFLNGRA
FMT_HAEIE         --------KPAGTILSADK-NGIQIATVD-----GVLNLLQLQPAGKKLMSAQDLLNGRA
FMT_PASMU         --------KVAGTILSADK-NGIQIATAE-----GVLNLLQLQPAGKKPMDARDLLNGRA
FMT_HISS2         --------KPCGTILAADK-RGIQVATAN-----GVLNLEQLQPAGKKPMSARDLLNSRA
FMT_VIBPA         --------KPAGTIVQADK-TGIYVATGN-----GVLVLEQLQVPGKKAMSVQDILNSRA
FMT_VIBVY         --------APAGTILKADK-SGIYIATGH-----GCLVLEQIQIPGKKAMPVQDVLNARA
FMT_VIBC3         --------QTPGTIIQADK-SGIYVATGQ-----DVLVLESLQIPGKKALPVQDILNARA
FMT_ALIFM         --------ATPGTIIQADK-TGIYVATGS-----DAIVFEQLQVPGKKAMGVQDILNSRK
FMT_PHOPR         --------KAPGTILSADK-QGITVATGK-----GALRLIELQPPGKKAMKAQDILNSRR
FMT_AERS4         --------QPTGTLLKADK-QGIDIATGL-----GVLRLLTLQPPGKKAMSVSDLLNSRR
FMT_SHEAM         --------KASGTIVAAGK-QGIDIATAD-----GMLRIHKMQLPGKKPMDVADILNSRG
FMT_SHEON         --------AAPGTIINASK-KGIDVSTGD-----GVLTLLSMQLPGKKPLSVADILNARG
FMT_SHEDO         --------ALAGSIIKADK-HSIEVATAE-----GSLQLEIIQLPNKKPLAVADILNSRA
FMT_SHEFN         --------QAPGTIIAATK-QGIEIATAE-----GKLMIKTMQLPNKKPLDVADILNARG
FMT_SHEPA         --------QQPGTILSADK-SGISIATGE-----GVLTITQMQLPGKKPLSVADILNSRA
FMT_SHEPW         --------AAAGTVISADK-NGIDVATGN-----GVLTITSMQLPGKKPLSVADILNSRA
FMT_SHESH         --------APAGTIISAGK-QGIDIATGD-----GVLTLLNMQLPGKKPLSVGDILNSRG
FMT_SHEWM         --------APAGTIISAGK-EGIEIATGD-----GVLTLLNMQLPGKKPLSVADILNSRS
FMT_SHELP         --------QAPGTIIRADK-QGIAVATGE-----GALVLETIQLPGKKAMAVADVLNARG
FMT_PSYIN         --------QTAGTIITASK-NGIQVATGE-----GIINLEVLQLAGKKALPVQDILNSRR
FMT_PSEHT         --------DNNGRVLSSDK-NGVIVGCGE-----HALCITQLQPQGKKPMAINDFLNGRS
FMT_COLP3         --------ADPGTIIKADK-EGIEVATTS-----GSLRLEVIQLPGKKALAVKDILNGRS
FMT_PSEA6         --------AKPGQIIQADK-HAIGVQTGD-----GVLLIKTLQLPGKKPLATQDILNGHS
FMT_IDILO         --------KGPGTIINSTH-EGIDVVTGD-----GILRITQAQMPGKKAQPASTLVNGYS
FMT_PSEE4         ---------TPGEILSASK-DGLVVACGD-----GALSLTRLQLPGGKALAFSDLFNSRR
FMT_PSEPF         ---------APGTILGASK-DGLIVACGE-----QALCLTRLQLPGGKALNFSDLFNSRR
FMT_PSE14         ---------VPGTVLSASK-DGLIVACGQ-----NALRLTRLQLPGGKPLNFADLFNSRR
FMT_PSEA7         ---------TPGSILEASR-DGLLVACGE-----GALRLTRLQLPGGKPLAFADLYNSRR
FMT_PSEMY         ---------APGTILAADK-NGLTVACGE-----GALRLTRLQLPGGKPLAFSDLYNSRR
FMT_PSEU5         ---------VPGLILDASK-AGLTVACGE-----GALSLTRLQLPGGKPLGFGDLYNSRR
FMT_CHRSD         --------VAPGTLLQSAP-DALRIACGHD-G-TQVVRITRAQLPGGKPLAVRDLLNARG
FMT_HAHCH         --------AKPGTILERSA-EAVKVACGE-----GVLSITSLQLPGGKPISCKDLINGGK
FMT_ALCBS         --------DEPGYILSVDD-QGIHVATGD-----GSLILEELQLPGKRRMAVSDLLRGNP
FMT_ACIAD         --------AEAGKIIAMDK-HGIHVACGTG-V----VCLTALQWPGGKALNPVQIIQTQK
FMT_ACIBS         --------AKAGEIIAIDK-QGVHVACGEN-TF---ICLTSVQWPGGKALNAQQIAQTQK
FMT_COXB1         --------FEPGVLVDADK-KGISIAAGS-----GILRLHQLQLPGKRVCSAGDFINAHG
FMT_METCA         --------APPGSIIACTK-N-LDVACGR-----GALRILEVQPPGKRRMSAKDFLNAHA
FMT_LEGPC         --------EMPGMVLNIDK-NGMLVATND-----NALLVEKIQFPGAKVISVRDWLNSGK
FMT_ACIAC         --------AQPGEILQVDD-AGVDVACGGPDGAAGVLRLTVLQRAGGKRLPVGDFLR-GH
FMT_ACISJ         --------AACGQILSIDA-DGIGVAC----GAGSLLRLTVLQRAGGKRLPAADFLR-GF
FMT_DELAS         --------AAPGTVLSAGA-DGVRVAC-----GNGVLCMTLLQRAGGKRLAAGDFLR-GF
FMT_POLNA         --------MRKGLILSANS-DGVRVAC-----GDGVLKVTELQRAGGKRLPAADFLR-GF
FMT_VEREI         --------MHPGQILSADD-SGIAVAC----GQGTALRLTVLQRAGGKRLAAADFLR-GF
FMT_METPP         ---------APGTVLSAAE-GVLRVAC-----GDLSLDLLQLQRPGGRRVGARDFLAVRS
FMT_RHOFT         --------KEFGSILAVAP-VGIEVVA-----MKSIVNITQLQRPGGKRLGVAEFLR-GF
FMT_BORA1         --------AAPGTVLRASA-QGVDIAT-----GQGVLRLLELQKAGGKRQSAEVFVR-GW
FMT_BORPD         --------QAPGSVLRAGP-EGIDIAT-----GSGVLRLLELQKAGGKRQPVDVFVR-GW
FMT_BORPE         --------GTSGAVLRADA-QGIDIAT-----GQGVLRLLELQKAGGKRQPVDVFVR-GW
FMT_PARP8         --------AEPGTIVEVSP-EGVVVAC-----GDGALRITQLQKPGGKRLPVRDFLA-GS
FMT_PARXL         --------GAPGTIAEVTP-EGVVVAC-----GEGALRLTQLQKPGGKRLPVREFLA-GS
FMT_BURM1         --------AAPGTIVEAAP-DGVIVAC-----GTGALRVTQLQKPGGKRLPAREFLA-GS
FMT_BURTA         --------AAPGTIVDAGA-DGVVIAC-----GEGALRVTQLQKPGGKRLPAREFLA-GA
FMT_RALPJ         --------AEPGVVLAANA-EGVTIAC-----GAGALRVTQLQKPGGKRLPAREFLQ-GL
FMT_HERAR         --------WPAGQVISANAQDGVVIAC-----GDGALRVTELQKPGGKRLPAAEFIK-GF
FMT_JANMA         --------LPPGQVIAANPHDGVLVAC-----GDGALRVTELQKPGGKRLSAVEFLK-GF
FMT_CHRVO         --------AEPGAVVSADA-DGVLVGA-----GQGLVRVSVLQAAGGKRLAARDFVA-GK
FMT_THIDA         --------APPGTVLRADP-AGIVVAC-----GGGALVLHEIQAAGSKRMTAAAFLA-GR
FMT_AROAE         --------GEPGTVLVADA-DGIVVAC-----GTQAVRLAQLQKPGSRRLAAGEFLR-GF
FMT_NEIM0         ---------AAGEVLSCSA-DGLVVAC-----GENALKITELQPAGGKRMSIQAFAA-GR
FMT_DECAR         ---------ETGAILAVDK-NSIIIAC-----GEGALAVTELQKAGGKRLPVQQFLA-GH
FMT_METFK         ---------EPGMIASVD--NGILVGC-----GRGLLRIDELQLPGGKRLQAKDFLA-GN
FMT_POLNS         --------GGAGDVLEFGR-DGAYIQC-----GEGVLEVLEMQKPGGKKMAAKACIQPIG
FMT_POLAQ         --------GPIGAVIGFSE-DGVFVRC-----GDGVIEILEAQKPGGKKMNAKTCLQSVD
FMT_NITEC         --------RQAGEIIAADH-NGIIVAC-----GRDALSINILQKAGGKKLTAAQFLA-GH
FMT_NITEU         --------HQAGKIITVDP-DGIVVAC-----GRDALSIDILQKAGGKKLTAAQFLA-GH
FMT_NITMU         --------EKPGEIVAIRP-DGIVVAC-----GKHALILKIVQKSGGKKLRSAEFLL-GH
FMT_STRM5         ---------APGTVLAASR-DGIDIACGQ-----GALRLRVLQREGGKAITAADYLNARR
FMT_XANC8         ---------APGTLLAASK-QGIDIACGQ-----GALRVRVLQREGGKAITAADYLNARR
FMT_XYLFA         ---------PPGTVLAASK-EGIDVACLQ-----GALRLCRLQREGGKAITAADYLNARR
FMT_HALHL         ---------RAGTVAAVGS-GGIEVATGE-----GRLEITRLKPAGGREQTAADYLNGRR
FMT_GLUDA         --------AVPGTVL---D-DRLTVACGQ-----GTLRLTRIQRPGRGMMEADAFLR-GQ
FMT_GLUOX         --------AAPGTTL---G-ESLTIACGT-----GALRIDRLQKPGRSMMSASDFLR-GQ
FMT_ACICJ         --------GEPGTVL---D-DRLAIACGD-----AAIRPTLVQRAGRAAMQAEAFLR-GH
FMT_GRABC         --------GIPGTVIGIGD-DTLLIACGD-----GALCLDKVQKPGRPALDAAAFLR-GH
FMT_AGRFC         --------GEAGSALD----DALTIACGS-----DAVRLTRLQKAGGKPMSAADFVR-GT
FMT_RHILW         --------GAAGELLT----DDLVVACAS-----GAVRLTRLQKAGGKPLAAADFLR-GT
FMT_RHIME         --------GDPGEVLD----HTLGIACGE-----GAVRLTRLQRAGGKALAAADFLR-GT
FMT_SINMW         --------GAPGQVLD----GSLAIACGE-----GAVRLTRLQRAGGKALPAADFLR-GT
FMT_CHESB         --------GAPGEVID----EGLAIACGQ-----GAVRLLELQRAGGKPVSAADFQR-GS
FMT_OCHA4         --------GEPGTVLD----DRLTVACGE-----GAVRLVTLQRSGGKPLPAQEFLR-GA
FMT_RHILO         --------GESGGILD----DRLTVACGA-----GAIRLVEVQRAGGKPAAASEFLR-GA
FMT_BRADU         --------GAPGEVLD----DQLTIACGE-----GAIRIIELQREGKARMQATDFLR-GV
FMT_BRASO         --------GEPGTVVD----DELTIACAD-----SAIRITELQRAGKSPMKAADFLR-GT
FMT_NITHX         --------GEPGELLD----DRLTIACKD-----GAIRVLELQRAGKPPMKADAFLN-GT
FMT_NITWN         --------GSPGDLLD----DRLTIACKD-----GAIRVLELQRAGKPPMKAAAFLN-GT
FMT_RHOP2         --------GAPGEMLG----DDLTIACAD-----GAIRVLQLQRAGKQPMSADEFLR-GT
FMT_RHOPT         --------GEPGEVID----DHLTIACGD-----GAIRVSQLQRAGKQPMTAEEFLR-GT
FMT_RHOPB         --------GEPGTLLD----DRLAIACGD-----GAIRILQLQRAGKQPMQAQDFLR-GT
FMT_OLICO         --------GAPGALLD----DRLTIACGE-----GAIRLLDVQRAGKQPMRALDFLR-GT
FMT_METS4         --------GAPGTLLD----EAGTVACGE-----GALRLLRVQPAGKAAMEAADFLR-GR
FMT_PARL1         --------GEPGKVLDA-G-ESIIIACGE-----GALEISGLQRAGKAAVTARDFLR-GF
FMT_CAUVC         --------GVAGTTLD----DALLIACGE-----GSIRLLKAQREGKGVQDAQTFTR-GF
FMT_CAUSK         --------GAPGVALD----DALLIACGAN-GEGGAVRLLKAQREGKGAQDAEVFLR-GF
FMT_PHEZH         --------GPAGETLD----DRLLVGTGH-----GAVRLLRVQREGRGPQDAEAFLR-GT
FMT_RUEPO         --------GTPGEVLDDA----LTIACGT-----GAISLIRLQRAGKAAQDADIFLR-GW
FMT_RUEST         --------GAVGTVLDDK----LTVACGS-----GAVELLRLQRAGKAAQDREVFLR-GF
FMT_DINSH         --------GAAGQVLEG-----FTLACGV-----GAVEITRAQRAGRKAADAAEILR-GM
FMT_ROSDO         --------GVPGTVRLNP----LRVVCGT-----GAVELTQVQRAGKAVQSAADFLN-GS
FMT_JANSC         --------GALGEVLHG-----LTVACGD-----GAVEISRVQPEGKGAMDAKDWLL-GA
FMT_RHOS1         --------GAPGAVLPG-----LTIACGT-----GAVEITLAQREGKRPMEPEEFLR-GF
FMT_RHOS5         --------GAPGELLEG-----LVIACGS-----GAVEITLAQREGKRPMERDEFLR-GF
FMT_PARDP         --------GAPGRVLSG-----FTIACGE-----GAVEVLEAQREGKRPMPAAEILR-GM
FMT_NOVAD         ---------EPGVTVD----DVLAIACGT-----GAIRPTLIQRAGRPAMDTASLLR-GR
FMT_SPHWW         --------EAPGAVID----DALTIACID-----GAIRPTRVQRAGKAAMSAGELLR-GF
FMT_SPHAL         --------AAPGVTID----DRLAIACNP-----GAIRVTRIQRAGKPAMEAGEMLR-GR
FMT_ZYMMO         ---------AVGETLD----DHLLIGCGS-----DSLQPVIVQRAGRKAMKLEDMLR-GF
FMT_MAGSA         ---------APGTVLD----DQLTIACGK-----FALRPLKVQRAGKAPMTASEMLR-GH
FMT_BARQU         --------REIGWIE---P-NSLIIHCGQ-----GRIEITSLQKSGGKILDSAAFLR-GA
FMT_BART1         --------LEIGRIE---P-NSLIVHCGQ-----GRIEITTLQRSGGKILDSATFLR-GA
FMT_BARHE         --------LEIGRIEKG-P-DSLLIHCGQ-----GCLEVTYLQRSGGKVLECATFLQ-GA
FMT_BARBK         --------LGIGRIE---A-GHLIIHCGQ-----GRIEITHLQRAGSRILDSSTFLR-GA
FMT_MAGMM         --------GTPGEVIEVEK-DGFVVACGD-----GALRVAQVQAAGKKRMSSGEWLR-GH
FMT_SYMTH         --------AEPGTVVALVRREGFTVAAGD-----GALLVREVQPHGKARMDAQSFVN-GG
FMT_BDEBA         --------AKPGTITAVHE-DHISVATGD-----GVLQLFEVQPESRNRMAIADFLK-GH
FMT_TRIV2         PDLS-QISGSPGEVVSITKGVGAIAQTGE-----GLLLLREVQLPGKRPQSGWDFVN-GT
FMT_TRIEI         SSES-EVVGNIGEVVKVIKGLGPVVQTGS-----GWLLLWQVQLAGKKVVSGWDFAN-GT
FMT_GLOC7         TTLS-SLTSSPGEVVNLIKNLGPIVQTGE-----GLLLLLQVQLSGKRPQSGWDFVN-GT
FMT_MICAN         KDLS-HLSGEVGSIVALWKNFGPVVQTGE-----GLLLLKEVQLSGKSPRSGGDLVN-GS
FMT_SYNP2         KEFV-GNTGKVGEIVAIAKKFGPIIQTGD-----GLLLLKQVQPSGKKPQSGWDMVN-GM
FMT_SYNY3         LNYS-LEAGEPGNIIGTIKNWGPVLETGN-----GHLLLEQVQPPGKKPQSGWDFIN-GN
FMT_SYNP6         QDWQPDPAAQPGTVLAIAKSLGPIVATRE-----GALLLLQVQPAGRKPLSGWDWAN-GL
FMT_THEEB         VREP-EAAAPPGTVLALIKGWGPVVQTGK-----GPLLLSQVQLSGRKAQSGWDFVN-GV
FMT_GLOVI         -----SEQFQPSAIIHVIKSKGFEVVTGD-----GALLLTRVQPAGGKEQPAWDYAN-GC
FMT_SYNJA         ------PPGSPGEVVGLARGEGVYVATGE-----GSLLIRRAQLPGRKEQSACDLVN-GG
FMT_DEIRA         --------GQPGKVLQVGAG-GLTVACGE-----GAVCIATVQPEAKKAQPAQVWAQ-GQ
FMT_THET8         --------GEPGVVARVGPE-GVVVGTAS-----GLLLLLEVQPEGRRAMPAADWAR-GY
FMT_ROSCS         ---------APPGTLLDTAEG-LAVATGD-----GLLVLETVQPAGKRPLPAADWRR-GV
FMT_ROSS1         ---------VPPGTLIDTADG-PAVATGN-----GLLALITVQPAGKRPLPAADWRR-GL
FMT_CHLAA         ---------VPGTVIGRSGSGHPLVQTGS-----DALELIEVQPASRRPMSGSAWLA-GV
FMT_HERA2         ---------IQPGTLFE-QQGQILVATGS-----GALELLEVQPAGKRPMAANDWRR-GA
FMT_DEHMB         ---------LKPSEVRVYEQSRVMVGSAS-----GELEIIRLQLEGKAGCSAADFVR-GQ
FMT_AKKM8         ------AEGKPGQVLSAGEQGLLIACGSG------GLLVTDVQLEGSTRMNISQLIAGHP
FMT_DESVV         ------QPAVPGTIVGLVDGAIAFACADR------TYLVRTIRPADKKPMTGEAFWCGYL
FMT_MYXXD         ------GSGAPGTVLASGPDGIEVACGEG------SLVLLDLQPEGKRVMRAADFLQGHK
FMT_SORC5         ------GGAPPGTVVMAGRSVVVVACGAG------AIQIVRAQVEGRKPLAAADLVAGRT
FMT_ANASK         ------PAGEPGEAEVVPGRGLAVACGGGT-----ALLVTRVQLEGRPAQSALDLANGLR
FMT_KORVE         ------ATLEPGELRIEGENLLVGAGHNT------ALELLEIQLEGKKRMPARDFINGYR
FMT_SOLUE         ------AAQAAAPGAVLRTRPLLVASGEG------ALELLEVQQEGRKRIPAADFANGQR
FMT_GEOBB         --------GAPGEILSCGRDGIEVACGTG------SLVIAELQLEGKKRLPAGDFLAGYK
FMT_GEOUR         --------GTPGSVIRAGREGLEVACSGG------SIVIEELQLEGKKRLHAGDFLAGYK
FMT_GEOMG         --------GKPGDIMAVGKDGIIVGCGSG------SLRIEELQLEGRKRLSAQDFLAGCR
FMT_GEOSL         --------GEPGEILRVGREGILVGCGSG------SILIQELQLEGRKRLPTAEFLAGFR
FMT_GEOLS         --------GTPGTIIATGKNGIEVACGHG------SLIIHELQAAGSKKMDAASFLAGHP
FMT_PELPD         --------GAPGTVLCSTGGQLEVACLDG------SLLIQELQLAGKKRLDSASFLAGCP
FMT_SYNAS         -------PGQPGEVGKLTDQGLQVTAGNG------YVVLQDVQMENRKRMNVSDFLRGHK
FMT_DESPS         -------DAQPGAVLRAGRDGLLIATGKN------CLLVKEIQPEGKKRMTVEAFLCGAK
FMT_DESRM         ------IDADPGTVLEVSPSGILVQTAGG------QILIKELQLQGSRRMEVTEFLRGKQ
FMT_PELTS         ------AALKPGQVMSAGRNAIVVGTGRG------RIAVTELQLQGARRLSAGDFLRGTP
FMT_MOOTA         ------IGR-AGRVVEVGREGFVVQAGTG------RLLVTSVQPPGKKIMPASAYLQGYP
FMT_HELMI         ------SAAHPGEILQIVGDEVAVATGAG------VYWLSEVRPAGGKTMTAGAYARGRR
FMT_NATTJ         ------SNSKPGEIIEINQQGPVVKCCQG------SVILTKIQPSGKKAMTGEQFIRGYD
FMT_METI4         ------AKGMPGEVVRIDRHGILVAAGRSG-----GLLLREVQLEGRKRMHAADFARGAR
FMT_RHOBA         ------YAADASNIGRVMEHEGLAIGCGDG-----QVVIERLQPAGKKEMSGLDFKRGHR
FMT_FRAAA         ----VPDELAPGRLVALADGAVAVGTGTA------PVLLDEVRPEGRGPMKAADWARGAR
FMT_FRACC         PAGLPAGGLPAGQIMVLPGGDVAVGTGTS------PVLLGEVRPEGRGPMAAAAWARGVR
FMT_FRASN         -----HPPLPSGRLAAPERGLVLVGTATT------PVVLDEVRPEGKAPMPAADWIRGLR
FMT_SACEN         ------LGLAPGEIRVERRR-VLAGTGSA------PVALGEVQAQGKKRMAATDWARGSR
FMT_SALTO         ------PELRPGELLVEKSR-VLAGTAST------PVQLGEIRAAGKKAMPASDWARGVR
FMT_STRCO         ------SDLAPGQLAAGKNN-VYVGTGSH------AVELLWVQAQGKKPMRAADWARGAR
FMT_STRGG         ------TDLAPGELSAAKNN-VYVGTGSH------AVELLWVQPQGKKPMRGADWARGVR
FMT_STRAW         ------TDLAPGALSVGKNN-VYVGTGSY------AVELLWVQAQGKKPMRAADWARGVR
FMT_THEFY         ------APLPPGQLVATSRD-VLVGTATH------PVRLGEVQPQGKKAMPAADWARGAR
FMT_MYCBP         ---RPSKPLPPGGIHVERTS-VWIGTGSE------PVRLGQIQPPGKKLMNAADWARGAR
FMT_MYCLE         ---RLLKPLLPGGIHVDHKS-VWIGTGSD------PVRLSKVQPQGKKFMNAVDWAHGAR
FMT_MYCPA         ---APPEPLPPGAIHVDRKS-VWVGTGSD------PVRLGQIQPPGKKFMNAVDWARGAR
FMT_MYCUA         ---EPPGPLPPGAIQVDRKH-VWVGTGSE------PLRLGQVQPPGKKLMNAADWARGAR
FMT_MYCS2         ------GPLAPGEIRVGRNS-VHVGTGSH------PVRLGQIQPPGKKLMNAADWARGAR
FMT_MYCSS         ------EPLAPGAIRVLKNA-VHVGTATE------PVRLGTVQPPGKKPMNAADWARGAR
FMT_MYCGI         -----PKDLEPGEIRVGKKH-VHVGTATD------AVLLGTVQPPGKKSMNAADWARGAR
FMT_MYCVP         -----PKGLEPGEIRVDKKH-IHVGTGSD------AVLLGTVQPPGKKPMNAADWARGAR
FMT_MYCA9         -------QLPPGAVAVRKRD-VLVGTGTT------AIALDEVQPQGKKVMKAADWARGAR
FMT_NOCFA         --------LPERVIEVRKSG-VFVGTATT------AVRLDKVQPQGKKMMPALDWARGAR
FMT_NOCSJ         -----SQGLGPGELGVGKHD-VLVGTGTT------AVRLGDVRPHGRKQMAAADWARGAR
FMT_ACIC1         LAPGEIRVLAPGEIRVERDR-VLVGTATT------PVILGTVQPAGRRAMPAEAWARGAR
FMT_KINRD         --------VPAGRIAVERKR-VLVGTAQG------SVVLGTVQPAGKKAMSATDWARGTR
FMT_PAEAT         ------KDLPPGSIRVDGKS-VLVGTGSH------AVELGRVQPAGKKMMPPADWARGLA
FMT_ARTS2         ------PALQPGQVLLDGKS-VLVGTGSH------PVELTRIQPSGKKMMAAADWARGQV
FMT_RENSM         ------RELAPGQLAQAGKS-LLVGTGSH------AIELLAVQPAGKKMMDAADWLRGVG
FMT_CLAM3         ------APLDPGRIESVGGA-VMVGTTSH------PVELIQVQPAGKKPMPAADWWRGVT
FMT_CLAMS         ------APLEPGRIAALDGR-VAIGTASH------PVELIQVQPAGKSPMPAADWWRGVT
FMT_LEIXX         ------GVLPPGAVVADGKR-ILAGTGSR------PLELVTVQPAGKRVMAAADWWRGAG
FMT_CUTAK         ---STVATAQPGQLVATRKQ-LFLGTGSQ------PLELLQVQAFGKRAMSGADWARGAD
FMT_BIFAA         ---NAPASLEPGHIVAGKKN-VWVGTSTE------PLELLEVKAQGKKAMRAADWARGAH
FMT_BIFLD         ---NTPAELQPGELKVGKKN-VWVGTGST------PLELTQVKAQGKKAMRAADWARGAR
FMT_COREF         ------PTLNPGALHATRDA-VYVGTGST------PVALGQIQPPGKKMMNAADWARGVH
FMT_CORGB         ------ADLAPGAILAQKNS-VVVGTGTT------PIVLGNIQPPGKKMMNAADWARGVQ
FMT_CORDI         ------SDLQPGHMRIEKNR-VLVGTGDL------NIELDQIQPQGKKRMKASDWARGLQ
FMT_CORJK         ------AELGPGEVVASPKK-VFVGTGTG------PLEITRIQPPGKKMMEAAAWARGQQ
FMT_CORU7         ------PELAPGQLWADKTR-VLVGTGDT------PLLVETIQPPGKKMMRAADWARGQQ
FMT_RUBXD         ------RELAPGELRAGDGR-LFVGCESG------VVEILELQLPGGRRLGAAEFLRGHS
FMT_BACFN         ----------PGSIVTDGKNFLRVAVPDG------FVNVLSLQLPGKKRLKTDELLRGFH
FMT_BACTN         ----------VGTVVTDGKKYIKVAVPDG------FVSVLSLQLPGKKRLKTDELLRGFR
FMT_BACV8         ----------IGDIRTDMKTYFQVAVKDG------FINVLTLQLAGKKRMNVADFLRGYR
FMT_PARD8         ----------VGSIHTDHKSYIDVAVKDG------FLRLRSLQLAGKKRMNITDFLNGFK
FMT_AZOPC         ----------VGTIVSDKKVYIDVRTKDG------FIRLRNVQLAGKKRMPVTDFLKGNA
FMT_PORG3         ----------FGSIIWDKK-NLDVMTRKG------VIRILSLQMPGKKQMDAASFLNGFA
FMT_CHLCH         ---------PAGSLLVSHG-KLYVHGSDG------WLELLALQLEGRKPMEAADFARGLH
FMT_CHLPD         ---------QPGSILVERG-RFLVRGSDG------WLEVKQLQPEGRKPMEGAEFARGFR
FMT_CHLL2         --------REPGLVYIDDS-RLLVGTVDG------WISLQQLQLEGKKIMEAQEFLRGFR
FMT_PELLD         ---------APGSLLIDDG-RLYARGTDG------WIELLLLQLEGKRPMEAPEFVRGFR
FMT_CHLPM         ---------KPGTMLIEGG-CLYASGTDG------WIEILSLQLEGKRPMDAGEFLRGFR
FMT_CHLPB         --------KVPGALVVDGT-RMFVMALDG------WVEILSLQMEGKRKMGAADFCCGFR
FMT_PROA2         --------AIPGRIAVENN-RLFVMGLDG------WIEILSLQMEGKKVMQSHEFCCGFR
FMT_CHLTE         ----------PGTLRIADG-RLLVAGTDG------WIELLSVQAEGKKAMDGELFARGLR
FMT_CHLAB         ----------PGDILLSDQQELLVACAEG------AICLKEIQPEGKGVMDSKSFLNGHS
FMT_CHLCV         ----------PGDVIVSDQQELLIACAEG------AICLKEIQPEGKGAMDSKTFLNGHS
FMT_CHLPN         ----------PGTVVVTDRQELAIACSEG------AICLHEVQVEGKGSTNSKSFLNGYP
FMT_CHLMU         ----------PGEVLGVSGEDLLVACRQG------VLRLCIVQPEGKVFMKAKDFFNGQS
FMT_CHLTA         ----------PGEVLGVSGEDLLIACRQG------ALRLRMVQPEGKALMKAKDFFNGQS
FMT_PARUW         ----------PGTILDSSKGNLKILTGDQ------ALELVEVQLEGKKTMTSEQWIRGMS
FMT_BORAP         ----------VGEIVDFDSEKGLFVNTGEG-----ILLLLEVQRPGRRVLDYKSFYNGSR
FMT_BORBP         ----------VGEIVDFDPERGLFVNTGKG-----ILFLLEVQRPGRRVLDFKSFYNGSR
FMT_BORHD         ----------IGKIILFDPSRGILVKTGDG-----ILLLLELQRAGRKVMDYKSFYNGNR
FMT_BORRA         ----------IGKIIAFDPSKGLLVKTGDG-----ILVVLELQRIGKKVLDCVSFYHGNR
FMT_TREDE         --------KKFGTILGTDKKCGILIQTGNG-----ILAVSVLQKQAKKKLEWKDFLNGSP
FMT_TREPS         ----------VGTVLAADKN-GVFVQTGDG-----VLSLLQLQRSGKKPLFWRDFLNGSP
FMT_LEPBL         ----------PGKLKRLDKKGLLTQCGDGR-----FLEILELQPENKNRMSASDFLNGFR
FMT_LEPIC         ----------PGKLKRLDKKRLLTQCGDGR-----FLEILELQPENKNRMTASDFLNGFR
FMT_ELUMP         --------PRGSVVSIENDGR-ILVKCYDS-----CIYIDIVRPAGKKDMTAASFANGHK
FMT_UNCTG         --------DSGIVYSAEKNRG-FTVSCAVG-----RILVVKMQSENKPVVSAWDFIQGRQ
D1B5G6_THEAS      --------PPGAHYVRDSLP--CVVCGDGS-----GLVLLEVQPEGKRPMESASWLKGLR
FMT_COPPD         --------P--GHYVAEKES--LYVGTGQG-----SLEILSLQQEGRKKQDAASFVKGLR
FMT_THEAB         --------EYGKVLKINNEGG--FISAKGG-----IVGIKYIQFPGKKPITFLDAKNGGL
FMT_THEM4         --------EIGKIISIDKEGA--LISCENG-----SVKVRYIQFPGKRKMTFFEAKNGCL
FMT_FERNB         --------EPGTVVRIEKQSGDGVIKTIDG-----LLHIKYIQFPGKNKITFLSAKNGGL
FMT_THEMA         --------EPGLINYIDREGA--WIGTGDG-----KVKVRYIQFPGKKKMTFWEAKNGRL
FMT_PSELT         --------EPGTIVHIDDKGA--YVTTSDG-----IIVISQIQFPSKKKMSFLSALNGRM
FMT_MESFL         ---------KPGTIVNISENGIDIQTKDGQ------VQILLIQKPGKKMMEASSYKLNNL
FMT_MYCMS         ---------IPGTILGINKQGIVVKTLDKA------LLILEIQKEGKKMILASNYYLNKL
FMT_UREP2         ---------KPGTIM-IFKNQLFVSTQDFD------IELLLIQLPNKKP-LSPKVLLNGK
FMT_UREU1         ---------KPGTIA-ISKHQIFVSTQDFN------VELLLIQLPNKKP-LAPKALLNGK
FMT_MYCPE         ---------APGTINNISKEGILISTKDFD------ILVKEVQIEGKNR-QEVKNILNGN
FMT_MYCPU         ----------------LVKNAFVVEVQGQK------IYCYEYQFEGKKRVKLNFNLLFFN
                                                                              

FMT_BACVZ         -NVQPGDVLGEANEEN-----------
FMT_BACSU         -HVEAGDVLGVNNEKN-----------
FMT_BACLD         -GLQAGMKLGHDDEK------------
FMT_BACP2         -NIEIGQKLGLMNEEK-----------
FMT_BACCN         -KLEIGMKLGEDA--------------
FMT_BACMK         -KPEIGTKLGENA--------------
FMT_GEOTN         SRLAVGTKLGENNERT-----------
FMT_BACHD         SQLSVGSVLGGQDGS------------
FMT_OCEIH         DRIKIGIKLGE----------------
FMT_STAAW         NTL-VGKKLI-----------------
FMT_STAEQ         ESL-VGKVLL-----------------
FMT_LYSSC         SKLQIGDQFK-----------------
FMT_LISMF         RNLSKTTRFGE----------------
FMT_BACSK         HPFQVGKRLGEGHE-------------
FMT_LACBA         DALTVGEQVAE----------------
FMT_PEDPA         ENLHPGKQIIDNDKSK-----------
FMT_LACPL         DKFATGEQVINK---------------
FMT_LACF3         QNLKPGVQAINND--------------
FMT_LACS1         QGLKIGQRIIEDEE-------------
FMT_LACCB         QQLVSGQQVITDDPE------------
FMT_LACSS         KQLAVGQQVVVQDAE------------
FMT_ENTFA         QNVAEKDKVD-----------------
FMT_LACAC         SKFVTGEEIVDK---------------
FMT_LACJO         SHFTIGDKIIDE---------------
FMT_LACDB         KKFAAGEKIVDED--------------
FMT_STRA5         RNLEIGDKFGE----------------
FMT_STRT1         RNLEVGDVFGQ----------------
FMT_STRGC         RNLAVGDKFGN----------------
FMT_STRP4         RTLTVGERFGD----------------
FMT_STRS2         RDIAVGDQFGDQ---------------
FMT_STRSV         RSLSLGDTFGK----------------
FMT_STRMU         QKLKVGDYFGK----------------
FMT_STRPM         RKLEVGDFIGR----------------
FMT_LACLA         QKIQVGDKFGD----------------
FMT_ALKMQ         IEKGVLLGEEDGN--------------
FMT_ALKOO         IEKGNILGE------------------
FMT_CLOD6         IETGLVLG-------------------
FMT_CLOB8         IEENIILQ-------------------
FMT_CLOBB         IDKDIILGE------------------
FMT_CLONN         IEIESVLK-------------------
FMT_CLOPS         IEVGKVLK-------------------
FMT_CLOTE         IEKGIILE-------------------
FMT_CLOAB         IDKGVILK-------------------
FMT_HUNT2         VGEGEVLGQ------------------
FMT_CALS4         IPEGTILK-------------------
FMT_THEYD         INEGMDSFS------------------
FMT_AQUAE         PQLYEPFNSE-----------------
FMT_HYDS0         NQVKKFY--------------------
FMT_FUSNN         LKIGEKLC-------------------
FMT_SULSY         IKAGERFE-------------------
FMT_DICT6         LNIGERFE-------------------
FMT_DICTD         LNIGERFENS-----------------
FMT_CARHZ         PLVGETFEC------------------
FMT_SYNWW         LHPGVLLGSKEG---------------
FMT_ANAPZ         GKSMPVVS-------------------
FMT_ANAMM         GCVSNVLQR------------------
FMT_EHRCJ         VLNCSIA--------------------
FMT_EHRCR         ISNSSIT--------------------
FMT_EHRRW         VKDYSIT--------------------
FMT_WOLPM         SSMVKKFIE------------------
FMT_WOLPP         SSLTKKFIE------------------
FMT_RICCK         ILKATVLK-------------------
FMT_RICTY         ILKDTILK-------------------
FMT_RICBR         TPVINKVQ-------------------
FMT_ORITB         ILPDTVLQ-------------------
FMT_BLOFL         SLFTMHSVLT-----------------
FMT_BLOPB         EWFKPNSVLE-----------------
FMT_WIGBR         KLFITGNIIQ-----------------
FMT_BUCAI         KLFKIGTIL------------------
FMT_BUCAP         HWFHIGKII------------------
FMT_BUCBP         KWCIPGTKLTNT---------------
FMT_FRAP2         LDKYIGYKIG-----------------
FMT_FRATN         LDKYIGYKLG-----------------
FMT_PROM9         PSLGEYLSN------------------
FMT_PROMS         PSVGEYLSD------------------
FMT_PROM2         PSVGEYFLD------------------
FMT_PROM5         PLIGEKFSD------------------
FMT_PROMP         PVIGENFSD------------------
FMT_PROMA         LTNSQNKLGE-----------------
FMT_PROM4         LSIGIRFD-------------------
FMT_SYNPW         AQPGDSLGLAAKP--------------
FMT_SYNSC         ATLGDRFGEV-----------------
FMT_SYNPX         AAEQQSIGDN-----------------
FMT_SYNS3         AAAEQQFGTFS----------------
FMT_SYNS9         ASVGDRFQSF-----------------
FMT_SYNR3         ---------------------------
FMT_PROMM         ATVGQGLGVGFNI--------------
FMT_PROMT         LSINDKLGI------------------
FMT_PELUB         IIKGSRITNV-----------------
FMT_CAMJ8         LKSEDSLC-------------------
FMT_WOLSU         LGVGDILF-------------------
FMT_CAMFF         LGVGSKFC-------------------
FMT_HELAH         LKAGDILA-------------------
FMT_HELPY         LKIGGILA-------------------
FMT_SULDN         LNIADTLS-------------------
FMT_CALS8         IKKGDILS-------------------
FMT_ECOLI         EWFVPGNRLV-----------------
FMT_SALDC         EWFIPGNRLA-----------------
FMT_KLEP7         EWFIPGTRLA-----------------
FMT_ENT38         EWFTPGTRLA-----------------
FMT_CROS8         EWFTPGAILA-----------------
FMT_YERE8         EWFTLGNQLA-----------------
FMT_YERPY         EWFIPGSQLV-----------------
FMT_SERP5         EWFTPGNRL------------------
FMT_ERWT9         EWFTPGNIIA-----------------
FMT_PECAS         EWFVPGNTLN-----------------
FMT_SODGM         ESFIPGTVLD-----------------
FMT_PHOLL         EWFTPGNKIN-----------------
FMT_PROMH         DWFTPGKIIQ-----------------
FMT_ACTP2         DWFAVGKQL------------------
FMT_HAEDU         NWFSLGKKL------------------
FMT_ACTSZ         DWFQAGNVLS-----------------
FMT_MANSM         DWFVLGQVLN-----------------
FMT_HAEIE         EWFAIGKVLA-----------------
FMT_PASMU         EWFPVGKVL------------------
FMT_HISS2         DWFKIGQVL------------------
FMT_VIBPA         AWFEVGTLLV-----------------
FMT_VIBVY         AWFEVGSVLS-----------------
FMT_VIBC3         DWFSVGSQLS-----------------
FMT_ALIFM         EWFEVGNTLN-----------------
FMT_PHOPR         EWFELGTQL------------------
FMT_AERS4         DWFEPGTQLN-----------------
FMT_SHEAM         DWFTPGTLLASPEASE-----------
FMT_SHEON         EWFTPNTRLNNEAQ-------------
FMT_SHEDO         DWFAQGLSLLPEASS------------
FMT_SHEFN         DWFTAGVCLNQEAN-------------
FMT_SHEPA         DWFTPGTVLASTD-------NQEA---
FMT_SHEPW         DWFTAGTQLNNAM-------GDQG---
FMT_SHESH         EWFTPGTLLNSKKLIGKEPAVKEAE--
FMT_SHEWM         EWFTPGTVLNS---------TKEAE--
FMT_SHELP         DWFTPGTQLQGVTPADEAQA-------
FMT_PSYIN         ELFAQGTLLQQG---------------
FMT_PSEHT         DWVTPGTILGENNE-------------
FMT_COLP3         DWFVVGSTINKLG--------------
FMT_PSEA6         DWFSVGTILS-----------------
FMT_IDILO         NVFSPGLELQ-----------------
FMT_PSEE4         EKFAGGKVLGQ----------------
FMT_PSEPF         EKFATGIVLGAAVDAQ-----------
FMT_PSE14         EKFAIGTVLGQ----------------
FMT_PSEA7         EQFAAGQVLGQ----------------
FMT_PSEMY         EQFAPGLVLGQ----------------
FMT_PSEU5         EQFAPGLVLGQ----------------
FMT_CHRSD         ERFPEGLRLGQEDRA------------
FMT_HAHCH         PLMQLGQVLEITS--------------
FMT_ALCBS         TLFSVGEPLGDAIINESGDHSGNA---
FMT_ACIAD         --LNIGQVLA-----------------
FMT_ACIBS         --LHVGQILP-----------------
FMT_COXB1         DKLIPGKTVFG----------------
FMT_METCA         ---LAGKRLGT----------------
FMT_LEGPC         TQLHTGLMLQ-----------------
FMT_ACIAC         PLAPGMVLGGGAGA-------------
FMT_ACISJ         PLAPGMVLGAAP---------------
FMT_DELAS         DLPEGAVLDGAASGGTP----------
FMT_POLNA         DLQAGQLFDLPNP--------------
FMT_VEREI         ALQPGMWLGAARA--------------
FMT_METPP         TLQVGATL-------------------
FMT_RHOFT         DLQPGMVFERHGS--------------
FMT_BORA1         QPA------------------------
FMT_BORPD         QPPAHPLKSE-----------------
FMT_BORPE         QP-------------------------
FMT_PARP8         TLAAGQRFELAQPQ-------------
FMT_PARXL         TLAVGQRFQLPEAK-------------
FMT_BURM1         PLAAGQRFALPDAG-------------
FMT_BURTA         PLAVGQRFSPPDTAA------------
FMT_RALPJ         AIQPGQRFASRG---------------
FMT_HERAR         ALE-AQRFQ------------------
FMT_JANMA         TLE-DKRFQ------------------
FMT_CHRVO         SLPAGTRLGV-----------------
FMT_THIDA         ALSAGTRLGA-----------------
FMT_AROAE         PVSAGERFEAAAR--------------
FMT_NEIM0         TIEVGTVL-------------------
FMT_DECAR         PLAVGDRFDIPA---------------
FMT_METFK         PLCPGDRFGS-----------------
FMT_POLNS         AGEKLLHFQLKE---------------
FMT_POLAQ         APEKLLCFQTKA---------------
FMT_NITEC         PLQPGEHFQKTTQGHL-----------
FMT_NITEU         PLHPGESFHKATQDNQGASET------
FMT_NITMU         SLHPHDRFESGE---------------
FMT_STRM5         DLRVGA---------------------
FMT_XANC8         DLPALR---------------------
FMT_XYLFA         DLQVRA---------------------
FMT_HALHL         LVPGEPVQ-------------------
FMT_GLUDA         PVPVGTRLGS-----------------
FMT_GLUOX         PVPKGTRLV------------------
FMT_ACICJ         PVAIGTRLG------------------
FMT_GRABC         KLPAGTRLDEHGFS-------------
FMT_AGRFC         PVPATTRLG------------------
FMT_RHILW         PLAAGMRLS------------------
FMT_RHIME         PIAAGARIA------------------
FMT_SINMW         PIVASAGIG------------------
FMT_CHESB         KLGRGTRLT------------------
FMT_OCHA4         QVSKVL---------------------
FMT_RHILO         KIVKGMKFS------------------
FMT_BRADU         PLKAGAKFT------------------
FMT_BRASO         RVAPGLRFG------------------
FMT_NITHX         PLKPPMRFA------------------
FMT_NITWN         PLTPPLRLD------------------
FMT_RHOP2         PIAKGVRVSSS----------------
FMT_RHOPT         PIAKGVRVG------------------
FMT_RHOPB         PLQPPLAVC------------------
FMT_OLICO         PLIPPLSVM------------------
FMT_METS4         RLEPGTRLA------------------
FMT_PARL1         ALKPGESVA------------------
FMT_CAUVC         PIATGTVLA------------------
FMT_CAUSK         PLAAGTALA------------------
FMT_PHEZH         AVPAGVKLS------------------
FMT_RUEPO         PVPKGTRL-------------------
FMT_RUEST         TLAKGTNLLTAQDAE------------
FMT_DINSH         TLPARLD--------------------
FMT_ROSDO         AIEDGTLFKGKS---------------
FMT_JANSC         RIAPGTVLE------------------
FMT_RHOS1         PLPEGSRAHTA----------------
FMT_RHOS5         ALPRGSLATAS----------------
FMT_PARDP         ALPDRLD--------------------
FMT_NOVAD         AIPGGTRLG------------------
FMT_SPHWW         AIPAGTQLASPPRT-------------
FMT_SPHAL         GIAKGTRLA------------------
FMT_ZYMMO         AIPRGTRLS------------------
FMT_MAGSA         AIPKGTVLG------------------
FMT_BARQU         RLSTVF---------------------
FMT_BART1         HISAVF---------------------
FMT_BARHE         HISAVF---------------------
FMT_BARBK         NISAVF---------------------
FMT_MAGMM         GVKQGERL------------GEG----
FMT_SYMTH         GVQVGTRFSPPEAPQREPAPGEA----
FMT_BDEBA         ALKVGDQLGV-----------------
FMT_TRIV2         RLTVGEVLGNGS---------------
FMT_TRIEI         RLLVGEVSEVFSR--------------
FMT_GLOC7         RLSVGEKFLMV----------------
FMT_MICAN         RLTIGEIFVQ-----------------
FMT_SYNP2         RLTVGESLG------------------
FMT_SYNY3         RSTISFA--------------------
FMT_SYNP6         RLQEGLSLLE-----------------
FMT_THEEB         RLAIATQFAIVPSAL------------
FMT_GLOVI         RLMPGESLGL-----------------
FMT_SYNJA         QLRVGMRFEVLPDP-------------
FMT_DEIRA         NVEQGARFDLWEPPQG-----------
FMT_THET8         GVAPGTRLGQV----------------
FMT_ROSCS         RLTGGERLGG-----------------
FMT_ROSS1         RLSGGERLGDASARLSGGEAVH-----
FMT_CHLAA         HADN-IRLGE-----------------
FMT_HERA2         KDIEQL---------------------
FMT_DEHMB         RNFDGVNLGV-----------------
FMT_AKKM8         NLKD-------IHFDV-----------
FMT_DESVV         SRCEG----ECPGFAVCEGA-------
FMT_MYXXD         LAPGS----QPFVAG------------
FMT_SORC5         LQAG-------MVLGR-----------
FMT_ANASK         RKR--------FRLGT-----------
FMT_KORVE         PNSA-------DKLGRLSS--------
FMT_SOLUE         LTEN-------EKLGEGHL--------
FMT_GEOBB         LQPG-------GLLGKKDASVGV----
FMT_GEOUR         IAPG-------SILGKKD---------
FMT_GEOMG         LEPG-------IRLGH-----------
FMT_GEOSL         LEPG-------TRLGEAGSVEH-----
FMT_GEOLS         LALG-------TLLMPHEVTA------
FMT_PELPD         IAEG-------TLLGGAATERPIP---
FMT_SYNAS         LSTG-------TVLG------------
FMT_DESPS         IGAE-------TVLKTT----------
FMT_DESRM         MSPG-------TVLGFEGGRGN-----
FMT_PELTS         MPEG-------IVLGEACS--------
FMT_MOOTA         MVPG-------EILGCV----------
FMT_HELMI         IGPG-------FRFG------------
FMT_NATTJ         IKSG-------IQLE------------
FMT_METI4         LAIG-------TVLGQKDEQ-------
FMT_RHOBA         LTAG-------QQLIAP----------
FMT_FRAAA         LTDDDLLHAPAERVSAAGSPAGAGGAP
FMT_FRACC         I-------AKGETLGAIGAMPVSGGTS
FMT_FRASN         P-------GTDEAFA------------
FMT_SACEN         IE-------QGERLK------------
FMT_SALTO         VT-------AGEVLA------------
FMT_STRCO         IT-------EGERVGD-----------
FMT_STRGG         IA-------HGELLGP-----------
FMT_STRAW         IT-------DGEPLGA-----------
FMT_THEFY         IG-------DGERFGDD----------
FMT_MYCBP         LD-------LAARAT------------
FMT_MYCLE         LD-------PAARAS------------
FMT_MYCPA         LD-------PAARAT------------
FMT_MYCUA         LD-------PSVRAS------------
FMT_MYCS2         LE-------EPVSAS------------
FMT_MYCSS         LD-------ASVSAQ------------
FMT_MYCGI         AE-------DIRRAR------------
FMT_MYCVP         LD-------ENGWAR------------
FMT_MYCA9         LD-------AEVHAL------------
FMT_NOCFA         LQ-------PGAVVE------------
FMT_NOCSJ         LQ-------TGVRIGVAFGES------
FMT_ACIC1         LA-------PGARFE------------
FMT_KINRD         PQ-------PGEEFS------------
FMT_PAEAT         TP-------ERVVFE------------
FMT_ARTS2         AL-------EGVVFE------------
FMT_RENSM         MV-------DGMVFGE-----------
FMT_CLAM3         TR-------DITAR-------------
FMT_CLAMS         TK-------DVIAR-------------
FMT_LEIXX         GE-------AVLS--------------
FMT_CUTAK         ID-------AGTRLR------------
FMT_BIFAA         LD-------NAFCE-------------
FMT_BIFLD         LS-------PAACVR------------
FMT_COREF         -------LDQEASFE------------
FMT_CORGB         -------LDQEAKFQ------------
FMT_CORDI         -------NTEGLVLS------------
FMT_CORJK         EL-----LAGRPTFSARETGE------
FMT_CORU7         EL-----LAQSPRFDIEEDTAK-----
FMT_RUBXD         LT--------GALRR------------
FMT_BACFN         LT------EAFKMKAV-----------
FMT_BACTN         LS------DGYKMN-------------
FMT_BACV8         TS------DNNKVE-------------
FMT_PARD8         QI------AEYTVG-------------
FMT_AZOPC         YL------LSLHF--------------
FMT_PORG3         LS------SDMYIE-------------
FMT_CHLCH         VE------GEALRLV------------
FMT_CHLPD         PE------SGTSLLFE-----------
FMT_CHLL2         YE------NREQPLLLL----------
FMT_PELLD         PE------VTEPQLV------------
FMT_CHLPM         AE------SGVLFGS------------
FMT_CHLPB         CE------EECPSFS------------
FMT_PROA2         CD------EECPVFS------------
FMT_CHLTE         AR------KEMLRFL------------
FMT_CHLAB         GH------KLKLSLNLMS---------
FMT_CHLCV         NH------KLKLSFQNN----------
FMT_CHLPN         AK------KLKIVFTLNN---------
FMT_CHLMU         RS------VALLF--------------
FMT_CHLTA         RL------VSKLF--------------
FMT_PARUW         KN------QLKFLVN------------
FMT_BORAP         QLIGQVFSSIGGVY-------------
FMT_BORBP         QLIGRVFSSVGGIY-------------
FMT_BORHD         DLIGKIFS-------------------
FMT_BORRA         DLIGKVFS-------------------
FMT_TREDE         DFLEGGFET------------------
FMT_TREPS         LLLTGRLGV------------------
FMT_LEPBL         IQEGETFG-------------------
FMT_LEPIC         IQEGETFG-------------------
FMT_ELUMP         IKPGDVIFY------------------
FMT_UNCTG         ISAGDRF--------------------
D1B5G6_THEAS      LSPGAAWE-------------------
FMT_COPPD         EKEGVFGG-------------------
FMT_THEAB         VKEGDKFES------------------
FMT_THEM4         IKEGECFDC------------------
FMT_FERNB         IKEGMVFRNLD----------------
FMT_THEMA         IIEGMRFERRYES--------------
FMT_PSELT         ----LRVKDRFQS--------------
FMT_MESFL         SDLKVGDCFE-----------------
FMT_MYCMS         SDLKINDKFD-----------------
FMT_UREP2         NPFIN----------------------
FMT_UREU1         NPFSN----------------------
FMT_MYCPE         SEIKIGVTLK-----------------
FMT_MYCPU         SVI------------------------