CLUSTAL format seed alignment for MF_00183

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DXR_HELPY       -------------------------MVVLGSTGSIGKNALKIAKKFG----IEIEALSCG
DXR_HELPJ       -------------------------MVVLGSTGSIGKNALKIAKKFG----VKIEALSCG
DXR_HELHP       -------------------------MILLGSTGSIGTNALEVASHFD----IPIESLCAG
DXR_WOLSU       -------------------------MILLGSTGSIGQNALSLARDFR----LPVEVLVAG
DXR_CAMJE       -------------------------MILFGSTGSIGVNALKLAALKN----IPISALACG
DXR_AGRFC       ---------------MTNASEMPRKLTILGSTGSIGTNTLDVVRQLGGRDGFEIMALTGA
DXR_RHIME       ---------------MASGDDLKRRLTILGSTGSIGTSTLDVIERLGGRDRFEIAALTGN
DXR_CAUVC       ----------------MGALTSPRKVVVLGSTGSIGLSTLSLFEESG--APVQILALTAG
DXR_BUCAI       ----------------------MKKITILGSTGSIGINALSIIQKNP--DLFKVIALVAN
DXR_BUCAP       ----------------------MKKITVLGSTGSIGISTLSIVKNNP--SLFKVIVLVAN
DXR_ECOLI       ----------------------MKQLTILGSTGSIGCSTLDVVRHNP--EHFRVVALVAG
DXR_ECO57       ----------------------MKQLTILGSTGSIGCSTLDVVRHNP--EHFRVVALVAG
DXR_SALTI       ----------------------MKQLTILGSTGSIGCSTLDVVHHNP--DSFRVIALVAG
DXR_SALTY       ----------------------MKQLTILGSTGSIGCSTLDVVRHNP--DSFRVIALVAG
DXR_YERPE       ----------------------MKQLTILGSTGSIGNSTLSVVRANP--ELFKVTALVAG
DXR_HAEIN       --------------------MQKQNIVILGSTGSIGKSTLSVIENNP--QKYHAFALVGG
DXR_PASMU       ----------------MSISYFMKKIVILGSTGSIGTSTLSVITHNP--DKYQVFALVGG
DXR_VIBCH       ----------------------MRKLTILGATGSIGASTLKVIAQNP--QQFSIVALVAG
DXR_NEIMA       --------------------MTPQVLTILGSTGSIGESTLDVVSRHP--EKFRVFALAGH
DXR_NEIMB       --------------------MTPQVLTILGSTGSIGESTLDVVSRHP--EKFRVFALAGH
DXR_PSEAE       -------------------MSRPQRISVLGATGSIGLSTLDVVQRHP--DRYEAFALTGF
DXR_RALSO       ----------------------MMRITVLGATGSIGDSTLDVVRRHP--DRYRVFALTAN
DXR_XANAC       -----------------MAGSSPRQVAVFGATGSIGTSALDVIARHP--ERLRASVLSAG
DXR_XANCP       -----------------MSGSSLRRVAVFGATGSIGASALDVIARHP--ERLRASVLSAG
DXR_XYLFA       ------------------MTKPIRNVAVLGATGSIGAAALDVLARHP--RQFHVSLLAAG
DXR_MYCLE       -----------MNNPIEGHAGGRLRVLVLGSTGSIGTQALEVIAANP--DRFEVVGLAAG
DXR_MYCTU       -----------MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNP--DRFEVVGLAAG
DXR_CORGL       ------------------MGVVTKKILILGSTGSIGTQALDVIADNS--DKFEVVGIAAG
DXR_STRCO       MSDSPAPLADPHLVYDPVAGDGPKDVVVLGSTGSIGTQAIDLVLRNP--DRFRVTALSAN
DXR_TREPA       --------------------MSVRRVVVLGITGSIGAAALKLLRRFP--DRFLLVG-ASG
DXR_DEIRA       --------------------MSGVRLTVLGSTGSIGTQTLDVARQRG----YTVGTLAAG
DXR_NOSS1       ---------------------MVKSITLVGSTGSIGTQTLDIVSQYP--DQFRIVGLAAG
DXR_SYNY3       ---------------------MVKRISILGSTGSIGTQTLDIVTHHP--DAFQVVGLAAG
DXR_BACHD       ----------------------MKGISVLGATGSIGTQTLDVLANHR--DKFRLVAMSVG
DXR_BACSU       ----------------------MKNICLLGATGSIGEQTLDVLRAHQ--DQFQLVSMSFG
DXR_LISIN       ----------------------MKKIILLGATGSIGTQTLTIIRENP--EKFQLVAFSFG
DXR_LISMO       ----------------------MKKIILLGATGSIGTQTLAIIRENP--EKFQVVALSFG
DXR_CLOAB       ----------------------MKNISILGATGSIGTQTLDVIRNDS--EAFKLLAVSAH
DXR_CLOPE       ----------------------MKRISILGVTGSIGTQTLDVLRFHK--EDFELVGITAN
DXR_CALS4       ----------------------MKKLIILGSTGSIGRQTLDVVRSLK--EEFEIVGLTGY
DXR_FUSNN       ----------------------MKKILILGSTGSIGTNALELIRNNR--EQYQVVGISGN
DXR_CHLMU       ----------------------MKRLALIGSTGSIGKQVLQVIREIP--DAFVIETLAAY
DXR_CHLTR       ----------------------MKHLALIGSTGSIGRQVLQVVRSIP--DTFIIETLAAY
DXR_CHLPN       ----------------------MKHLAVLGSTGSIGRQTLEIVRRYP--SEFKIISMASY
DXR_AQUAE       -----------------------MKLGVLGSTGSVGSQTLQVYENFR--DEIELVGILAN
DXR_THEMA       --------------------MEERTLVILGATGSIGTQTLDVLKKVK---GIRLIGISFH
DXR_PELUB       ----------------------MKKIAIFGSTGSIGSSLLKIIKDDQ--KNFKIELLTVN
DXR_MYCPE       ------------MLEGEKMENKKKKVLVFGATGNIGFSSLEIIEKEN----YELVGFSFN
DXR_MYCGA       -----------------------MKILVLGATGSIGKQAIDVICQLK----YQLVGFSYY
                                         : :.* **.:*   : :                  

DXR_HELPY       K-NIALINEQIQVFKPK--KVAILDPSDLNDL-EPLGAE---------VFVGLEGIDAMI
DXR_HELPJ       K-NIALINEQIKVFKPK--KVAILDPNDLNNL-EPLGAE---------VFVGLDGIDAMI
DXR_HELHP       K-NITLLNQQIAHYAPK--NVCIADKNDAHKL-INGNYK---------LFFGSEGILEMI
DXR_WOLSU       H-NLSLLNAQIAEFQPK--IIVIADSSRASELSLPKDSK---------LLFGEEGIIESL
DXR_CAMJE       D-NIALLNEQIARFKPK--FVSIKDSKNKHLV---KHDR---------VFIGQEGLEQIL
DXR_AGRFC       G-NIALLAEQAREFGAQ--LAVTADDDKYEALKSALA------GTGIKVAAGMAGLEEAA
DXR_RHIME       G-NIPLLAEQARRIGAE--LAVTADEDRYGELKDALS------GSGIEVAAGRSGLTEAA
DXR_CAUVC       R-NVERLIEQARRWKPS--LAVIEDESRLDDLRAGLA------GTGVEAAAGADAVRDAA
DXR_BUCAI       K-NFSIMLRQCELFSPD--WVAMRDEKSAHILRKKLKHS----KINTQVLTGEKDICALA
DXR_BUCAP       K-NSSMMLEQCEYFSPD--WAIMKNKKSAHILKKRLKDK----KIKTQVLSGNKAICQLA
DXR_ECOLI       K-NVTRMVEQCLEFSPR--YAVMDDEASAKLLKTMLQQQ----GSRTEVLSGQQAACDMA
DXR_ECO57       K-NVTRMVEQCLEFSPR--YAVMDDEASAKLLKTMLQQQ----GSRTEVLSGQQAACDMA
DXR_SALTI       K-NVARMAEQCLEFSPR--YAVMDDTSSAEQLKIMLQQH----GSRTEVLSGQQAACEMA
DXR_SALTY       K-NVARMAEQCLEFSPR--YAVMDDTSSAEQLKIMLQQH----GSRTEVLSGQQAACEMA
DXR_YERPE       R-NVREMAQQCLEFSPR--YAAMSDEHSAKSLRLLLAEQ----GSDTEVYSGETAACELA
DXR_HAEIN       K-NVEAMFEQCIKFRPH--FAALDDVNAAKILREKLIAH----HIPTEVLAGRRAICELA
DXR_PASMU       R-NVELMFQQCLTFQPS--FAALDDDVAAKMLAEKLKAH----QSQTTVLAGQQAICELA
DXR_VIBCH       V-NVAKMYQLCQQWRPK--YAVMATASAASELQGLLKNQ----AMATEVLYGEEAMCQVA
DXR_NEIMA       K-QVEKLAAQCQTFHPE--YAVVADAEHAARLEALLKRD----GTATQVLHGAQALVDVA
DXR_NEIMB       K-QVEKLAAQCQTFHPE--YAVVADAEHAARLEALLKRD----GTATQVLHGAQALVDVA
DXR_PSEAE       S-RLAELEALCLRHRPV--YAVVPEQAAAIALQGSLAAA----GIRTRVLFGEQALCEVA
DXR_RALSO       T-QVDKLAALCRVFRPA--MAVVGSATAAEVLRDQLGAE----ATGIDIRFGPEALEEAA
DXR_XANAC       S-KVDELLALCATHRPA--HALIADATLYPALRDGLRAR----GLATQAHAGAEALDALA
DXR_XANCP       S-KVDALLALCVLHRPA--HAVIADAALYPALRDGLRAA----GLTTQAHAGDQALDALA
DXR_XYLFA       Q-RVDALLALCHTYRPD--HAVIGDATLYTTLRDGLNAA----GLATKAYAGEAALAELV
DXR_MYCLE       GAQLDTLLRQRAATGVT--NIAIADDRAA----QLAGD---------IPYHGTDAVTRLV
DXR_MYCTU       GAHLDTLLRQRAQTGVT--NIAVADEHAA----QRVGD---------IPYHGSDAATRLV
DXR_CORGL       GSQPDLVISQAQQLGLAADKVAVADAQAAAVISKALGG---------EIISGTDAAKILV
DXR_STRCO       GGRVALLAEQAYRLKAR--TVAVAREDVVPALREALTAQYGTGEPLPEILAGPEAATQLA
DXR_TREPA       HRQTEYARALAREFSLS--DITMTGSCSE--------------------QEGRARIKRLL
DXR_DEIRA       R-NLDLLAEQVREFRPA---LVSVDGSILAEARERLSGV--------RVIADPS----EA
DXR_NOSS1       S-NVEMLAEQIRQFRPQ--IAAISAAEKLPALQAAIKDL----DPQPILLGGEAGVIEVA
DXR_SYNY3       G-NVALLAQQVAEFRPE--IVAIRQAEKLEDLKAAVAELT---DYQPMYVVGEEGVVEVA
DXR_BACHD       K-NLTLAEEQIHQFKPP--LVSVMT---DEDRKTLASKVP---EGTRVVCG-EEGLIEVA
DXR_BACSU       R-NIDKAVPMIEVFQPK--FVSVGDL--DTYHKLKQMSFS---FECQIGLG-EEGLIEAA
DXR_LISIN       R-NIERGRAIIQEFKPK--MVAVWH---TRDRVTLESEFP----DVKFFNG-LDGLREVA
DXR_LISMO       R-NMERGRAIIKEFKPK--MVAVWH---TRDRVTLEAEFP----NVKFFNG-LEGLREVA
DXR_CLOAB       S-NFKKMIEIIDEFKPE--LVVMVDKLAYNKVLDYCCEKK---LKTSVKVG-YEAFNEVA
DXR_CLOPE       R-NIELTLDIIKEFSPK--YVAINHEESYKKLVDLVKSEG---LKCEVIYG-MEGLVKVA
DXR_CALS4       N-NVSLLSKQIKEFRPK--VVAVKDE---EKARKLRENLD---EPIEVLTG-KEGLKEIV
DXR_FUSNN       K-NIDLLKKQIEEFKPI--SIYVGSE---QDAIYLKKEYS---FIKEVYFG-ENGLAELS
DXR_CHLMU       GRNRESLISQIREFSPR--VVAVRDETTYKELRKLFPHI--------EILSGEEGLIAVA
DXR_CHLTR       GRNQEALISQIREFNPR--VVAVREETTYKELRKLFPHI--------EILLGEEGLVSVA
DXR_CHLPN       GNNLRLFFQQLEEFAPL--AAAVYNEEVYNEACQRFPHM--------QFFLGQEGLTQLC
DXR_AQUAE       R-ASEKLLQQAKKYKPK--YVVSYQEPAKEWLESLPEGV--------KYLKGDEGLKAII
DXR_THEMA       S-NLELAFKIVKEFNVK--NVAITGDVEFEDSS-------------INVWKGSHSIEEML
DXR_PELUB       K-NYKKLIKQVKLFNVK--NVIVTDYNSFLITTKLLKNAK-----VKVFNNFDSLNKIFN
DXR_MYCPE       N-NYEKALEIINRFPNA--LVFSPS---------------------VKTKNTVNSFEELL
DXR_MYCGA       Q-NHNEANNILKQLNPN--YVLCHSDP-------------------KYNKNVKSDLIELI
                                                                            

DXR_HELPY       EECTSNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHLLDI-------SQITP
DXR_HELPJ       EECVSNLVINAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHLLDI-------SQITP
DXR_HELHP       ESSHSHLLLNALVGFAGLKPSFKALQCNKKLALANKESLVNAGWLLQN-------ADITP
DXR_WOLSU       HLAQSSFVLNALVGFLGLRPTLESLRLGKTLALANKESLVAGGSFVDA-------SKIIP
DXR_CAMJE       TECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLKG-------AKFLP
DXR_AGRFC       SM-DAGWVMAAIAGTPGLAPTLTAARRGADIALANKECLVSAGDVFLRTVKQ-GGGRLIP
DXR_RHIME       ER-DAGWVMAAIVGNAGLGPTLAAARRGADIALANKECLVSAGSLFIDAVAE-GGGRLLP
DXR_CAUVC       AM-GADWVMSAIVGAAGLAPTVAAARTGAVIALANKESLVCAGPALLAIAKA-AGGSVIP
DXR_BUCAI       ALEETDHVISAIVGMAGLLPTLSAIHAGKTILLANKESLITSGYFFMKALSS-SGAKIIP
DXR_BUCAP       ALKESDLVISAIVGMAGLLPTLSAINAGKTILLANKESLIVCGIIFMKALSS-NKAKIFP
DXR_ECOLI       ALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQ-SKAQLLP
DXR_ECO57       ALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQ-SKAQLLP
DXR_SALTI       ALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKR-SNARLLP
DXR_SALTY       ALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKR-SNARLLP
DXR_YERPE       ALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR-SRAQLLP
DXR_HAEIN       AHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKN-YGSKLLP
DXR_PASMU       AHPEADMVMAAIVGAAGLLPTLSAVKAGKRVLLANKEALVTCGQLFIDAVRE-SQAQLLP
DXR_VIBCH       ALDDVDTVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVAQ-SGAELMP
DXR_NEIMA       SADEVSGVMCAIVGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARA-NGAAVLP
DXR_NEIMB       SADEVSGVMCAIVGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARA-NGAAVLP
DXR_PSEAE       SAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKR-SGAVLLP
DXR_RALSO       AHPDCDAVMAAIVGAAGLRPTLAAVRAGKRVLLANKEALVMSGALFMDAVRQ-HGATVLP
DXR_XANAC       SSDACDTVVAAIVGAAGLPSTLAAARAGKRLLLANKESLVLAGELLTRTAAA-AGAEIIP
DXR_XANCP       ASDACDTVVAAIVGAAGLSSTLAAAAAGKRLLLANKESLVLAGELLTRTAAA-AGAEIIP
DXR_XYLFA       ASTTCDTVVAAIVGAAGLHSTLAAARAGKRLLLANKESLVLAGMLLMREASI-SGAEIIP
DXR_MYCLE       EETEADVVLNALVGALGLRPTLAALHTGARLALANKESLVAGGSLVLAAAQP---GQIVP
DXR_MYCTU       EQTEADVVLNALVGALGLRPTLAALKTGARLALANKESLVAGGSLVLRAARP---GQIVP
DXR_CORGL       ETTKADTVLNALVGSLGLAATLATLESGAHLALANKESLVAGGEFVTSKAKL---GQIIP
DXR_STRCO       -ASDCHTVLNGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVKALAKP---GQIIP
DXR_TREPA       SSCEAEVVVNGIAGAAGLFASLEVLKTRCTLALANKESVVLAASLLHAAARE-SGATIVP
DXR_DEIRA       AVAQADVVVNAMSGLIGLPPTRAALEAGQAVALATKEAMVTSAHLMWEAAAA-GGGRVVP
DXR_NOSS1       RYGDAETVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEK-HGVKLLP
DXR_SYNY3       RYGDAESVVTGIVGCAGLLPTMAAIAAGKDIALANKETLIAGAPVVLPLVEK-MGVKLLP
DXR_BACHD       TAEKAEILVNAVIGSVGLAPTLAAIEAKKTIALANKETLVTAGHLVTEKARE-HGVKLLP
DXR_BACSU       VMEEVDIVVNALLGSVGLIPTLKAIEQKKTIALANKETLVTAGHIVKEHAKK-YDVPLLP
DXR_LISIN       TYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMQAAKE-KNISLLP
DXR_LISMO       TYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKE-KNISLLP
DXR_CLOAB       SYKDSNIVVTSIVGMIGLIPTLEAIKAGKDIALANKETLVVAGELVTKEAKK-YGVNILP
DXR_CLOPE       TLDEIDIVVTSVVGMIGLKPTVEAIRKGKDIALANKETLVVAGELVMREAKE-NGVKILP
DXR_CALS4       KY-EADMVVVAVEGIAGLIPTVEAIKLGKNIALANKEVLVTAGEIVMGLVKE-KKIEFLP
DXR_FUSNN       KNSDYDIILTAVSGAIGIDATVEAIKRGKRIALANKETMVSAGVYINKLLKEYPKAEIVP
DXR_CHLMU       TAASVDMTIVASSGIDALPAVMASIQERKTIALANKESLVAAGELVTTLAKK-NHVQILP
DXR_CHLTR       TEPSVTMTIVASSGIDALPAVIAAIRQKKTIALANKESLVAAGELVTTLARE-NGVQILP
DXR_CHLPN       IMDTVTTVVAASSGIEALPAILESMKKGKALALANKEILVCAGELVSKTAKE-NGIKVLP
DXR_AQUAE       EE--SERLMNAISGIYGIKPAYEVIKAGKTLLASNKESILCLGEIIRKNRER-----VIP
DXR_THEMA       EALKPDITMVAVSGFSGLRAVLASLEHSKRVCLANKESLVCGGFLVKKKLKE-KGTELIP
DXR_PELUB       TNNKIDYSMCAISGFDGLKPTLDIIKFTKTIAIANKESIICGWNLIKKDLKK-YKTYFVP
DXR_MYCPE       EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRS-SSSRIYP
DXR_MYCGA       DKSKPKVIINAINGYHGIEASLIALSKKKDLLLANKESLVIAGSQLEAIRKD-TKTTIYP
                        : .  *  .:            :  :.** ::     .           . *

DXR_HELPY       IDSEHFGLWALLQNK-----------TLKPKSLIISASGGAFRDTPLEFIPIQNAQNALK
DXR_HELPJ       VDSEHFGLWALLQNK-----------TLKPKSLIISASGGAFRDTPLDLIAIQNAQNALK
DXR_HELHP       IDSEHFGLWYLQNNR-----------PIT--KLYITASGGAFRDYPLDKIALATPQEALK
DXR_WOLSU       VDSEHFSLWFLKSDK-----------PFS--RLFITASGGAFRDTPLEEIPLQKAQAALR
DXR_CAMJE       VDSEHAALKFLLEGK-----------KNIA-KLYITASGGAFYRYKIKDLNQVSVKDALK
DXR_AGRFC       VDSEHSAIFQCLTGE----------YKQAVERIVLTASGGPFRTWSRDEMSNVTADIARA
DXR_RHIME       VDSEHNAIFQVLEND----------QRHAVERIVLTASGGPFRTKTLDEMRHVTADVARA
DXR_CAUVC       VDSEHSAIFQVLQSE----------CAHRVSRLILTASGGPFRTWDKAAMARATPEQAIA
DXR_BUCAI       IDSEHNAIFQVLPLEIQKNLGKTTLEKNSIKHLVLTGSGGPFYKFSSSDLSNVTPDQACS
DXR_BUCAP       IDSEHNAIFQVLPKFVQKNLGKVNLKKNGVKSIILTASGGPFYNFKRENLSFVTPLEACS
DXR_ECOLI       VDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACR
DXR_ECO57       VDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACR
DXR_SALTI       VDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACR
DXR_SALTY       VDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACR
DXR_YERPE       IDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACA
DXR_HAEIN       VDSEHNAIFQSLPPEAQEKIGFCPLSELGVSKIILTGSGGPFRYTPLEQFTNITPEQAVA
DXR_PASMU       VDSEHNAIFQSLPPEAQRQIGFCPLSELGISKIVLTGSGGPFRYTPLEQFEQITPAQAVA
DXR_VIBCH       VDSEHNAIFQCLPTEIQTQLGRCDLSQHGIDHILLTGSGGPFRYSDLATLDSVTPEQAIA
DXR_NEIMA       VDSEHNAVFQVLPRDYTGR-----LNEHGIASIILTASGGPFLTADLNTFDSITPDQAVK
DXR_NEIMB       VDSEHNAVFQVLPRDYAGR-----LNEHGIASIILTASGGPFLTADLNTFDRITPAQAVK
DXR_PSEAE       IDSEHNAIFQSLPRNYADG-----LERVGVRRILLTASGGPFRETPLEQLASVTPEQACA
DXR_RALSO       IDSEHNAIFQCLPQQRPS-------FGHGVARIVLTASGGPFRTRAVETLAEVTPDQACA
DXR_XANAC       IDSEHSAIFQCLRSC---------DASRGVRRVILTASGGPFRGRDRAALAAVTPAQAVA
DXR_XANCP       IDSEHSAIFQCLRSC---------DASRGVRRVILTASGGPFRGRQRAQLAEVTPAQAVA
DXR_XYLFA       IDSEHNAIFQCLRS----------RTTDGVHRITLTASGGPFRGHNRTMLAKITPTQAMA
DXR_MYCLE       VDSEHSALAQCLRGG----------TPDEVAKLVLTASGGPFRGWNAGDLERVTPEQAGV
DXR_MYCTU       VDSEHSALAQCLRGG----------TPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGA
DXR_CORGL       VDSEHSAMAQCLRSG----------TRDEVARIVLTASGGPFRGWTREKMWEVTPEQAAA
DXR_STRCO       VDSEHAALFQALAAG----------TRADVRKLVVTASGGPFRGRTRDELAAVTVEDALA
DXR_TREPA       VDSEHAAIFQLIAAH----------GAHAVAQVVLTASGGPFRTFSKECLAHVTVEDALQ
DXR_DEIRA       VDSEHTGVYQCLTGE----------DMGDVAELILTASGGPFRDGP-ADLSAVTPEQALK
DXR_NOSS1       ADSEHSAIFQCLQGV----------PKGGLKKILLTASGGAFRDWDVERLAEVTVSDALK
DXR_SYNY3       ADSEHSAIFQCLQGV----------PEGGLRRIILTASGGAFRDLPVERLPFVTVQDALK
DXR_BACHD       VDSEHSAIFQALQGE----------RMDRLHRIIITASGGSFRDKSRDELNGVTVEDALK
DXR_BACSU       VDSEHSAIFQALQGE----------QAKNIERLIITASGGSFRDKTREELESVTVEDALK
DXR_LISIN       VDSEHSAILQALNGE----------NRERIEKIILTASGGSFRDKTREQLSEVTVKEALK
DXR_LISMO       VDSEHSAILQALNGE----------NTERIEKIILTASGGSFRDKTREQLSAVTVKEALK
DXR_CLOAB       VDSEHGAIFQCLQGN----------KYKDINKILLTASGGPFRGKSFDELNNVTLNDALN
DXR_CLOPE       VDSEHSAIFQSLQGN----------AHNKIDKILLTASGGPFRGFTIEDLKSVTPERALK
DXR_CALS4       VDSEHSAILQCLKGN----------NKREVSNLILTASGGPFRGKKKKDLVNVTVEEALK
DXR_FUSNN       VDSEHSALFQSLQGF----------KKENLKKLIITASGGTFRGKDLAYLENVTVEQALK
DXR_CHLMU       IDSEHNALFQCLEGR----------DPSTIKKLILTASGGPLRNKSKEELQKVTLQEVLK
DXR_CHLTR       IDSEHNALFQCLEGR----------DSSTIKKLLLTASGGPLRNKSKEELQKVSLQEVLR
DXR_CHLPN       IDSEHNALYQCLEGR----------TIEGIKKLILTASGGPLLNKSLEELSCVTKQDVLN
DXR_AQUAE       VDSEHNALFQLLSSVK----------REEVKHVYLTASGGPFKDKSLEELKTASVEEALR
DXR_THEMA       VDSEHSAIFQVMEPE--------------VEKVVLTASGGALRDWKISKIDRARPEDVLK
DXR_PELUB       VDSEHFSIWSLLDNN----------KKNNFEKIYITASGGPFRNLSLKKFRNISVKDALK
DXR_MYCPE       VDSEHSSLYDSLKNN----------NK-EIKELIITCSGGPFYKKEFNELLNINFADAVK
DXR_MYCGA       IDSEHSALYDLLKDK----------KKNQIKQLMITASGAGYFNKDISELRKLTYNDLLN
                 **** .:                        : :: **.         :          

DXR_HELPY       HPNWSMGSKITIDSASMVNKLFEILETYWLFGASL-KIDALIERSSIVHALVEFEDNSII
DXR_HELPJ       HPNWSMGDKITIDSASMVNKLFEILETYWLFGASL-KIDALIERSSIVHALVEFEDNSVI
DXR_HELHP       HPNWQMGYKITIDSASMANKLFEILEARWLFDIE--SIDAFIEPSSSMHALIEFADGSIT
DXR_WOLSU       HPNWSMGRKITVDSATMVNKLFEILEARWLFNTK--SVDALIERNSLVHALIGYPDGSFS
DXR_CAMJE       HPNWNMGAKITIDSATMANKLFEIIEAYHLYDFK--EIDALIEPRSLVHAMCEFKNGAST
DXR_AGRFC       HPNWSMGLKVSIGSASMFNKGLEMIEAKYLFDLRPDQVDVIVHPQSIIHSMVGYTDGSYI
DXR_RHIME       HPNWSMGLKISIDSASMFNKALEMIEARHLFRLRPEQIEVIVHPQSVVHSMVGYTDGSVL
DXR_CAUVC       HPNWSMGAKISVDSATMMNKGLEMIEASYLFATPEDRVDVVIHPQSVIHSLVEYVDGSTL
DXR_BUCAI       HPNWLMGKKISVDSATMMNKGLEYAEARWLFNALESEIKILIHPESIIHSMVQYYDGSLL
DXR_BUCAP       HPNWSMGRKISIDSATMINKGFEYAEARLLFNASSSEIDILIHPQSIIHSMVEYIDGTIL
DXR_ECOLI       HPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVL
DXR_ECO57       HPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVL
DXR_SALTI       HPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVL
DXR_SALTY       HPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVL
DXR_YERPE       HPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSIL
DXR_HAEIN       HPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEVIIHPQSIIHSMVRYVDGSVI
DXR_PASMU       HPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEVIIHPQSIIHSMVRYIDGSVI
DXR_VIBCH       HPNWSMGPKISVDSATMMNKGLEYIEAKWLFNTSREQLKVLIHPQSVIHSMVQYQDGSVI
DXR_NEIMA       HPNWRMGRKISVDSATMMNKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVL
DXR_NEIMB       HPNWRMGRKISVDSATMMNKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVL
DXR_PSEAE       HPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVI
DXR_RALSO       HPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVERLEVLIHPQSVIHSMVAYDDGSVL
DXR_XANAC       HPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGEQIDVLVHPQSLVHSLVEFVDGSTL
DXR_XANCP       HPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGEQIDVLVHPQSLVHSLVEFVDGSTL
DXR_XYLFA       HPTWSMGPKISVDSATLMNKGLEVIEAHHLFGLPSEQIDVLVHPQSLVHSLVEFIDGSTL
DXR_MYCLE       HPTWSMGTMNTLNSASLVNKGLELIEANLLFGIPYDRIEVVVHPQSIVHSMVTFIDGSTI
DXR_MYCTU       HPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTI
DXR_CORGL       HPTWAMGQMNTLNSATLINKGLELIEATLLFETDADLIDVTVHPQSIIHSMITFTDGATI
DXR_STRCO       HPTWAMGPVITINSATLVNKGLEVIEAHLLYDIPFDRIEVVVHPQSYVHSMVEYTDGSTL
DXR_TREPA       HPTWRMGKKISVDSATLANKALEVIEAVQFFRIPVDRVTVVVHPQSIVHALVQCHSGETY
DXR_DEIRA       HPSWSMGPKVTIDSATLMNKGLEVMECASLYGLPLSQVGVVVHPQSIVHAAVRLRDGSLK
DXR_NOSS1       HPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYQDIEIVIHPQSIIHSLIELQDTSVL
DXR_SYNY3       HPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDHIDIVIHPQSIIHSLIEVQDTSVL
DXR_BACHD       HPNWSMGAKITIDSATMMNKGLEVIEAHWLFNLPYEKIDVLLHKESIIHSMVEFVDRSVI
DXR_BACSU       HPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHKESIIHSMVEFHDKSVI
DXR_LISIN       HPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRESIVHSMVQFVDGSFI
DXR_LISMO       HPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRESIIHSMVQFVDGSFI
DXR_CLOAB       HPKWTMGRKITIDSATLMNKGLEVIEAHWLFNVDYEKIQVLVHPQSIVHSMVQYKDGSVI
DXR_CLOPE       HPKWNMGQKISIDSSTLMNKGLEVIEAHWLFDCSYKDIEVVVHPQSIIHSMVQYTDGAVI
DXR_CALS4       HPNWKMGKKITIDSATLMNKGFEVIEARWLFDMPLDKIKVVIHPQSIIHSMVEYVDGSVI
DXR_FUSNN       HPNWSMGKKITIDSSTLVNKGLEVIEAHELFNVDYDDIEVVIHPQSVIHSMVEYVDGSII
DXR_CHLMU       HPIWDMGPKITVDSSTLVNKGLEIIEAFWLFGLQAVEIEAVIHPQSLIHGMVEFCDGTIL
DXR_CHLTR       HPVWNMGPKITVDSSTLVNKGLEIIEAFWLFGLEAVEIEAVIHPQSLVHGMVEFCDGTIL
DXR_CHLPN       HPIWNMGSKVTVDSSTLVNKGLEIIEAYWLFGLENVEILAVIHPQSLIHGMVEFLDGSVI
DXR_AQUAE       HPRWNMGAKITIDSATLMNKGFEMLEAHFLFDFPIENIKVVIHPQSFVHGILELIDNSFL
DXR_THEMA       HPVWNMGARITVDSATMVNKAFEVLEAMELFELPFEKIEVKIHREGLVHGAVVLPDGNVK
DXR_PELUB       HPNWSMGKKITIDSATMMNKVFEIIEAKKIFNLNYKQLEILIHPKSYLHAIVKFNNGLSK
DXR_MYCPE       HPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYI
DXR_MYCGA       HPNWKMGAEISINSATFVNKVYEIVEAYHLFKIK--DIIPVVERSSTIHAGVIYQDNSIH
                ** * **   ::.*::: **  *  *   ::      :    .  . :*.     .    

DXR_HELPY       AHLASADMQLPISYAIDPKL------------ASLSASIKPLDLYALSAIKFEPISMERY
DXR_HELPJ       AHLASADMQLPISYAINPKL------------ASLSASIKPLDLYALSAIKFEPISVERY
DXR_HELHP       THISTPDMKLPIAYALDKDK------------AAQMPFIQPLDIQSL-CLALKNIDTLRY
DXR_WOLSU       AHIAQADMRLPLAYAMLGKL------------DQPLG--PPLELERLAALSFEPINPSRY
DXR_CAMJE       AYFSKADMKLAISDAIFEK--------------QDTPILEAVDFSKMPALKFHPISTKKY
DXR_AGRFC       AQLGSPDMRTAISYALTYP-------------ERGNLSVERLDFAKLARLDFEAPDEARF
DXR_RHIME       AQLGCPDMRTAIGYALSYP-------------KRCDLPVERLDFARLARLDFEAPDEVRF
DXR_CAUVC       AQLGPPDMRAPIACAFAWP-------------DRLPWPAPRLDLAAYGQLTFESPDVERF
DXR_BUCAI       AQLSVPDIRTSISYAMSWP-------------DRICTEVDYLNFYKINNLTFFEPDFTQF
DXR_BUCAP       AQLSVPDMKVAISYAMSWP-------------NRISSGAKFLNFNKLSNLSFFKPDFIQF
DXR_ECOLI       AQLGEPDMRTPIAHTMAWP-------------NRVNSGVKPLDFCKLSALTFAAPDYDRY
DXR_ECO57       AQLGEPDMRTPIAHTMAWP-------------NRVNSGVKPLDFCKLSALTFAAPDYDRY
DXR_SALTI       AQLGEPDMRTPIAHTMAWP-------------NRVTSGAQPLDFCKLSALTFSAPDYQRY
DXR_SALTY       AQLGEPDMRTPIAHTMAWP-------------NRVTSGAQPLDFCKLSALTFSAPDYQRY
DXR_YERPE       AQMGTPDMRTPIAHAMAYP-------------MRVSSGVAPLDFCKVGALTFTTPDYQRY
DXR_HAEIN       TQMGNPDMRTPIAETMAYP-------------HRTFAGVEPLDFFKIKELTFIEPDFNRY
DXR_PASMU       AQMGNPDMRTPIAETMAYP-------------SRTVAGVEPLDFYQLNGLTFIEPDYQRY
DXR_VIBCH       AQLGEPDMATPISYAMAYP-------------ERVTAGVPALDFTRLQQLTFMEVDFARY
DXR_NEIMA       AQLGNPDMRTPIAYCLGLP-------------ERIDSGVGDLDFDALSALTFQKPDFDRF
DXR_NEIMB       AQLGNPDMRTPIAYCLGLP-------------ERIDSGVGDLDFDALSALTFQKPDFDRF
DXR_PSEAE       AQLGNPDMRTPISYAMAWP-------------ERIDSGVSPLDMFAVGRLDFQRPDEQRF
DXR_RALSO       AQLGNPDMRTPIAYGLAYP-------------ERIEAGVPLLDLAATGTLAFEAPDLHRF
DXR_XANAC       AQLGLPDMRTTLAVGLAWP-------------ERVESGVGGLDLLSQGRLDFEAPDTAAF
DXR_XANCP       AQLGLPDMRTTLAVGLAWP-------------ERVESGVGGLDLLQQGRLDFEAPDTEAF
DXR_XYLFA       AQLSLPDMRTTLAVGLSWP-------------ERIGSGVPGLDLMKHNRLDFERPDTETF
DXR_MYCLE       AQASPPDMKLPISLALGWP-------------QRVGGAARACAFTTASTWEFEPLDIDVF
DXR_MYCTU       AQASPPDMKLPISLALGWP-------------RRVSGAAAACDFHTASSWEFEPLDTDVF
DXR_CORGL       AQASPPSMKLPIALALDWP-------------HRVPKAQPALDFTAAHTWAFEPVDDAAF
DXR_STRCO       AHATPPDMGGPIAVGLGWP-------------ERVPDAAPAFDWSKASTWEFFPLDNEAF
DXR_TREPA       AQLSVPDMASPLLYALLYP-------------DAPPAYQTPLDFTSGLSLHFEPPRVDDF
DXR_DEIRA       AQFGPADMRLPIAYAIDAAPSGMQHPGDVRGARRGEEVGEHLGWPLLGQWEFRAPDLTRF
DXR_NOSS1       AQLGWPDMRLPLLYALSWP------------ERIYTDWER-LNLVKAGNLTFREPDHQKY
DXR_SYNY3       AQLGWPDMRLPLLYALSWP------------ERIYTDWEP-LDLVKAGSLSFREPDHDKY
DXR_BACHD       AQLGTPDMRVPIQYALSYP------------DRLEFHEGQQLNLWEVGKLHFAPLDMERF
DXR_BACSU       AQLGTPDMRVPIQYALTYP------------DRLPLPDAKRLELWEIGSLHFEKADFDRF
DXR_LISIN       AQLGTPDMRMPIQYALTYP------------DRLSIPYEKEFRITDFSALHFEEVNYERF
DXR_LISMO       AQLGTPDMRMPIQYALTYP------------DRLYIPYEKEFRITDFSALHFEKVDYERF
DXR_CLOAB       AQLGPTDMRLPIQYALNYP------------VRK-ERIVEPVDFYSTPDLHFEKPDMDTF
DXR_CLOPE       AQLGVPDMKLPIQYALNYP------------NRE-GNISEKLDLFKIRELTFEKPDLDTF
DXR_CALS4       AQLSVPDMRIAIQYALNYP------------DRKYVEGVKFLDFYALGQLTFEEPDFETF
DXR_FUSNN       AQMGVANMKTPILYAFTYP------------EKEYNSSINFLDLIKNNNLTFEEADRKVL
DXR_CHLMU       SVMNPPSMLFPIQHVLTFP-------------DRYPSIISGLNFLTNQTLEFLPIDDERF
DXR_CHLTR       SVMNPPSMLFPIQHVLTFP-------------ERSPAIGPGFDFLSNRTLEFFPIDEDRF
DXR_CHLPN       SIMNPPDMLFPIQYALTAP-------------ERFASPRDGMDFSKKQTLEFFPVDEERF
DXR_AQUAE       MHTSQTDMKIPIMHALFYP-------------KRKEYPFKKVSLLELSPITFEKVDTTKF
DXR_THEMA       MVVSPPDMRIPISYALFYP----------------RRVALEPFFLRTISLSFEDPDPEKY
DXR_PELUB       LLVHDTNMTIPIFNSIYFN-------------TDKKLKSKNIDIKTLNNLNLKKIDNIRF
DXR_MYCPE       ANMSVPDMKLSIQQGLSGY--------------ESKTNLINDLSFNNLNLTFSEIDLDKW
DXR_MYCGA       FHATTNDMRWAIQSALTKF--------------DNRTNVVQSLDLYQKTIQFEKIDFEQY
                      .:  .:   :                                   :        

DXR_HELPY       TLWCYKDLLL-ENPK-LGVVLNASNEVAMEKFLNKEIAFGGLIQTISQALESYDKMPF--
DXR_HELPJ       TLWRYKDLLL-ENPK-LGVVLNASNEVAMKKFLNQEIAFGGFIQIISQALELYAKKSF--
DXR_HELHP       PLWNLKDTLL-HTPQ-KGIVLNASNEIAIEAFLAQKIPFGHISALILAMMEYFDSFKFA-
DXR_WOLSU       PLWNLKEKLL-THPW-LGITLNAANEVAVEKFLEGKILFGEIPRYIERSLERFSMIPA--
DXR_CAMJE       PIFKLKNTFL-KEPN-LGVIINAANEVGVYNFLENKSGFLDIAKCIFKALDHFGVPKI--
DXR_AGRFC       PALRLARMAL-ERGGLQGAALNAAEETAFHAFVAGGIGFLDMAEIVETVMDRMHDG----
DXR_RHIME       PAIKLARRAM-EEGGVQGAVLNGAKETALDAFIKGRIGFLAMAEIVEKVMDGLAGL----
DXR_CAUVC       PAIGIAREAL-RLGGGAPAAMNAANEVAVAAFLDRRIGFLDIAGAVAGTLERMNSLGDLS
DXR_BUCAI       PCLKLAIDAF-SQGQASMTVLNAANEIAVSSFLDSKISFTKIYEINMEILMSSCFSEPK-
DXR_BUCAP       PCLKLAIDAF-SQGQAAMTVLNAVNEVTVSAFLDSKISFNKISEINTDILMSSSFSEPV-
DXR_ECOLI       PCLKLAMEAF-EQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQ-
DXR_ECO57       PCLKLAMEAF-EQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQ-
DXR_SALTI       PCLKLAMEAF-EQGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLHEPA-
DXR_SALTY       PCLKLAMEAF-EQGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPA-
DXR_YERPE       PCLKLAIDAC-NAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPT-
DXR_HAEIN       PNLKLAIDAF-AAGQYATTAMNAANEIAVQAFLDRQIGFMDIAKINSKTIERISPYTIQ-
DXR_PASMU       PCLKLAIDAF-SAGQYATTAMNAANEIAVASFLDNKIKFTDIARLNQLVVSKLQPQKIH-
DXR_VIBCH       PCLQLAMDAC-FLGQHATTSLNAANEVAVDAFLKRKIRFTDIALINDQVLSKVCATNTQL
DXR_NEIMA       PCLKLAYEAM-NAGGAAPCVLNAANEAAVAAFLDGQIKFTDIAKTVAHCLSQDFSDGIG-
DXR_NEIMB       PCLRLAYEAM-NAGGAAPCVLNAANEAAVAAFLDGQIKFTDIAKTVAHCLAQDFSDGIG-
DXR_PSEAE       PCLRLASQAA-ETGGSAPAMLNAANEVAVAAFLERHIRFSDIAVIIEDVLNREAVTAVE-
DXR_RALSO       PCLALAFDAL-RAGGTAPAVLNAANEVAVEAFLQRRIRFTEIAAVVGDTLARTAIGPAD-
DXR_XANAC       PCLRLAWDAL-RAGGTAPAILNAANEVAVSAFLQGQVGFLAIPALVEHTLTTLQRHNAD-
DXR_XANCP       PCLRLAWDAL-RAGGTAPAILNAANEVAVSAFLQGKVGFLAIPALVEHTLTTLQRQNAD-
DXR_XYLFA       SCLRLARDAM-QTGGTAPAVLNAANEIAVSAFLQGRIGFLTIPALIEHALTTLPRYEAD-
DXR_MYCLE       PAVELARHAG-QIGGCMTAIYDAANEEAAEAFLQGRIGFPAIVATIADVLQRADQWAPQW
DXR_MYCTU       PAVELARQAG-VAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQWAVE-
DXR_CORGL       PAVQLARHVA-KQKGTYPAVYNAANEEAAEAFLRGRIKFPQIVDVVDEVLQGASQFAGV-
DXR_STRCO       PSVDLARHVG-QLAGTAPAVFNAANEECVEAFRSGALPFLGIMETVTRVVEEHGTPRTG-
DXR_TREPA       PLLRMGFDVA-RAQRAYPIAFNAANEEAVRAFLQRNIGFLDIAHVTAQALQEDWRAIPQ-
DXR_DEIRA       PCLALAYRAG-EAGGLLPVALNAADEVAVDAFLHGRIGFLDIPQLIERVLDETPGGALT-
DXR_NOSS1       PCMQLAYAAG-RAGGSMPAVLNAANEQVVALFLDEKIKFLDIPRCIELVCDRHQNDN-CA
DXR_SYNY3       PCMQLAYGAG-RAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKTCDLYVGQN-TA
DXR_BACHD       RCMAFAYESG-KQGGTMPTVLNAANEEAVELFLNNQLSFLGIEDVIEKALERHERID---
DXR_BACSU       RCLQFAFESG-KIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQLLK---
DXR_LISIN       PALKLAYNAG-KIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSIS---
DXR_LISMO       PALKLAYNAG-KIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSIS---
DXR_CLOAB       RCLRLAYDAG-MAGGIMPAILNSANEYAVDLFLKDKIKFTNIQEIIEDALNHFENVN---
DXR_CLOPE       KCLKLAYEAG-EKGKLMPTILNGANEVCVELFLNKKITYLQIPEIIEECMNTFDYNK---
DXR_CALS4       KCLSLAYHAA-ECGGTMTAVLNAADEVAVSLFLQNKINFLEIAEIIEEALENHKNIQ---
DXR_FUSNN       KGIDLAYRAG-RTGDTMPTVFNASNEIAVELFMKKQIKFLDIYRIIEEAMNSHQVLTLNT
DXR_CHLMU       PSIRLAKDVL-REGGSMGCFFNGANEALVQRFLSGEIAWYQIVSKLQTLMDKYVVRSCL-
DXR_CHLTR       PSVHLAKRVL-LEKGSMGCFFNGANEALVHRFLAGEISWHQIVPKLQALVDQHRVQSCL-
DXR_CHLPN       PSIRLAQQVL-EKQGSSGSFFNAANEVLVRRFLCEEISWCDILRKLTTLMECHKVYACH-
DXR_AQUAE       KAIDLAKWAG-FMGGVYIPVLVGADEEAVNLFLNKKIGFLDIVDLIEQALSEVNIKDPQ-
DXR_THEMA       PAFFLLKEI--KDSYALRTAFNAADEVAVEAFLKGRIRFGGIHRVIEKTLEEFQGYPQPR
DXR_PELUB       PVIKILNNLS-NEDSLFETIIVSANDKLVKLFLNNKIKFNDISNTLIKICNTPEFNKFKS
DXR_MYCPE       KPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN-
DXR_MYCGA       PIFKIAYDILKNPYTTRGAVLTCINEHVVKLFQKQKINFLQITELISNFYWNYQHKKID-
                                        .:     *      :  :                  

DXR_HELPY       --KLSSLEEVLELDKEVRERF------KNVAGV-------------------
DXR_HELPJ       --KLSSLDEVLALDKEVRERF------GSVARV-------------------
DXR_HELHP       --SLCDLESIQAFDNQVRAVS------SQWLERKIKE---------------
DXR_WOLSU       -----SIEELFALDSEVRQFA------HKL----------------------
DXR_CAMJE       ----SSIEEVFEYDFKTREYL------RS-----------------------
DXR_AGRFC       -RTAETMDDVFSADEEARRHA------LELIATKEKAA--------------
DXR_RHIME       -PAATSMDDVFAADERARRAA------AEMIR--------------------
DXR_CAUVC       VAESDAVETAMLIDGSARRIA------AEVVAQKRQRA--------------
DXR_BUCAI       -----CIQDILEIDRKVRILA------KNKVSSLIF----------------
DXR_BUCAP       -----SVEEVLEIDKKTRIKS------QKKISSLIF----------------
DXR_ECOLI       -----CVDDVLSVDANAREVA------RKEVMRLAS----------------
DXR_ECO57       -----CVDDVLSVDASAREVA------RKEVMRLAS----------------
DXR_SALTI       -----SVDDVLQVDAIAREVA------RKQVIRLSR----------------
DXR_SALTY       -----SVEDVLQVDAIAREVA------RKQVIRLSR----------------
DXR_YERPE       -----SVEEVLVIDRKARDVA------AQVIAKLNN----------------
DXR_HAEIN       -----NIDDVLEIDAQAREIA------KTLLRE-------------------
DXR_PASMU       -----CIEDVLEVDKKARELS------QSIILSFSHP---------------
DXR_VIBCH       --HCRDLESLLELDTMARHFA------HQVLKERQA----------------
DXR_NEIMA       -----DIGGLLAQDARTRAQA------RAFIGTLR-----------------
DXR_NEIMB       -----DIGGLLAQDARTRAQA------RAFIGTLR-----------------
DXR_PSEAE       -----SLDQVLAADRRARSVA------GQWLTRHAG----------------
DXR_RALSO       -----SLDTVFAADAQARRRA------EHYIAASCLQS--------------
DXR_XANAC       -----SLDTLLFADAQARQIT------ERALAHHALHA--------------
DXR_XANCP       -----TLNALLFADAEARRTT------ERALAHHSLHA--------------
DXR_XYLFA       -----TLETLLTVDTETRRIT------HAALTHFPLPLPL------------
DXR_MYCLE       GEGPATVDDVLDAQRWARERA------LCAVATASSGK-----VSDMVLERS
DXR_MYCTU       ---PATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
DXR_CORGL       ---ASHVDDILATESEARARA------NALINRLATNL--------------
DXR_STRCO       --TSLTVADVLEAETWARARA------RQLAAQTAEARA-------------
DXR_TREPA       -----TFEEVMACDTRARMCA------RTCIAQRWRER--------------
DXR_DEIRA       ------WDSLTETDAWARARA------QELCAYGVGGAGVGA----------
DXR_NOSS1       ---NPSLDDILAADQWARQEV------LTATKNLASQPQIISVN--------
DXR_SYNY3       ---SPDLETILAADQWARRTV------LENSACVATRP--------------
DXR_BACHD       ---SPSLADILHVDQETRAFV------HSLIK--------------------
DXR_BACSU       ---KPSLADIQEVDKDTRGYV------NSILT--------------------
DXR_LISIN       ---NPNLDTILQVDQETRAYV------KTLL---------------------
DXR_LISMO       ---NPDLDTILQVDQETRAYV------KTLL---------------------
DXR_CLOAB       ---NLTANTIINKSNEVTKYL------KGKIGF-------------------
DXR_CLOPE       ---EVTLDNVINLDKEVRQYI------YEKYN--------------------
DXR_CALS4       ---NPTLDDIISVDLETRERI------MRKYLR-------------------
DXR_FUSNN       ---DNALNVIKEVDREIRKKV------REQWEK-------------------
DXR_CHLMU       -----SLEDILQVDSEARALA------SEC----------------------
DXR_CHLTR       -----SLEEILSVDAEARARA------QEC----------------------
DXR_CHLPN       -----SLEDILEVDGEARALA------QEI----------------------
DXR_AQUAE       -----SVEEILEAVEWGRQKV------REIYERKYAGKG-------------
DXR_THEMA       -----TLDDVERIHFEAIKKA------ERVTEWLSSTSY-------------
DXR_PELUB       MK-PRNIDEIQNLNDYVSLKI------SSMSV--------------------
DXR_MYCPE       -----DLKDILNLNKNTRKYV------YDFSKNKFRY---------------
DXR_MYCGA       -----NIWQINDLIFKIKAAI------SSKYAYLDK----------------