CLUSTAL format seed alignment for MF_00186

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLPK_RHILO       ------------MSGFVLAIDQGTTSTRAILFDGQMKVAGSGQKEFAQHYPASGWVEHDP
GLPK_RHIME       ------------MGGYILAIDQGTTSTRAIVFDGNQKIAGVGQKEFKQHFPKSGWVEHDP
GLPK_AGRFC       ------------MGGYILAIDQGTTSTRSMVFDRDMRVIGVGQREFPQHFPASGWVEHDA
GLPK_THEBO       -------------MKYLLALDQGTTSSWAILFTLEGEVVAVAQRAFAQHYPEPGLVEHDP
GLPK_DEIRA       ----------MSEHQYILALDQGTTSSRAIVFDHQGNMKGVGQQEFRQHFPKPGWVEHDA
GLPK_RALSO       -------------MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDP
GLPK_BORBU       -------------MKYILSIDQGTTSSRAMVFDKNANIKGFAQKEFTQIYPQPSWVEHDP
GLPK_LISIN       -----------MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHSA
GLPK_LISMO       -----------MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHNA
GLPK_BACHD       -----------MTKKYILALDQGTTSSRAILFNEAGEIIGIEQKEFQQIFPKPGWVEHDA
GLPK_THEAQ       ------------MNQYILAIDQGTTSSRAILFNQKGEIVHMAQKEFTQYFPQPGWVEHNA
GLPK_THETH       ------------MNQYMLAIDQGTTSSRAILFNQKGEIVHMAQKEFTQYFPQPGWVEHNA
GLPK_BACSU       ------------METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPHPGWVEHNA
GLPK_STAAM       ------------MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDA
GLPK_STAAW       ------------MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDA
GLPK_XANAC       -----------MEKQYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWVEHNP
GLPK_XANCP       -----------MEKKYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWVEHNP
GLPK_XYLFA       -----------MKKKYILAIDQGTTSSRAILFDQKGHIAGMAQREFTQIFPQPGWVEHNP
GLPK_ENTCA       ----------MAEKNYVMAIDQGTTSSRAIIFDRNGKKIGSSQKEFPQYFPKSGWVEHNA
GLPK_ENTFA       ----------MAEEKYIMAIDQGTTSSRAIIFDKKGNKIGSSQKEFTQYFPNAGWVEHNA
GLPK_LACLA       ----------MTETSYIMAIDQGTTSSRAIIFDKHGKHIGSSQKEFTQYFPKEGWVEHDA
GLPK_STRP1       ----------MSQEKYIMAIDQGTTSSRAIIFNQKGEKVSSSQKEFPQIFPHAGWVEHNA
GLPK_STRP8       ----------MSQEKYIMAIDQGTTSSRAIIFNQKGEKVSSSQKEFPQIFPHAGWVEHNA
GLPK_STRPN       ----------MSQEKYIMAIDQGTTSSRAIIFNKKGEKVSSSQKEFTQIFPQAGWVEHNA
GLPK_CLOAB       ------------MKKYIIALDQGTTSSRAIIFDHEQNILEISQKEFTQIYPSKGWVEHNP
GLPK_CLOPE       ------------MKKYIVALDQGTTSSRAIIFDKEQNIIGVSQKEFNQIYPREGWVEHDP
GLPK_FUSNN       -------------MKYIVALDQGTTSSRAILFDESQNIIGVAQKEFTQIYPNEGWVEHDP
GLPK_SALTI       -----------MTEKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDP
GLPK_SALTY       ----------MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDP
GLPK_ECOLI       ----------MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDP
GLPK_VIBCH       ----------MTEQKYVVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDP
GLPK_HAEIN       ----------MTDKKYIIALDQGTTSSRAVLLDHNANVVEIAQREFTQIYPRAGWVEHNP
GLPK_PASMU       ----------MTDKKYIIALDQGTTSSRAVLLDHDANIVEIAQREFTQIYPQAGWVEHNP
GLPK2_PSEAE      -------MTDKHNKKYVVALDQGTTSSRAIVFDRDANVVSQAQREFAQFYPQAGWVEHDP
GLPK_PSETO       -------MTDIQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFTQHYPQAGWVEHDP
GLPK2_THEMA      -------------MKYVLSLDQGTTSSRAIVFDEKGNVVSKVNKEFRQIYPRPGWVEHDP
GLPK_CALS4       ------------MAKYVMALDQGTTSSRAIIFDHSGKMIASLNKEFRQIYPKPGWVEHDP
GLPK_MYCGE       ---------MDLKKQYIIALDEGTSSCRSIVFDHNLNQIAIAQNEFNTFFPNSGWVEQDP
GLPK_MYCPN       ---------MDLKQQYILALDEGTSSCRTIVFDKDLNQVAIAQNEFNQFFPKSGWVEQDP
GLPK_MYCPU       ---------MENNEKYIITLDSGTTSCRSLIVNKKGEIIAIAQNEFSQYFPKSGWVEHDP
GLPK_PYRAB       ------------MEGYILSLDEGTTSARAIVFDREGNIKGIGQYEFPQYYPKPGWVEHNP
GLPK_PYRFU       ------------MDRYILSLDEGTTSARAIIFDKNSNVLGIGQYEFPQYYPKPGWVEHNP
GLPK_THEKO       ------------MEKFVLSLDEGTTSARAIIFDRESNIHGIGQYEFPQHYPRPGWVEHNP
GLPK2_SACS2      -----------MPGGFILAIDEGTTSARAIIYNQDLEVLGIGQYDFPQHYPSPGYVEHNP
GLPK_AQUAE       -------------MSVVISIDVGTTRVKVIAFSKNGKIVAISDREVSQIYPEPGWVEQDP
GLPK1_THEMA      --------------MYVLAIDQSTSGTKAIIFDEKGGIVHRVTVYHKQYYPKPGWVEHDP
GLPK_MYCLE       ---------MAEFAEFIAAIDQGTTSTRCVIFDHNGAEVARHQLEHEQILPRSGWVEHNP
GLPK_MYCTU       MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
GLPK1_STRCO      ------------MADFIGAVDQGTTSTRFMIFDHGGNEVAKHQLEHEQILPRSGWVEHDP
GLPK2_STRCO      ------MTDSHTAGPFIAAIDQGTTSSRCIVFDRDGRIVSVDQKEHEQIFPKPGWVEHDA
GLPK_COREF       -------MRASKANAYVAAIDQGTTSTRCIIIDDTGAVVSVAAKEHEQILPQQGWVEHDP
GLPK_NOSS1       --------MQISSSGYILALDLGTTGNRAFIFNNAGKIVAQAYKELTQHYPQPGWLEHDA
GLPK_SYNY3       --------MTAKHNQYVMALDLGTTGNRAILFDYEGNIVGQAYKELTQFYPKAGWVEHDA
GLPK_GLOVI       ---MVFASAGAAVSGAILALDLGTTGIRALLFDPSGAVAAGAYREVPQIYPQPGWVEHDP
GLPK_HALSA       -----------MTDAYVGAIDQGTTGTRFIVFDQHGDVVANTYEKHEQHYPEPGWVEHDP
                                 : ::* .*:    .                    *  . :*:..

GLPK_RHILO       EEIWASVVTTVKAALKNAGKAASDVAAIGITNQRETVVVWDRATGKPIHNAIVWQDRRTA
GLPK_RHIME       EEIWQTVVSTVKEAIEKSGITANDIAAIGITNQRETVVVWDRETGKPIHNAIVWQDRRTA
GLPK_AGRFC       EDIWKSVLETIRLALADAGIAASDIAAIGITNQRETTVLWDRNTGEAVHRAVVWQDRRAA
GLPK_THEBO       WEIWESQLWAAKEALRRAGVGPEAVLALGIANQRETTLVWERDTGRPLHPAIVWQDRRTA
GLPK_DEIRA       NEIWSTQIGVAQQALSNAGIRASDLAAIGITNQRETTLIWDRATGKPIHHAIVWQDRRTA
GLPK_RALSO       LDIWSSQLATCRAALEQARLGAADMAALGITNQRETTVVWERATGRPIFNAIVWQDRRTE
GLPK_BORBU       TEIWGSQLGVITEAMANARILPNEIDAIGITNQRETTVIWEKNTGKPIYNAIVWQDRRTA
GLPK_LISIN       NEIWASILAVIAGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTE
GLPK_LISMO       NEIWASILAVIAGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTE
GLPK_BACHD       NEIWASVLSVIAGVLLKTNVEAKEIAAIGITNQRETAVVWEKESGRPIYNALVWQSRQTA
GLPK_THEAQ       NEIWGSVLAVIASVLSEAQVKPEQVAGIGITNQRETTVVWVKDTGNPIYNAIVWQSRQTA
GLPK_THETH       NEIWGSVLAVIASVLSEAQVKPEQVAGIGITNQRETTVVWEKDTGNPIYNAIVWQSRQTA
GLPK_BACSU       NEIWGSVLAVIASVISESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTS
GLPK_STAAM       NEIWTSVLAVMTEVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQ
GLPK_STAAW       NEIWTSVLAVMTEVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQ
GLPK_XANAC       REIMTSVYTTITELLNNAQIDARAIAGIGITNQRETAVVWDKATGQPIYNAIVWQSRQTK
GLPK_XANCP       REIMTSVYTTITELLNNAQIDAREISGIGITNQRETAVVWDKATGQPIYNAIVWQSRQTK
GLPK_XYLFA       RDIMTSVYTTITELLNNTQIDVRAIAGIGITNQRETTVIWDRQTGQPIYNAIVWQSRQTK
GLPK_ENTCA       NEIWNSVQSVIAGAFIESGIRPEAIAGIGITNQRETTVVWDKTTGQPIANAIVWQSRQSS
GLPK_ENTFA       NEIWNSVQSVIAGSLIESGVKPTDIAGIGITNQRETTVVWDKATGLPIYNAIVWQSRQTT
GLPK_LACLA       NEIWNSVQSVIAGAFIESGIKPVQVAGIGITNQRETTIIWDKKTGKPIYHAIVWQSRQSA
GLPK_STRP1       NQIWNSVQSVIAGAFIESSIKPSQIEAIGITNQRETTVVWDKKTGVPIYNAIVWQSRQTA
GLPK_STRP8       NQIWNSVQSVIAGAFIESSIKPSQIEAIGITNQRETTVVWDKKTGVPIYNAIVWQSRQTA
GLPK_STRPN       NEIWNSVQSVIAGAFIESGVKPNQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTA
GLPK_CLOAB       LEIWSSQYGVLQEVMAKANITQENIAAIGITNQRETTIVWDKNTGEPVYNAIVWQCRRTA
GLPK_CLOPE       MEIWATQYSVLQEVMAKCNITQENIAAIGITNQRETTIVWDKNTGVPIYNAIVWQCRRTA
GLPK_FUSNN       MEIWSSQSGVLSEVIARAGISQHDIIALGITNQRETTIVWDKNTGKPVYNAIVWQCRRTA
GLPK_SALTI       MEIWASQSSTLVEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTA
GLPK_SALTY       MEIWASQSSTLVEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTA
GLPK_ECOLI       MEIWATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTA
GLPK_VIBCH       MEIYATQSSTLVEALGKAGIRSDEVAAIGITNQRETTVVWNKETGKPVYNAIVWQCRRTA
GLPK_HAEIN       MEIWATQSSTLNEVVAKAGITSDEIAAIGITNQRETTIVWEKSTGTPVYNAIVWQCRRTA
GLPK_PASMU       MEIWATQSSTLNEVVAKAGITADQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTT
GLPK2_PSEAE      MEIWATQSSTLVEALAQASIEHDQVAAIGITNQRETTVVWDRHSGRPIHNAIVWQCRRSA
GLPK_PSETO       MEIFATQSAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKVTGRPIYNAIVWQCRRST
GLPK2_THEMA      VEIWESQIEVAKKAIEEAGIKPEDIAAIGITNQRETTIVWDKNTGKPVYNAIVWQCRRTA
GLPK_CALS4       MEIWESQIEVAKGVIEKAGIKPEDIAAIGITNQRETTVVWDKNTGKPIYNAIVWQCRRTA
GLPK_MYCGE       LEIWSAQLATMQSAKNKAQIKSHEVIAVGITNQRETIVLWNKENGLPVYNAIVWQDQRTA
GLPK_MYCPN       LEIWSVQLATMQSAKNKAQIKSNNIAAVGITNQRETIVLWNKENGLPVYNAIVWQDQRTA
GLPK_MYCPU       LEIWNTQLSTMQSVKNKAQIKSSDIVALGITNQRETIVVWDKDTGLPVYNAIVWQDVRTS
GLPK_PYRAB       MEIWDAQVRAIKTAIQKAKVEPAQIKAIGITNQRETTIVWDK-NGNPLYNAIVWQCRRTA
GLPK_PYRFU       EEIWEAQVKAIKTAIEKAKIEANQIAAIGVTNQRETTVIWKK-DGKPVYNAIVWQCRRTA
GLPK_THEKO       EEIWDAQLRAIKDAIQSARIEPNQIAAIGVTNQRETTLVWDK-DGKPLYNAIVWQCRRTA
GLPK2_SACS2      DEIWNAQMLAIKEAMKKAKIESRQVAGIGVTNQRETTILWDAISGKPIYNAIVWQDRRTS
GLPK_AQUAE       LELWEAVRKSLSEVIQQVGLK--EINSIGITNQRETVILWDKETGRPVYNAILWQDLRTE
GLPK1_THEMA      EEIFRNTLDACRKVIEESGIKPLEIEALAITNQRETTILWEKKSGKPVYNAVVWQCQRGA
GLPK_MYCLE       VEIWERTASVLMSVLNATNLSAKDIAALGITNQRETTLVWNRNTGRPYCNAIVWQDTRTD
GLPK_MYCTU       VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
GLPK1_STRCO      VEIWERTNSVMQNALRNGGLSGTDLAAIGITNQRETTVVWDPRTGRPYYNAIVWQDTRTD
GLPK2_STRCO      TEIWTNVQEVVAGAVEKAGITRDDIKAIGITNQRETTLVWDKNTGEPVHNAIVWQDTRTD
GLPK_COREF       VEIWDNVRAVVSQAMVAIDITPYEISSVGVTNQRETTVIWDPATGEPVYNAIVWQDTRTN
GLPK_NOSS1       EEIWQDTCWVMKTAIVNAQISPSEIAAIGLTVQRETCLLWDKTTGRPLHKAIVWQDRRTA
GLPK_SYNY3       LEIWRDTKTVMQEVVQKTAIQPQQIVAIGLTVQRETCLLWDKTTGQPLHPAIVWQDRRTA
GLPK_GLOVI       QTIWQLTCEVVAEVQAQSAA---RIAAVGLTNQRETCLLWDAATGTPHGNAIVWQDRRTA
GLPK_HALSA       LEIWENTKSVVTAGLSAAGLDADDLAAIGITNQRETTVVWDAASGRPIHNALVWQDRRTT
                   :                     : .:.:: **** ::*    * .   *::**  :  

GLPK_RHILO       PL--CQKLKK-QGLEKKFTRKTGLLLDPYFSGTKIAWILDKVKGG----------RKRAE
GLPK_RHIME       AF--CDKLKK-KGLEKTFVKKTGLLLDPYFSGTKLNWLLSNVKGA----------QVRAA
GLPK_AGRFC       PV--CEDLKR-RGLEPLFSKKTGLLLDPYFSGTKLKWLLDSVSGL----------REKAV
GLPK_THEBO       SL--CEALRE-RGLEGLFRARTGLLLDPYFSATKLLWLLERVPGL----------RERAE
GLPK_DEIRA       PY--CDSIRA-QH-EKTLQDKTGLVLDAYFSGTKVKWLLDNVPGA----------RERAE
GLPK_RALSO       AI--CERLRA-EGLEDEVRKRTGLVIDPYFSGTKLRWILDHVDGA----------RERAA
GLPK_BORBU       KI--CDQLKK-EGKDKIILEKTGLVLDSYFSGTKIMWILDNVEGA----------RQRAE
GLPK_LISIN       DI--CKQLRK-DGYEDTIRSKTGLLIDPYFAGTKARWILDHVDGA----------QERAE
GLPK_LISMO       DI--CKQLRK-DGYEDTIRSKTGLLIDPYFAGTKARWILDHVDGA----------QERAE
GLPK_BACHD       GI--CERLRA-EGFSEMVTEKTGLLIDPYFSGTKVRWILDHVDGA----------QERAE
GLPK_THEAQ       GI--CDELKA-KGYDPLFREKTGLLIDAYFSGTKVKWILDHVEGA----------RERAE
GLPK_THETH       GI--CDELKA-KGYDPLFRKKTGLLIDAYFSGTKVKWILDHVDGA----------RERAE
GLPK_BACSU       GI--CEELRE-KGYNDKFREKTGLLIDPYFSGTKVKWILDNVEGA----------REKAE
GLPK_STAAM       SI--CSELKQ-QGYEQTFRDKTGLLLDPYFAGTKVKWILDNVEGA----------REKAE
GLPK_STAAW       SI--CSELKQ-QGYEQTFRDKTGLLLDPYFAGTKVKWILDNVEGA----------REKAE
GLPK_XANAC       DI--CAQLKE-AGHEQMVRDKTGLLIDAYFSGTKVKWILDHVEGA----------RERAQ
GLPK_XANCP       DI--CTQLKE-AGHEQMVRDKTGLLIDAYFSGTKVKWILDHVDGA----------RERAR
GLPK_XYLFA       DI--CDQLTT-AGYQDLVHAKTGLLIDAYFSGTKVKWILDHVENA----------HTQAT
GLPK_ENTCA       PI--ADQLKV-DGHTEMIHEKTGLVIDAYFSATKVRWLLDNIEGA----------QEKAD
GLPK_ENTFA       PI--ADQLKE-DGYSEMIHEKTGLIIDAYFSATKVRWILDHVEGA----------QERAE
GLPK_LACLA       DI--ANGLKE-AGHEELFHKKTGLIVDSYFSATKIRWILDHVEGA----------QERAE
GLPK_STRP1       PI--AEQLKQ-DGHTKMIHEKTGLVIDAYFSATKIRWILDHVPGA----------QERAE
GLPK_STRP8       PI--AEQLKQ-DGHTKMIHEKTGLVIDAYFSATKIRWILDHVPGA----------QERAE
GLPK_STRPN       PL--AEQLKS-QGYVEKFHEKTGLIIDAYFSATKVRWILDHVEGA----------QERAE
GLPK_CLOAB       DI--VEGLKRDKEFSDYVKENTGLILDAYFSATKIKWILDNVEGA----------REKAE
GLPK_CLOPE       DI--CDELKERDGLVDYIRENTGLVLDAYFSGTKIKWILDNVEGA----------REKAE
GLPK_FUSNN       KI--CDELKEIEGFSDYVKDNTGLLVDAYFSGTKIKWILDNVEGA----------RERAE
GLPK_SALTI       NI--CEQLKR-DGLEDYIRDNTGLVVDPYFSGTKVKWILDHVEGS----------RERAK
GLPK_SALTY       DI--CEQLKR-DGLEDYIRDNTGLVVDPYFSGTKVKWILDHVEGS----------RERAK
GLPK_ECOLI       EI--CEHLKR-DGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEGS----------RERAR
GLPK_VIBCH       AI--CEELKE-RGLESYIRDNTGLVLDPYFSGTKIKWILDNVEGA----------REQAE
GLPK_HAEIN       DI--TDKLKA-DGHEEYIRNTTGLVVDPYFSGTKVKWILDNVEGA----------REKAE
GLPK_PASMU       EI--TDKLKA-DGHEDYIRQTTGLVVDPYFSGTKIKWILDNVEGA----------REQAE
GLPK2_PSEAE      AI--CAQLKR-DGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGA----------RERAR
GLPK_PSETO       EIQICQQLKR-DGHEQYINDTTGLVTDPYFSGTKLKWILDNVEGS----------RERAR
GLPK2_THEMA      PI--CDELKE-KGYSEFIRERTGLVIDAYFSGTKIKWILDNVEGV----------REKAE
GLPK_CALS4       PI--CDDLKN-KGFDKKIREKTGLVVDAYFSGTKVKWILDNVEGA----------REKAE
GLPK_MYCGE       AL--CQKFNEDKLIQTKVKQKTGLPINPYFSATKIAWILKNVPLA----------KKLME
GLPK_MYCPN       SL--CDKLNQDTKIKEFVKKHTGLPINPYFSATKIAWILENVPLA----------QKMLK
GLPK_MYCPU       SF--CDQMIAENK-TEFFREKTGLIINPYFSATKLKWILENVPLA----------KEKLA
GLPK_PYRAB       EM--VEEIK-RE-YGDLIKEKTGLIPDAYFSASKIRWLLDNVPRL----------REKAE
GLPK_PYRFU       EM--VEEIK-RE-YSDVIKEKTGLVPDAYFSASKIAWLLDNVPGL----------REKAE
GLPK_THEKO       EM--VEEIK-RE-YGTMIKEKTGLVPDAYFSASKLKWLLDNVPGL----------REKAE
GLPK2_SACS2      NI--TDWLK-EN-YFGMIKDKTGLIPDPYFSGSKIKWILDNLPNV----------RSKAE
GLPK_AQUAE       DI--CRKLS-E--YSEYIKENTGLLLHPYFSASKVNWIIENVNGV----------KKDIE
GLPK1_THEMA      SL--CEEIK-KRGLEGKIKEKTGLVVDPYFSASKIRWILDNVEGV----------KNKAK
GLPK_MYCLE       RI--AVALDR-DGRGEVIRRKAGLPPATYFSGGKLQWILENVDGV----------GAAAE
GLPK_MYCTU       RI--ASALDR-DGRGNLIRRKAGLPPATYFSGGKLQWILENVDGV----------RAAAE
GLPK1_STRCO      AI--AANLER-SGRGDVIRRKAGLPPATYFSGGKIQWILENVDGV----------REAAE
GLPK2_STRCO      AL--CKELGR-NVGQDRFRRETGLPLASYFAGPKARWLLDNVDGL----------RERAE
GLPK_COREF       EI--CRELAG-EEGQQKWLDRTGLLINSYPAGPKIKWILDNVEGV----------RERAE
GLPK_NOSS1       PL--CHQLQE-KGYAQEIYSRTGLVVDAYFSATKLRWLLDYIT--------------GVD
GLPK_SYNY3       HF--CGELTA-AGYVDEIYERTGLVLDAYFSGTKLHWLLDWVKQS----------K-SVD
GLPK_GLOVI       AL--CQKLRA-EGWEAPIRQRTGLVIDAYFSATKLAWLLAHRR---------------PY
GLPK_HALSA       SR--VESLEE-NGKIERIREKTGLEADAYFSATKTEWLLDEAEPLKLSSARASSLRDRAR
                        :             :**   .* :. *  *::                     

GLPK_RHILO       KGELLAGTIDSFLIWRLTGGK--------VHATDATNASRTLVYNIAENAWDDELLAILN
GLPK_RHIME       KGELCFGTIDTFLIWRLTGGE--------CFCTDATNASRTLLYNIAENAWDDELTEVLR
GLPK_AGRFC       KGEICFGTVDSFLIYRLTGGR--------RHVTDATNASRTLIYNIEDNAWDDELLSILN
GLPK_THEBO       RGEVCFGTVDTWLLWNLTGGR--------VHATDPTNASRTLLFHLETLTWDEELLRVLG
GLPK_DEIRA       KGELAFGTIDSWLVYNLTGGE--------LHITDATNASRTLLYNIHTGEWDDELLRILD
GLPK_RALSO       RGELAFGTIDSWLVWQLTRGR--------LHVTDVSNASRTLLWNIHTGQWDADLMRALD
GLPK_BORBU       NGELCFGTIDTWILWNLTQKK--------EHATDYSNASRTLLLNIKTLEWDDELLSILN
GLPK_LISIN       KGELLFGTIDTWLVWKLTGGR--------AHITDYSNASRTLLYNIYDLEWDDELLKMLN
GLPK_LISMO       KGELLFGTIDTWLVWKLTGGR--------AHITDYSNASRTLLYNIYDLEWDDELLKMLN
GLPK_BACHD       RGELLFGTIDTWLIWKLSGGK--------AHVTDYSNASRTLLYNIYEQCWDDELLKMLN
GLPK_THEAQ       RGELLFGTIDTWLIWKLSGGR--------AHVTDYSNASRTLMFNIHTLEWDDELLAILN
GLPK_THETH       RGELLFGTIDTWLIWKLSGGR--------VHVTDYSNASRTLMFNIHTLEWDDELLDILG
GLPK_BACSU       KGELLFGTIDTWLIWKMSGGK--------AHVTDYSNASRTLMFNIYDLKWDDELLDILG
GLPK_STAAM       NGDLLFGTIDTWLVWKLSGKA--------AHITDYSNASRTLMFNIHDLEWDDELLELLT
GLPK_STAAW       NGDLLFGTIDTWLVWKLSGKA--------AHITDYSNASRTLMFNIHDLEWDDELLELLT
GLPK_XANAC       KGELAFGTIDSWLIWNLTGGK--------VHVTDYTNASRTMMFNIHTLQWDAELLAMLD
GLPK_XANCP       KGELAFGTIDSWLIWNLTGGK--------VHVTDYTNASRTMMYNIHTLEWDAELLEMLD
GLPK_XYLFA       RGELAFGTIDTWIIWNLTGGQ--------VHVTDYSNASRTLLYDIHALRWDPDLLTMLD
GLPK_ENTCA       NGELLFGTIDSWLVWKLTDGQ--------VHVTDYSNASRTMLYNIHKLEWDQEILDLLN
GLPK_ENTFA       NGELMFGTIDTWLVWKLT-GD--------THVTDYSNASRTMLFNIHDLDWDQEILDLLN
GLPK_LACLA       RGELLFGTIDTWLLWKLTDGD--------AHYTDYSNASRTMLYNIHELKWDEEILKILN
GLPK_STRP1       KGELLFGTIDTWLVWKLTDGA--------VHVTDYSNAARTMLYNIKDLTWDDEILELLN
GLPK_STRP8       KGELLFGTIDTWLVWKLTDGA--------VHVTDYSNAARTMLYNIKDLTWDDEILELLN
GLPK_STRPN       KGELLFGTIDTWLVWKLTDGA--------AHVTDYSNAARTMLYNIKELKWDDEILEILN
GLPK_CLOAB       KGELLFGTVDTWLVWKLTNGK--------VHVTDYTNASRTMLYNIKELKWDERILRKLN
GLPK_CLOPE       KGELLFGTVDSWLVWKLTNGK--------VHVTDYTNASRTMIFNIKNLQWDERMLKELD
GLPK_FUSNN       KGELLFGTVDTWLIWKLTNGK--------IHATDYTNASRTMLYNIKELKWDEKILETLN
GLPK_SALTI       RGELLFGTVDTWLIWKMTQGR--------VHVTDYTNASRTMLFNIHDLDWDDKMLDVLD
GLPK_SALTY       RGELLFGTVDTWLIWKMTQGR--------VHVTDYTNASRTMLFNIHDLDWDDKMLDVLD
GLPK_ECOLI       RGELLFGTVDTWLIWKMTQGR--------VHVTDYTNASRTMLFNIHTLDWDDKMLEVLD
GLPK_VIBCH       AGQLLFGTVDTWLVWKMTQGR--------VHVTDYTNASRTMLFNINTLQWDEKILAEFN
GLPK_HAEIN       RGELLFGTVDTWLVWKLTQGR--------VHVTDYTNASRTMLFNIHTKQWDDKMLEILN
GLPK_PASMU       RGELLFGTVDTWLVWKLTQGR--------AHVTDYTNASRTMLFNIHTLQWDDNMLAILG
GLPK2_PSEAE      NGDLLFGTIDTWLIWKLTEGK--------VHVTDYTNASRTMLFNIHSRDWDARMLEVLD
GLPK_PSETO       NGELLFGTIDSWLIWKFTGGK--------THVTDYTNASRTMLFNIHTLEWDAKMLEILD
GLPK2_THEMA      KGEVLFGTVDTWLIWNLTGGR--------VHVTDYSNASRTMIFNIHKLDWDDEILELLN
GLPK_CALS4       RGELLFGNIDTWLIWNLTRGK--------VHVTDYSNASRTMLFNIHELKWDKEILEELN
GLPK_MYCGE       QKKLLFGTIDSWLIWKLTNGK--------MHVTDVSNASRTLLFDIVKMEWSKELCDLFE
GLPK_MYCPN       EDKLLAGTIDTWLIWKLTGGK--------MHVTDVSNASRTLLFDITTMTWSQELGDIFK
GLPK_MYCPU       KGKLLAGTIDTWLIWKLTGGK--------VHASDVSNASRTMLFNIHSLDWDQEILDYLK
GLPK_PYRAB       RGEVLFGTVDSFLIYKLTGE----------HVTDYSNASRTMLFNIKKLDWDEELLEIFK
GLPK_PYRFU       KGEVMFGTIDTFLIYRLTGE----------HVTDYSNASRTMLFNINKLEWDEELLEIFK
GLPK_THEKO       KGEVMFGTVDTFLIYRLTGE----------HVTDYSNASRTMLFNIKKLDWDDELLELFD
GLPK2_SACS2      KGEIKFGTIDTYLIWKLTNGK--------IHVTDYSNASRTMLFNINKLEWDREILELLK
GLPK_AQUAE       RGKVIFGTVDTWILWNLTGGK--------VHKTEPSNASRTLLFNIKRLEYDDELLKIFR
GLPK1_THEMA      QGEIAFGTVDSWLIWKLTKGE--------VHATDFSNASRTLLLNIHELRWDEEVLEIFE
GLPK_MYCLE       NGEALFGTPDTWLLWNLTGGPRG-----GVHVTDVTNASRTMLMDLEKLDWDDELLSFFS
GLPK_MYCTU       NGDALFGTPDTWVLWNLTGGPRG-----GVHVTDVTNASRTMLMDLETLDWDDELLSLFS
GLPK1_STRCO      QGHAVFGNTDSWVLWNLTGGPDG-----GIHATDVTNASRTMLMNLETLDWDDELLGFFG
GLPK2_STRCO      AGDLLFGTMDTWVIWNLTGGVNG-----GKHVTDVTNASRTMLMNLHTMAWDEKIAESIG
GLPK_COREF       KGELYFGTMDTWLLWNLTGGIRGDDGEEALHVTDVTNASRTLLMDIHTQQWDPELCEALD
GLPK_NOSS1       LKNVLAGTIDTWILWKLTGG--------KVHATDHSNASRTMLMNLKTGEWDEQLLEILQ
GLPK_SYNY3       PANLLAGTIDSWALWNLTGG--------KVHRTDHSNASRTMVLNLDSLIWDEKLLDLFT
GLPK_GLOVI       YPGLKAGTIDSWIIWKLTGG--------RVHATDTSNASRTMLFNLHTRDWDPELLELLA
GLPK_HALSA       DGELLMGTIDSWLIYNLTGE----------HITDVSNASRTMLYNITDLEWDDWLLEEFD
                       *. *:: ::.::            . :: :**:**:: .:    :.  :   : 

GLPK_RHILO       IPAKLLPQVKDCA---DDYGVTERDLFGAEI----RILGVAGDQHAATIGQACFEPGMMK
GLPK_RHIME       VPKEMLPEVKDCA---ADFGVTDPSLFGAAI----PILGVAGDQQAATIGQACFKPGMLK
GLPK_AGRFC       IPRAMLPEVLDCA---ADFGVTDKALLGAEI----PILGVAGDQQAAVIGNACFEPGMMK
GLPK_THEBO       IPKALLPEVRPSD---GDFGETLPGLLGAPI----PIRGVLGDQQAALLGQAALGAGEGK
GLPK_DEIRA       VPRSVLPEVRNSS---EVYGKTAAGLLGAQV----PIAGIGGDQQAATFGQACLERGMAK
GLPK_RALSO       IHPSLLPEVHPSA---HRFGQTDADWLGAPL----TIGGIAGDQQSALFGQACFKPGMAK
GLPK_BORBU       VPRAILPELKESS---TIYGKTDKALFGAEI----PIAGIAGDQFAATFGQACLKKGMAK
GLPK_LISIN       IPRAMLPEVRPSS---EVYADTVPYHFFGEE---VPVAGIAGDQQAALFGQGCFEKGMAK
GLPK_LISMO       IPKAMLPEVRPSS---EVYADTVPYHFFGEE---VPVAGIAGDQQAALFGQGCFEKGMAK
GLPK_BACHD       VPRAMLPDVRPSS---EVYAETVSYHFFGEE---IPIAGAAGDQQAALFGQACFEKGMAK
GLPK_THEAQ       VPKAMLPEVRPSS---EVYAKTVPHHFFGVE---VPIAGAAGDQQAALFGQACFTEGMAK
GLPK_THETH       VPKAMLPEVRPSS---EVYAKTAPYHFFGVE---VPIAGAAGDQQAALFGQACFTEGMAK
GLPK_BACSU       VPKSMLPEVKPSS---HVYAETVDYHFFGKN---IPIAGAAGDQQSALFGQACFEEGMGK
GLPK_STAAM       VPKNMLPEVKPSS---EIYGKTIDYHFYGQE---VPIAGVAGDQQAALFGQACFECGDVK
GLPK_STAAW       VPKNMLPEVKPSS---EVYGKTIDYHFYGQE---VPIAGVAGDQQAALFGQACFERGDVK
GLPK_XANAC       VPAQMLPEVRSSS---EVYGMTQTQYFYGEQ---VPIAGIAGDQQAALFGQACFEPGMAK
GLPK_XANCP       VPAQMLPEVRSSS---EVYGMTQTQYFYGEQ---VPIAGIAGDQQAALFGQACFEPGMAK
GLPK_XYLFA       IPAAILPDVRSSS---DIYGLTQTPYFHGEQ---IPIAGIAGDQQAALFGQACFEPGMAK
GLPK_ENTCA       IPSSMLPEVKSNS---EVYGHTRSYHFYGSE---VPIAGMAGDQQAALFGQMAFEKGMIK
GLPK_ENTFA       IPRVMLPKVVSNS---EVYGLTKNYHFYGSE---VPIAGMAGDQQAALFGQMAFEPGMVK
GLPK_LACLA       IPASMLPEVKSNS---EVYGVTKGFHFFGSE---VPISGMAGDQQAALFGQMAFEPGMIK
GLPK_STRP1       IPKDMLPEVKSNS---EIYGKTAAFHFYGGE---VPISGMAGDQQAALFGQLAFEPGMVK
GLPK_STRP8       IPKDMLPEVKSNS---EIYGKTAAFHFYGGE---VPISGMAGDQQAALFGQLAFEPGMVK
GLPK_STRPN       IPKAILPEVRSNS---EIYGKTAPFHFYGGE---VPISGMAGDQQAALFGQLAFEPGMVK
GLPK_CLOAB       IPRSMLPEVKNSS---EVYGYTNLGGKGGIR---VPIAGMAGDQQCALFGQTCFEEGSVK
GLPK_CLOPE       IPRSMLPEVKNSS---EIYGYANLGAKGGIR---VPIAGIAGDQQAALFGQAAFNKGDVK
GLPK_FUSNN       IPKSMLPEVKDSS---GTFGYANLGGKGGHR---IPIAGVAGDQQSALFGQACFEEGESK
GLPK_SALTI       IPRAMLPQVRKSS---EVYGQTNIGGKGGTR---IPIAGIAGDQQAALFGQLCVKEGMAK
GLPK_SALTY       IPRAMLPQVRKSS---EVYGQTNIGGKGGTR---IPIAGIAGDQQAALFGQLCVKEGMAK
GLPK_ECOLI       IPREMLPEVRRSS---EVYGQTNIGGKGGTR---IPISGIAGDQQAALFGQLCVKEGMAK
GLPK_VIBCH       IPLSMMPEVKKSS---EVYGQTNIGGKGGTR---IPIAGIAGDQQAALYGQMCVQAGQAK
GLPK_HAEIN       IPRSMLPEVRNSS---EIYGQTNIGGKGGVR---IPVAGIAGDQQAALYGHLCVHAGQAK
GLPK_PASMU       IPRAMLPEVRNSS---EIYGQTNIGGKGGVR---IPVAGMAGDQQAALYGHLCVNAGQAK
GLPK2_PSEAE      IPRSMLPEVRNSS---EVYGNARIGGVGGGE---LPIAGIAGDQQAALFGQMCVEPGQAK
GLPK_PSETO       VPREMLPEVKSSS---EIYGRTKVAS---------PSAAIAGDQQAALFGQMCVRGGQAK
GLPK2_THEMA      IPRAMLPQVMPSS---HVYGYTAKDIFG-VE---IPIAGDAGDQQAALFGQACFQPGMLK
GLPK_CALS4       VPENMLPEVKPSS---HVYGYTDKSIFG-VE---IPIAGDAGDQQAALFGQACFKPGMAK
GLPK_MYCGE       VPVSILPKVLSSN---AYFGDIETNHWSSNAKGIVPIRAVLGDQQAALFGQLCTEPGMVK
GLPK_MYCPN       VPLSILPKVMPSN---AHFGDIVPSHWSTSATGMVPIRGVAGDQQAALFGQLCVEPAMVK
GLPK_MYCPU       IPRSILPKVQASS---EFYGFVQSSLWSNKAKGKVPITGVAGDQQSALFGQMCTEVGMVK
GLPK_PYRAB       IPEGILPEVRESS---EIYGYTR--ILGNE----IPVSGDAGDQQAALFGQAGFETGMVK
GLPK_PYRFU       IPDGILPDVKESS---EIYGYTK--ILGPE----IPVSGDAGDQQAALFGQAAFEEGMVK
GLPK_THEKO       IPESVLPEVRESS---EVYGYTKKELLGAE----IPVSGDAGDQQAALFGQAAFEAGMVK
GLPK2_SACS2      IPESILPEVRPSS---DIYGYTE--VLGSS----IPISGDAGDQQAALFGQVAYDMGEVK
GLPK_AQUAE       IPKNILPEVNESS---SLFGYTDKSITGVE----IPITGILGDQQASLFAHGIRELEEVK
GLPK1_THEMA      IPPEILPELKSSD---SVFGYTDLGFLPKK----IPIVGVMGDSSAALFGQGGFYSGDIK
GLPK_MYCLE       IPRAMLPAIASSSPLQPYGVTLADGPVGGEV----PITGVLGDQHAAMVGQVCLDAGEAK
GLPK_MYCTU       IPRAMLPEIASSAPSEPYGVTLATGPVGGEV----PITGVLGDQHAAMVGQVCLAPGEAK
GLPK1_STRCO      IPRGMLPTINPSSHPEAFGTTRTSRPLRAAV----PITGVLGDQHAATVGQVCFSPGEAK
GLPK2_STRCO      VPMQMLPEIRSSAEVYGEITGGRLGELLGGI----PVASALGDQQAALFGQTCFSEGETK
GLPK_COREF       IPMSLLPEIKPSI---GDYRSVRHRGILADV----PITGVLGDQQAALFGQGGFKEGDTK
GLPK_NOSS1       IPAHILPQIQPSL---GKFGVTDTSLLDAAI----PITAILGDQQAALFGHGCDRPGLMK
GLPK_SYNY3       IPAQIMPEVQPSL---SYFGVTDPEILGVEI----PITAIFGDQQAALYAHGCDRPGLLK
GLPK_GLOVI       IPAEILPAIKPSL---GVLAETDVRVLGYSA----PIAGILGDQQAALFAHGCDRPGLVK
GLPK_HALSA       IPREMLPEVRPSSD-EAVYGHTDPDGFLGAA---VPVTAALGDQQAALFGQTCFDAGDAK
                 :   ::* :                             .  **. .:  .:        *

GLPK_RHILO       STYGTGCFALLNTGSDLVRSKNRLLTTIAYRLNGK-----TTYALEGSIFIAGAAVQWLR
GLPK_RHIME       STYGTGCFALLNTGKDMVRSKNRLLTTIAYRLDGE-----TTYALEGSIFVAGAAVQWLR
GLPK_AGRFC       STYGTGCFALLNTGTDRVASTNRLLTTIAYRLDGV-----TTYALEGSIFIAGAAVQWLR
GLPK_THEBO       CTYGTGAFLLLNTGERPVWAEGGLLTTLAWHLEGK-----AAYALEGSVFVAGAAVGWLR
GLPK_DEIRA       NTYGTGCFMLMNTEGEAVPSQNKLLTTVAWQLDGE-----RTYALEGSVFIGGAVVQWLR
GLPK_RALSO       NTYGTGCFMLLNTGERAVESRNGLISTAACQSGSR-----RSYALEGSVFVGGAVVQWLR
GLPK_BORBU       NTYGTGCFLTVNIGKEPIISHDKLLTSIAWGRKKS-----VTYVLEGSVFIGGAVIQWLR
GLPK_LISIN       NTYGTGCFLLMNTGEKAVRSENGLLTTLAWGLDGK-----VEYALEGSIFVAGSAIQWLR
GLPK_LISMO       NTYGTGCFLLMNTGEKAVRSENGLLTTLAWGIDGK-----VEYALEGSIFVAGSAIQWLR
GLPK_BACHD       NTYGTGCFMLMNTGNQGVKSKHGLLTTIAWGLDGK-----VEYALEGSIFVAGSAIQWLR
GLPK_THEAQ       NTYGTGCFMLMNTGEKAVQSKHGLLTTIAWGIDGK-----VEYALEGSIFVAGSAIQWLR
GLPK_THETH       NTYGTGCFMLMNTGEKAVASKHGLLTTIAWGIDGK-----VEYALEGSIFVAGSAIQWLR
GLPK_BACSU       NTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGK-----VNYALEGSIFVAGSAIQWLR
GLPK_STAAM       NTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGK-----VNYALEGSIFVSGSAIQWLR
GLPK_STAAW       NTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGK-----VNYALEGSIFVSGSAIQWLR
GLPK_XANAC       NTYGTGCFMLMNTGDKAVASKAGLLTTIAWGIDGK-----VEYALEGAIFVAGSVVQWLR
GLPK_XANCP       NTYGTGCFMLMNTGDKAVASKAGLLTTIAWGIDGK-----VEYALEGAIFVAGSVVQWLR
GLPK_XYLFA       NTYGTGCFMLMHTGKKAVESKNGLLTTIAWGLNGE-----IEYALEGSIFVAGSVVQWLR
GLPK_ENTCA       NTYGTGAFIVMNTGEEPQLSDNDLLTTIGYGINGK-----VYYALEGSIFVAGSAIQWLR
GLPK_ENTFA       NTYGTGSFIVMNTGEEPQLSKNNLLTTIGYGINGK-----VYYALEGSIFVAGSAIQWLR
GLPK_LACLA       NTYGTGSFIVMNTGEKPHISKNNMLTTIGYGINGK-----VYYALEGSIFVAGSSIQWLR
GLPK_STRP1       NTYGTGSFIIMNTGDEMQLSSNNLLTTIGYGINGK-----VHYALEGSIFIAGSAIQWLR
GLPK_STRP8       NTYGTGSFIIMNTGDEMQLSSNNLLTTIGYGIGGK-----VHYALEGSIFIAGSAIQWLR
GLPK_STRPN       NTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGK-----VYYALEGSIFIAGSAIQWLR
GLPK_CLOAB       NTYGTGCFLLMNTGENIIQSKNGLVTTIAIGLEGK-----VQYALEGSVFVGGAVIQWIR
GLPK_CLOPE       NTYGTGCFLLMNTGEELVKSKSGLLTTIAIGLHGK-----VQYALEGSVFVGGAVIQWLR
GLPK_FUSNN       NTYGTGCFLLMNTGEKFVKSNNGLITTIAIGLNGK-----VQYALEGSVFVGGASVQWLR
GLPK_SALTI       NTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGE-----VNYALEGAVFMAGASIQWLR
GLPK_SALTY       NTYGTGCFMLMNTGEKAVKSENGLLITIACGPSGE-----VNYALEGAVFMAGASIQWLR
GLPK_ECOLI       NTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGE-----VNYALEGAVFMAGASIQWLR
GLPK_VIBCH       NTYGTGCFLLMNTGQEKVTSHNGLLTTLACGPRGE-----PAYALEGAVFMGGASIQWLR
GLPK_HAEIN       NTYGTGCFMLLHTGNKAITSKNGLLTTIACNAKGE-----PEYALEGSVFIAGASIQWLR
GLPK_PASMU       NTYGTGCFMLMHTGDNAVQSQNGLLTTIACNAKGE-----PAYALEGSIFMGGASIQWLR
GLPK2_PSEAE      NTYGTGCFLLMHTGDKAVKSTHGLLTTIACGPRGE-----VGYALEGAVFNGGSTVQWLR
GLPK_PSETO       NTYGTGCFLLMNTGDKAVKSKHGMLTTIACGPRGE-----VAYALEGAVFNGGSTVQWLR
GLPK2_THEMA      NTYGTGCFLLMNTGEKAFESKSGLLTTIAWGINGK-----VYYALEGSIFITGAAVQWLR
GLPK_CALS4       NTYGTGCFMLMNTGEKAVPSKTGLLTTIAWGIDGK-----VEYALEGSIFITGAAIQWLR
GLPK_MYCGE       NTYGTGCFVLMNIGDKPTLSKHNLLTTVAWQLENHP----PVYALEGSVFVAGAAIKWLR
GLPK_MYCPN       NTYGTGCFMLMNIGNELKYSQHNLLTTVAWQLENQK----PVYALEGSVFVAGAALKWLR
GLPK_MYCPU       NTYGTGCFTLVNTGQKPVNSKNRLLTTIAWKLGNEK----TIYALEGSVFVAGAAIQWLR
GLPK_PYRAB       ATYGTGNFILVNTGKTVRYSEN-LLTTIAWGLDGK-----VTYALEGSIFITGAAVQWLR
GLPK_PYRFU       ATYGTGNFILANTGRMLLYSDN-LLTTVAWGINGK-----VNYALEGSIFITGAAVQWLR
GLPK_THEKO       ATYGTGSFILVNTDKMVLYSDN-LLTTIAWGLNGR-----VSYALEGSIFVTGAAVQWLR
GLPK2_SACS2      STYGTGSFILMNIGSNPIFSEN-LLTTIAWGLESKR----VTYALEGSIFITGAAVQWFR
GLPK_AQUAE       NTYGTGLFLMLLTGSKPIIPER-LLGTVAWVINGK-----VNYAIEGSVLTGGACIKWLM
GLPK1_THEMA      VTYGTGSSTMLNIGEKPNVSDSPIVCSVGWVVKET-----SSYVLEGNIHSAGDTIVWLK
GLPK_MYCLE       NTYGTGNFLLLNTGEAIVRSGNGLLTTVCYQFGDA----KPVYALEGSIAVTGSAVQWLR
GLPK_MYCTU       NTYGTGNFLLLNTGETIVRSNNGLLTTVCYQFGNA----KPVYALEGSIAVTGSAVQWLR
GLPK1_STRCO      NTYGTGNFLVLNTGTELVRSQHGLLTTVAYQFGDN----PPVYALEGSIAVTGSAVQWLR
GLPK2_STRCO      STYGTGTFMVMNTGDKLINSYSGLLTTVGYKIGDQ----DTVYALEGSIAVTGSLVQWMR
GLPK_COREF       NTYGTGLFLVMNTGPELKISEHGLLSTIAYQIEGQ----DPVYALEGSVSMGGSLVQWLR
GLPK_NOSS1       CTYGTGSFLVAHTGSNIVRSQHQLISTIAWTQADKQENINIGYALEGSMFTSGACIQWLR
GLPK_SYNY3       CTYGTGAFLVANTGQTVTRSQHRLLSTVAWTQTNRDKSLTRDYALEGSMFTAGSCVQWLR
GLPK_GLOVI       CTYGTGSFLVAHTGDRPIRSRHQLLTTVAWSDRT-----STGYALEGALFTTGASVQWLR
GLPK_HALSA       NTYGTGSFYLMNTGEDAVSSEHGLLTTIGFQLSGEP----VQYALEGSIFVTGAAIEWLE
                  *****             .   :: :               *.:** :   *  : *: 

GLPK_RHILO       DGIKVIGKAEQSGKLADEADPT-QNVYLVPAFVGLGAPHWDAEARGAIFGLTRNSGPAEF
GLPK_RHIME       DGLKVIKAAPDTGSLAESADPS-QEVYLVPAFTGLGAPHWDPDARGAIFGMTRNTGPAEF
GLPK_AGRFC       DELGFISVASEVSALAEKADPK-QRVYLVPAFTGLGAPYWDAEARGAIFGLTRGTGPAEF
GLPK_THEBO       E-VGLLGESHEVESLARQVEDA-GGVYFVPAFTGLGAPHWDPYARGAILGLTRGTTRAHL
GLPK_DEIRA       DGLNIIRSSTEIEALARTVDSS-EGVMLVPAFVGLGAPYWDAYARGTMVGITRGTTKAHI
GLPK_RALSO       DGLRAIQRSADVEGLAASVPDS-GGVVFVPSFTGLGAPYWDPTAQGAIVGLSRGTTIGHI
GLPK_BORBU       DGLEFFRKSSDAEALASSVSDN-GGVYFVPAFVGLGAPHWDSYARGTIIGITRGSTKAHI
GLPK_LISIN       DGLRMVRQSSDSENYASRIESS-DGVYVVPAFVGLGAPYWDSDVRGAVFGLTRGTEKEQF
GLPK_LISMO       DGLRMVRQSSDSENYASRIESS-DGVYVVPAFVGLGAPYWDSDVRGAVFGLTRGTEKEQF
GLPK_BACHD       DGLRMMKSAKESEGYATKVTSA-DGVYVVPAFVGLGTPYWDSDVRGAVFGLTRGTSKEHF
GLPK_THEAQ       DGLRMIKTAADSEAYAEKVEST-DGVYVVPAFVGLGTPYWDSEVRGAVFGLTRGTTKEHF
GLPK_THETH       DGLRMIKTAADSETYAEKVEST-DGVYVVPAFIGLGTPYWDSEVRGAVFGLTRGTTKEHF
GLPK_BACSU       DGLRMFQDSSLSESYAEKVDST-DGVYVVPAFVGLGTPYWDSDVRGSVFGLTRGTTKEHF
GLPK_STAAM       DGLRMINSAPQSESYATRVDST-EGVYVVPAFVGLGTPYWDSEARGAIFGLTRGTEKEHF
GLPK_STAAW       DGLRMINSAPQSESYATRVDST-EGVYVVPAFVGLGTPYWDSEARGAIFGLSRGTEKEHF
GLPK_XANAC       DGLRMLGKASDSQAYAERAGDN-DGVYIVPAFVGLGAPYWRSDIRGAVFGLTRGTTKEHF
GLPK_XANCP       DGLRMFGKASDSQAYAERAGDN-DGVYFVPAFVGLGAPYWRSDIRGAVFGLTRGTSKEHF
GLPK_XYLFA       DGLRMFGKASDSQAYADRVSDN-GGVYVVPAFVGLGAPYWRSDVRGAVFGLTRSTTKEHF
GLPK_ENTCA       DGLRMIETSPQSEELAAKAKGD-NEVYVVPAFTGLGAPYWDSEARGAVFGLTRGTTKEDF
GLPK_ENTFA       DGLKMLQTAAESEAVAKASTGH-NEVYVVPAFTGLGAPYWDSQARGAVFGLTRGTTREDF
GLPK_LACLA       DGLKMLERASDSEEVALQSRSQ-DEVYVVPAFVGLGAPYWDQEARGAMFGLTRGTTKEDI
GLPK_STRP1       DGLKMIETSPESEQFALASTSD-DEVYVVPAFTGLGAPYWDSNARGSVFGLTRGTSKEDF
GLPK_STRP8       DGLKMIETSPESEQFALASTSD-DEVYVVPAFTGLGAPYWDSNARGSVFGLTRGTSKEDF
GLPK_STRPN       DGLRMVENSPESEKYARDSHNN-DEVYVVPAFTGLGAPYWNQNARGSVFGLTRGTSKEDF
GLPK_CLOAB       DELKLVSDAADTEYFAKKVNDN-GGVYVVPAFTGLGAPYWDMYARGAIFGLTRGANKNHI
GLPK_CLOPE       DELRIISDSSDTEYFATKVEDN-GGVYVVPAFVGLGAPYWDMYARGTIVGLTRGTNRNHI
GLPK_FUSNN       DELKLISDSKDTEYFARKVKDS-AGVYVVPAFVGLGAPYWDMYARGAILGLTRGANKNHI
GLPK_SALTI       DEMKLISDAFDSEYFATKVKDT-NGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHI
GLPK_SALTY       DEMKLISDAFDSEYFATKVKDT-NGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHI
GLPK_ECOLI       DEMKLINDAYDSEYFATKVQNT-NGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHI
GLPK_VIBCH       DELKLISDARDSEYFATKVDTS-NGVYVVPAFTGLGAPYWDAYARGTIVGLTRGVNSNHI
GLPK_HAEIN       DELKIVHDSFDSEYFAQKVTDS-NGVYVVPAFTGLGAPYWDPYARGAIFGLSRGANRNHI
GLPK_PASMU       DELKIVHDSYDSEYFATRVPDC-NGVYVVPAFTGLGAPYWDPYARGAIFGLSRGANRNHI
GLPK2_PSEAE      DELKVINDSFDSEYFATKVKDS-NGVYLVPAFTGLGAPYWDPYARGAVFGLTRGVKADHL
GLPK_PSETO       DELKIIADATDTEYFAGKVKDS-NGVYLVPAFTGLGAPYWDPYARGALFGLTRGVRVDHI
GLPK2_THEMA      DGLKIISNAAETEELATKVPDN-GGVFFVPAFVGLGAPYWDMYARGLIIGITRGTTREHI
GLPK_CALS4       DELRIIDNAPQSEEYALKVEDT-NGVYVVPAFVGLGAPYWDMYARGVIVGLTRGAKREHI
GLPK_MYCGE       DALKIIYSEKESDFYAELAKENEQNLVFVPAFSGLGAPWWDASARGIILGIEASTKREHI
GLPK_MYCPN       DSLKVMYSAAESDFYAKLAQKEEQEVVFVPAFTGLGAPYWDASARGAIFGIEANTKREHL
GLPK_MYCPU       DSLRILYNAALSDFYSSLVKDN-QRVYVVPAFTGLGAPYWDSYAKGAIFGLERGTKNEHI
GLPK_PYRAB       DGIKIIKHASETEDLAEKLESN-EGVYFVPAFVGLGAPYWDQFARGLIIGITRGTGREHL
GLPK_PYRFU       DGIKIISNAAETEELATKLESN-EGVYFVPAFVGLGAPYWDQFARGLIIGITRGTGREHL
GLPK_THEKO       DGIKIIKHASETEELATKLESN-EGVYFVPAFVGLGAPYWDQFARGIIIGITRGTGREHL
GLPK2_SACS2      DGLRAIDASDDIEPLAASVPDT-GGVYFVPAFVGLGAPYWDPYARGLIIGITRGTTKAHI
GLPK_AQUAE       DRLKLIKQAADTEYLAKSISSN-EGVYFVPAFSGLGAPYWDASARGIIIGITGRTRIEHI
GLPK1_THEMA      EKLGIISDPSETEKIALSLENN-GGVYLVPAFVGLGAPYWRSDVKAAILGLQRNHGKEHV
GLPK_MYCLE       DQLGIISGAAQSESLARQVVDN-GGVYFVPAFSGLFSPYWRSDARGAIVGLSRFNTNAHL
GLPK_MYCTU       DQLGIISGAAQSEALARQVPDN-GGMYFVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHL
GLPK1_STRCO      DQMKIIKTAAESEELARTVEDN-GGMYFVPAFSGLFAPYWRSDARGAIVGLARYNDNAHL
GLPK2_STRCO      DQMGLISTAAEIETLALTVEDN-GGAYFVPAFSGLFAPYWRSDARGVIAGLTRYVTKAHL
GLPK_COREF       DSLQMIPTAPAIEEFARQVPDN-GGVHIVPAFSGLFAPRWHPEARGVITGLTRFANRNHI
GLPK_NOSS1       DGIKLIKTAAETETMANQVADN-GGVYFVPAFSGLGAPYWDMNARGAFFGITASVQPQHL
GLPK_SYNY3       DKLGLIESAAASESLARSVDSN-GGVYFVPALSGLGAPHWDMNACGAFLGLTAGVTKAHL
GLPK_GLOVI       DGLGIIETADESEALAASVPDS-GGVYFVPALSGLGAPHWDMGARGLLIGLTRGSGRGQI
GLPK_HALSA       D-VDLINNAAQTAELASSVDTT-DGVYMVPAFTGLGAPHWDGRARGTLVGMTRGTRKAHI
                 : :  .         :           .**:: ** :* *     . . *:       ..

GLPK_RHILO       ARAALEAVAYQTRDLLDAMRKDWKGTSAKTVLRVDGGMVASDWTMQRLADILDAPVDRPT
GLPK_RHIME       ARAALEAVCYQTRDLLEAMHKDWRRNGNDTVLRVDGGMVASDWTMQRLSDLLDAPVDRPV
GLPK_AGRFC       ARAALESVAYQTFDLLDAMRKDWAGDNGKTVLRVDGGMVASDWTMQRLADILAAPVDRPV
GLPK_THEBO       ARAALEGVAFSVGEVAWAMAG--AAGLGLKALKADGGMAQNDLFLEIQADLLGVPVLRPR
GLPK_DEIRA       ARAALEAVAYQSAELLEAMQKD-SGVEL-KELRVDGGASTNDLMMQFQADILGVPVIRPK
GLPK_RALSO       ARAALESIAFQSTALLQAMTRD-AVSAI-TELRVDGGASANNLLLQFQADLLGIPVVRPE
GLPK_BORBU       TRAALESIAFQSFDILNTMKKSIPNFEI-QELRVDGGASQNNLLMQFQADLLECKVVRPK
GLPK_LISIN       IRATLESLAYQTRDVLYAMEQD--SGISLKTLRVDGGASANNFLMQFQSDILGVPVERPE
GLPK_LISMO       IRATLESLAYQTRDVLYAMEQD--SGISLKTLRVDGGASANNFLMQFQSDILGVPVERPE
GLPK_BACHD       IRATLESLAYQTKDVLQAMEAD--SGISLKTLRVDGGAVANNFLMQFQSDLLGVSVERPT
GLPK_THEAQ       IRATLESLAYQTKDVLAAMEAD--SGISLTTLRVDGGAVKNNFLMQFQSDLLAVPVERPV
GLPK_THETH       IRATLESLAYQTKDVLAVMEAD--SGISLTTLRVDGGAVKNNFLMQFQSDLLAVPVERPV
GLPK_BACSU       IRATLESLAYQTKDVLDAMEAD--SNISLKTLRVDGGAVKNNFLMQFQGDLLNVPVERPE
GLPK_STAAM       IRATLESLCYQTRDVMEAMSKD--SGIDVQSLRVDGGAVKNNFIMQFQADIVNTSVERPE
GLPK_STAAW       IRATLESLCYQTRDVMEAMSKD--SGIDVQSLRVDGGAVKNNFIMQFQADIVNTSVERPE
GLPK_XANAC       VRAAVESMAYQTRDVLTAMQSD--SGIELKELRADGGAIANDFMAQFQSDILNVPVLRPE
GLPK_XANCP       VRAAVESMAYQTRDVLTAMQSD--SGIELKELRADGGAIANDFMAQFQSDILNVPVLRPE
GLPK_XYLFA       IRAALESMAYQTRDVLSAMQAD--AGMELKELRTDGAAITNDFMAQFQSDILAVPVLRSE
GLPK_ENTCA       VRATLQAVAYQSKDVIDTMKKD--SGIDIPLLKVDGGAAKNDLLMQFQADILDIDVQRAA
GLPK_ENTFA       VKATLQAVAYQVRDIIDTMKED--TGIDIPVLKVDGGAANNDFLMQFQADILNTAVQRAH
GLPK_LACLA       VKATLQGIAYQVRDVVSTMKED--TGIDMSVLKVDGGAANNEYLMQFQADILNIPIQRAG
GLPK_STRP1       VKATLQSIAYQVRDVIDTMQVD--SGIDIQQLRVDGGAAMNNMLMQFQADILGIDIARAK
GLPK_STRP8       VKATLQSIAYQVRDVIDTMQVD--SGIDIQQLRVDGGAAMNNMLMQFQADILGIDIARAK
GLPK_STRPN       IKATLQSIAYQVRDIIDTMQVD--TQTAIQVLKVDGGAAMNNFLMQFQADILGIDIARAK
GLPK_CLOAB       IRAALEAIAYQSRDLIDAMKED--SGCEITRIKVDGGASRNNLLMQFQADITGTEVVRPI
GLPK_CLOPE       IRAALESIAYQTRDVLEAMIND--VGYDINCIKVDGGASRNNFLMQFQSDLVGKKVIKPI
GLPK_FUSNN       IRATLESIAYQTKDVLKAMEED--SGIKLNGLKVDGGAAANNFLMEFQADILGESVKRPT
GLPK_SALTI       IRATLESIAYQTRDVLEAMQAD--SGIRLHALRVDGGAVANNFLMQFQSDILGTRVERPE
GLPK_SALTY       IRATLESIAYQTRDVLEAMQAD--SGIRLHALRVDGGAVANNFLMQFQSDILGTRVERPE
GLPK_ECOLI       IRATLESIAYQTRDVLEAMQAD--SGIRLHALRVDGGAVANNFLMQFQSDILGTRVERPE
GLPK_VIBCH       IRATLESIAYQTRDVLDAMQAD--SGIKLSALRVDGGAVANNFLMQFQADVLDTEVHRPK
GLPK_HAEIN       VRATLESIAYQTRDVLEAMQSD--SGERLQYLRVDGGATNNNFLMQFQADILDVNVERPV
GLPK_PASMU       VRATLESIAYQTRDVLEAMQSD--SGQTLQALRVDGGATENNFLMQFQADILATKVERPK
GLPK2_PSEAE      IRATLESIAYQTRDVLDAMQRD--AGERLRALRVDGGAVANNFLMQFQADILGTRVERPV
GLPK_PSETO       IRAALESIAYQTRDVLDAMQQD--SGERLKALRVDGGAVANNFLMQFQADILGTQVERPQ
GLPK2_THEMA      VRAVLESIAYQTRDVVEVMEKD--SDIKVETLRVDGGAVVNNFLMQFQADILGVPVERPV
GLPK_CALS4       IRATLESIAYQTRDVLEAMQED--SGIKLQALKVDGGASANNFLMQFQADILGVPVDRPQ
GLPK_MYCGE       VKASLESIAFQTNDLLNAMASD--LGYKITSIKADGGIVKSNYLMQFQADIADVIVSIPK
GLPK_MYCPN       VKATLEAIAFQANDLIKAMASD--LNSSIKKIKADGGACNSNYLMQFQADIANLEVIIPK
GLPK_MYCPU       IKATLESIAYQSNDLIKAMEKD--LGQKITLLKVDGGASKSDYLMNFQASISNLDVHRPA
GLPK_PYRAB       ARATLEAIAYLTRDVIEEMEKL----VGIKELRVDGGATANDFLMQFQADILNRRVVRPV
GLPK_PYRFU       ARATLEAIAYLTRDVIEEMEKL----IQIKELRVDGGATVNNFLMQFQADILNKKVIRPV
GLPK_THEKO       ARATLEAIAYLTRDVVDEMEKL----VQIKELRVDGGATANDFLMQFQADILNRKVIRPV
GLPK2_SACS2      ARAILESIAYQNRDVIEIMEKE--SGTKINILKVDGGGAKDNLLMQFQADILGIRVVRPK
GLPK_AQUAE       ARAALEAIAYQTRDVIEEMEKE--TGVKIKILKADGGASQNNFLMQFQADILGIPVERPR
GLPK1_THEMA      VRAALESIAYQVRDIFEEMVRI--SSKEPTEVRADGGITRNRFLMQFQADILNIPVLVSN
GLPK_MYCLE       ARATLEAICYQSRDVVDAMAAD--SGVRLDVLKVDGGITSNDLCMQIQADVLGVDVVRSV
GLPK_MYCTU       ARATLEAICYQSRDVVDAMEAD--SGVRLQVLKVDGGITGNDLCMQIQADVLGVDVVRPV
GLPK1_STRCO      ARATLEAICYQSRDVVVAMEQD--SSVHLDVLRVDGGVTANDLCMQIQADILGVPVSRPV
GLPK2_STRCO      ARAVLEATAWQTREIADAMTKD--SGVELTALKVDGGMTSNNLLMQTLADFVDAPVVRPM
GLPK_COREF       CRAVLEATAFQTREVVDAMARD--AGKELESLRVDGAMVQNELLMQMQADILGIDVIRPG
GLPK_NOSS1       VRAVLEAIAYQVLEVVQAINAS--CSSPMQRLIVDGGACENNFLMQFQADVLGIPVERPT
GLPK_SYNY3       VRSVLEAIAFQAREVVEAINQD--SPAPIQQLKVDGGACNNDFLMQCQADVLGIPVERPA
GLPK_GLOVI       ARAVLEAIAFQTREVTDALAAD--MGTPLTRLKVDGGAVRNNLLMQLQADVLGVPVERPQ
GLPK_HALSA       VRATLESIAYQTRDIAAAMEAD--SGVSTTTLRVDGGAVKNNFLCQLQSDIIQTDLARPE
                  :: ::. .:    :   :            : .**.   .    :  ...    :  . 

GLPK_RHILO       ILETTALGAAWLAGSKAGVWPKAKEFAKSWALER-RFKPEMDIATRSAKLAGWRDAVRRT
GLPK_RHIME       ILETTALGVAWLAGSRAGVWPNQEAFAKSWARDR-RFEPHMDEATRKVKLKGWRSAVKRT
GLPK_AGRFC       FLETTILGAAWLAASRAGIWPDRKAFADHWRRDR-RFSPDMEESERKNAIAGWRDSVGRC
GLPK_THEBO       VTETTALGAAWARGIGAGAL-SLGDLPALWREEA-RFLPRMPEARREALYRGWRRAVERA
GLPK_DEIRA       VTETTALGAAYLAGLAVGYWKSTDDIAHQWQEDK-RFEPQMSEEERSKLMRRWKKAVARA
GLPK_RALSO       IIETTALGAAYLAGIATGFYRSEDEVARQWRASR-TFHPVISRDEAQHRMAQWEMAVAQV
GLPK_BORBU       ITETTALGAAYLAGLATGYWQSAEEIVSLWQVDK-IFEPSMPKNQKEKLLENWNKAVGKA
GLPK_LISIN       NKETTVLGAAFLAGLAVGVWKDKNEIKKHWKLDK-RFEVEMKDDQREDLYEGWHKAVKAA
GLPK_LISMO       NKETTVLGAAFLAGLAVGVWKDKNEIKKHWKLDK-RFEVEMKEEQREDLYEGWHKAVKAA
GLPK_BACHD       VQETTALGAAYLAGLAVGFWTSKEEITNNWNLEQ-KFSAEMEETDRAKLYEGWQKAVRAA
GLPK_THEAQ       INETTALGAPYLAGLAVGYWNSRDDIAAQWQLER-RFEPKMDDDKRTMLYDGWKKAVRAA
GLPK_THETH       VNETTALGAAYLAGLAVGYWNSRDDIAAQWQLER-RFEPKMDDDKRTMLYDGWKKAVRAA
GLPK_BACSU       INETTALGAAYLAGIAVGFWKDRSEIANQWNLDK-RFEPELEEEKRNELYKGWQKAVKAA
GLPK_STAAM       IQETTALGAAFLAGLAVGFWESKDDIAKNWKLEE-KFDPKMDEGEREKLYRGWKKAVEAT
GLPK_STAAW       IQETTALGAAFLAGLAVGFWESKDDIAKNWKLEE-KFDPKMDEGEREKLYRGWKKAVEAT
GLPK_XANAC       VAETTALGAAYLAGLATGFWSSREEIAKQWAVDR-RFEPAMADDKRQALYAGWQQAVEAT
GLPK_XANCP       VAETTALGAAYLAGLATGFWSSREEIAKQWAVDR-RFEPNMPEERREQLYAGWQQAVEAT
GLPK_XYLFA       IAETTALGAAYLAGLATGFWSSREEITQHWAINL-CFKPQMDKQQREHLYAGWKQAVAAT
GLPK_ENTCA       NLETTALGAAYLAGLAVGFWKDLDELKSMAEEGQ-MFTPEMPAEERDNLYEGWKQAVAAT
GLPK_ENTFA       NLETTALGAAFLAGLAVGFWKDLEEIKAFQEEGQ-QFEPIMAEEEREDLYEGWQQAVAAT
GLPK_LACLA       DLETTALGAAFLAGLAVGFWKDLEELKESYEPGK-IFQTQMQEERREELYAGWKKAVNAT
GLPK_STRP1       NLETTALGAAFLAGLAVGYWEDMDALKELNATGQ-LFKASMNESRKEKLYKGWKRAVKAT
GLPK_STRP8       NLETTALGAAFLAGLAVGYWEDMDALKELNATGQ-LFKASMNESRKEKLYKGWKRAVKAT
GLPK_STRPN       NLETTALGAAFLAGLSVGYWKDLDELKLLNETGE-LFEPSMNESRKEQLYKGWKKAVKAT
GLPK_CLOAB       ITETTALGAAYLAGLAVGFWKSKEEIAEKWSVSE-VYTPNLDEDEKIRLYNGWKRAVERV
GLPK_CLOPE       ITETTALGAAYLAGLAVGYWSDKEEIAKLWFASE-EFEPTISEERRNKYHKKWKKAVERS
GLPK_FUSNN       VLETTALGAAYLAGLAVGFWENKNEIKQKWVLDK-EFTPNMPKEERDKKYAGWLKAVERT
GLPK_SALTI       VREVTALGAAYLAGLAVGYWQNLDELQEKAVIER-EFRPGIETTERNYRYSGWKKAVKRA
GLPK_SALTY       VREVTALGAAYLAGLAVGYWQNLDELQEKAVIER-EFRPGIETTERNYRYSGWKKAVKRA
GLPK_ECOLI       VREVTALGAAYLAGLAVGFWQNLDELQEKAVIER-EFRPGIETTERNYRYAGWKKAVKRA
GLPK_VIBCH       VTEVTALGAAYLAGLAVGFWDGLEELQGKAEIDR-SFKPHHDEEKRQRRYKGWKRAVKCA
GLPK_HAEIN       VKEVTALGAAYLAGLATGFWKDLDELRDKARVER-TFSPDSDNEKRERRYKGWKKAVKRS
GLPK_PASMU       VKEVTALGAAYLAGLATGFWKDLSELRDKASIEK-TFVPDGDEAKRTRRYKGWKKAVKRA
GLPK2_PSEAE      MRETTALGAAYLAGLACGFWSSLDELKSKAVIER-VFEPECDEPRREKLYAGWKKAVERT
GLPK_PSETO       MRETTALGAAYLAGLACGFWGSLEELRGKAVIER-EFEPQLDEAAKEKLYAGWQKAVSRT
GLPK2_THEMA      VNETTALGAAYLAGLAVGYWKDQEEIASLWQLDR-RFEPSMNSEERERLYSKWKEAVSRS
GLPK_CALS4       VIETTALGAAYLAGLAVGFWNSREEIEKNWNIDR-RFEPAMEEEKREKLYRGWKKAVERA
GLPK_MYCGE       NKETTAVGVCFLAGLACGFWKDIHQLEKLTTLDK-KFKSTMDPNIRKTKINSWHKAVERA
GLPK_MYCPN       NVETTTMGAAFLAGLAVNYWKDTKQLEKLTGIAK-QFKSQMNQTVREKKSKRWNEAVKRT
GLPK_MYCPU       NVETTALGAAYLAGLAVGFWKDIKEIQKMIKIDH-QFKPSVDQKEVDVLLKGWNEAVKRV
GLPK_PYRAB       VKETTALGAAYLAGLAVDYWESLEEIESLWRVEK-IFEPRMDEETREKLYRGWKEAVKRA
GLPK_PYRFU       VKETTALGAAYLAGLAVDYWESMEEISQLWRAER-VFEPQMDEKTREKLYRGWKEAVKRA
GLPK_THEKO       VKETTALGAAYLAGLAVDYWADTREIAELWKAER-IFEPKMDEKTRERLYKGWKEAVKRA
GLPK2_SACS2      VMETASMGVAMLAGLAINYWNSLNELKQKWTVDK-EFIPSINKEERERRYNAWKEAVKRS
GLPK_AQUAE       HVELTALGAAGIAGIYSGMWKSKEEFIEDTREVELTFSPEMKKEERELYYSKWKDAVKRA
GLPK1_THEMA      IEEVSARGVAFVALLHLGAFSDLEEIRQKITYRE-KYEPRMGDELREMYYEGWKTAIRKL
GLPK_MYCLE       VAETTALGSAYAAGLAVGFWAGPSDLRANWQEDK-RWTPTWGEDQRAAAYAGWRKAVQRT
GLPK_MYCTU       VAETTALGVAYAAGLAVGFWAAPSDLRANWREDK-RWTPTWDDDERAAGYAGWRKAVQRT
GLPK1_STRCO      VAETTALGAAYAAGLATGFWRHTDELRTHWSESR-RWEPQWSEERRAQGYAGWKMAVERT
GLPK2_STRCO      VAETTCLGAAYAAGLAVGFWNSTDDLRANWRRAA-EWTPRMDADIRDREYKSWLKAVERT
GLPK_COREF       DIETTALGTAFAAGLGSGFFKDFDQIIELISIRQ-TWTPEMTEAERERAYDAWNEAVTHA
GLPK_NOSS1       MRDTTVQGAAFAAGLAVGFWDSYTALVNQRQIDR-IFEPGEGSQNATANFAIWQKAVKRS
GLPK_SYNY3       VLDATAQGAAFGAGLKIGWNQLQIRFF------R-TFHHGTISL-ICLQFLPMRIQEGVS
GLPK_GLOVI       LIDTTAQGAAFAAGLGTGFWGDYAELVAARPIDR-VFESGERQLVLQAHYAVWQRAVERS
GLPK_HALSA       VDETTALGAAYAAGLAVGYWDSLDDLRENWRVDR-SFEPEMDPSEADSKYGRWEDAVDRS
                   : :  *         .       .          :                       

GLPK_RHILO       LSA-----------
GLPK_RHIME       LIAA----------
GLPK_AGRFC       LSKRDN--------
GLPK_THEBO       KGWVQEG-------
GLPK_DEIRA       RDWEDDSEA-----
GLPK_RALSO       RLPTTHGH------
GLPK_BORBU       KSWIQNSHSS----
GLPK_LISIN       QAFK----------
GLPK_LISMO       QAFK----------
GLPK_BACHD       QAFK----------
GLPK_THEAQ       MAFK----------
GLPK_THETH       MAFK----------
GLPK_BACSU       MAFK----------
GLPK_STAAM       QVFKTE--------
GLPK_STAAW       QVFKTE--------
GLPK_XANAC       MGFRIS--------
GLPK_XANCP       MGFRIS--------
GLPK_XYLFA       LGFRVA--------
GLPK_ENTCA       QTFKFKAKKEGE--
GLPK_ENTFA       QQFKRKNK------
GLPK_LACLA       RAFK----------
GLPK_STRP1       QVFTQEEDADDDAK
GLPK_STRP8       QVFTQEEDADDDAK
GLPK_STRPN       QVFAEVDD------
GLPK_CLOAB       QGWEE---------
GLPK_CLOPE       KGWALED-------
GLPK_FUSNN       KKWEE---------
GLPK_SALTI       MAWEEHDK------
GLPK_SALTY       MAWEEHDK------
GLPK_ECOLI       MAWEEHDE------
GLPK_VIBCH       QAWAVLHNEEE---
GLPK_HAEIN       LEWAKEDEE-----
GLPK_PASMU       LEWEKEEE------
GLPK2_PSEAE      RGWDDGEL------
GLPK_PSETO       RDWEPHEGAE----
GLPK2_THEMA      LGWEKR--------
GLPK_CALS4       MKWAEE--------
GLPK_MYCGE       LKWKEID-------
GLPK_MYCPN       LKWASLD-------
GLPK_MYCPU       LNWQKDIE------
GLPK_PYRAB       MGWAKVISS-----
GLPK_PYRFU       LGWAKVVS------
GLPK_THEKO       MGWAKVVDSAKSN-
GLPK2_SACS2      LGWEKSLGSK----
GLPK_AQUAE       MKWSML--------
GLPK1_THEMA      LTE-----------
GLPK_MYCLE       LDWVDVS-------
GLPK_MYCTU       LDWVDVS-------
GLPK1_STRCO      LDWVKVPES-----
GLPK2_STRCO      MGWLEDEE------
GLPK_COREF       YPR-----------
GLPK_NOSS1       LDWV----------
GLPK_SYNY3       VDQ-----------
GLPK_GLOVI       REWVR---------
GLPK_HALSA       LAWATED-------