CLUSTAL format seed alignment for MF_00190

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CLSA_BUCAI            -----------MDIFYNLIKCLIFSTYWLLIANITFRVLIKRRNIPYSMSWLLTIYIIPF
CLSA_BUCAP            -----------MDIFYDLIKWLVVLIYWLLIANITYRILIKRRSIPSSMSWLLTIYIIPF
CLSA_YERPB            -----------MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_YERPE            -----------MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_YERPY            -----------MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_KLEP3            -----------MTTFYTVVNWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_KLEP7            -----------MTTFYTVVNWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_ECOLI            -----------MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_SHIDS            -----------MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_SHIB3            -----------MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_SALDC            -----------MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_SALTY            -----------MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_SALPK            -----------MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
C9XTQ9_CROTZ          -----------MTTFYTVVSWLIILGYWLLIAGVTLRILMKRRAVPSAMAWLLVIYILPL
CLSA_ENT38            -----------MTTFYTVVSWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
D4GFZ7_PANAM          -----------MTTFYTLISWLLLFGYWLLIAGITLRILMKRRAVTSAMAWLLIIFILPL
D8MSW6_ERWBE          -----------MTTFYSVLSWLLVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPL
CLSA_SODGM            -----------MTTLYTVINWLLLFGYWLLIAGVTLRVMMKRRAVPSAMAWLLVIYILPL
A0A140NJ41_PROSM      -----------MATVYTLLSWLLFFVYWLVIAAITVRILVKRRPVTSAMTWLLIIYILPL
CLSA_WIGBR            ---MLINFFSSIEVLFVIIKWILLLGYWWLITEVTIRILFKRRTVPSAMAWLLIIYVVPF
Q9KRH2_VIBCH          -----------MDKVYHFLTLLSIGIYWLLVAGVTIRVVLKRRAVSVSLAWLMVIYIIPF
Q7MLM7_VIBVY          -----------MDKFYHFLTLAGIGLYWVLIAGVTFRVVLKRRAVSVSLAWLMIIYILPV
D4ZK21_SHEVD          -----------MDHLYQILALISVLVYWIIIAAVTARIVIRRRSIGVSFAWMMVIYVIPV
A4SKH4_AERS4          ------MEYDIQLLFSQFLGWLLLLFHTVIVAGISLRVVMKRRPIGVSLAWLALIYAIPF
A1SZT8_PSYIN          ---MDTSLFTTNWSDNSLYVGLTAFIYITLVILTSLSVLIKRKPIGVSLAWLLLIYALPM
A4SYP0_POLAQ          ---MNSLTTFLIKHAFDINISWLVLIHFLLVTIFIGVIISVRRPVGVAFAWIFIVMTFPI
B3PB19_CELJU          -------MRDSIWMLISIIQQAMILLHFALVIIFAVRVIMQRLPVGASLAWLLVLALLPY
Q6AJK9_DESPS          ------MQIQALHWTSPLISTVFFTADLILRIGLSLRVIMCKKNYGVSYAWLVVVLLVPF
M1P6W0_DESSD          ------MDQDSLHWSVHIATIIIPVADLILRLGLSIRVIMRKRQYGVTLAWLVVILLLPF
F6ACQ6_PSEF1          -----------MEFGIQHFFGYLIAAIHVLGTLAAIHAILTVRTAQGAIAWALSLFFMPY
A0A379INJ2_PSEME      ---------MPADFGIPHLFAYLIATIHALGVLAAIHAVLTVRTAQGALAWGLSLFFMPY
CLSA_PSEAE            MAATGVDKDRPRAMTSTTYLGLLLVGIQVLGFVAAIHAVLTVRTAQGAIAWATSLVFMPY
CLSA_PSESM            -----------MDYHDPYFFGYVLGFIHLLGTGAAIHALLTVRTSQGAIAWAMPLLFIPY
CLSA_PSEU2            -----------MDYHDPYFFGYVLGFIHLLGTGAAIHALLTVRTSQGAIAWAMPLLFIPY
CLSA_PSEF5            -----------MDYFGPHIFGYLIALLHFLGLIAAIHAVLTVRTAQGAIAWALSLLFMPY
CLSA_PSEFS            -----------MDFFGPHLLAYFIATLHFLGTLAAIHAVLTVRTAQGSIAWALSLMFMPY
CLSA_PSEPW            -----------MDYHSPYFFGYVLGLVHLLGIIAALHAVFTVRTAQGAIAWAMSLFFIPY
F8GMQ2_CUPNN          ------------MLQSPSVIAIIVLCFHVVGVVAALHAVMTVRTAPGAIAWAGSLLMMPY
B2UI69_RALPJ          ------------MLTNTTAFAAFLFLVHSVGVLAAMHAVLTVRTSQGAIAWAISLVTLPE
A0A3N4GJT7_BURML      ------------MTLDWLHLGTLIGLAHVLGVIAACHAILNTRTSQGAIAWAVSLTAMPY
Q3JR13_BURP1          ------------MTLDWLHLGTLIGLAHVLGVIAACHAILNTRTSQGAIAWAVSLTAMPY
A3NAW4_BURP6          ------------MTLDWPHLGTLIGLAHVLGVIAACHAILNTRTSQGAIAWAVSLTAMPY
F2LG28_BURGS          ------------MQLDWLHLGTLIAIAHILGVIAACHAILNTRTSQGAIAWAVSLTAMPY
B1JUG4_BURCC          ------------MTLDWLHLGTLILTIHVLGIVAACHAIMNTRTSQGAIAWAVSLTAMPY
Q0BE01_BURCM          ------------MTLDWLHLGTLILAVHVLGIVAACHALMNTRTSQGAIAWAVSLAAMPY
D5W8V6_PARAM          ------------MTFDLLHVGPLVLLAHILGIIAAAHAILHTRTSQGAIAWAVSLVAMPY
H8KYX0_FRAAD          --------------MPLSLIACSALLLHLCGMACAMHAVMRVRTSQGAIAWALGLVVMPY
Q1QWH1_CHRSD          --------------MTSGVIGILIVVIHVLGVLSALMALMSSRTSQGAVAWIVTLLTFPY
E1VCS7_HALED          --------------MASWLFGVLIPTIHLLGILSAVQALMSSRTSQGAIAWIISLVTVPY
L0DUG0_THIND          -MSRRPEMAGAARPRRGRVLALFLLLAHLLGFASSIDALMSTRTPQGAVAWIVSLNAVPY
C4XG94_DESMR          ------------------MLFLILLCCHLIGAASAARALFTARSSQGAMAWVMAMITFPY
                                                            :        : :*   :  .* 

CLSA_BUCAI            IGISIWFFFGE-LYLGKRQKKIANRIWSISNKWLHELKSCTYIFQIKNSEVATSIFQLCK
CLSA_BUCAP            IGIAIWFFFGE-LYLGKRQKKIAKKIWSISNTYLNKLKSYKYIFQIKNSEVATSLFQLCK
CLSA_YERPB            VGIIAYLSFGE-LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVATPLFQLCE
CLSA_YERPE            VGIIAYLSFGE-LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVASPLFQLCE
CLSA_YERPY            VGIIAYLSFGE-LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVASPLFQLCE
CLSA_KLEP3            VGIIAYLSFGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEDNSPVAESLFKLCE
CLSA_KLEP7            VGIIAYLSFGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEDNSPVAESLFKLCE
CLSA_ECOLI            VGIIAYLAVGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCE
CLSA_SHIDS            VGIIAYLAVGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCE
CLSA_SHIB3            VGIIAYLAVGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCE
CLSA_SALDC            VGIIAYLSVGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCE
CLSA_SALTY            VGIIAYLSVGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCE
CLSA_SALPK            VGIIAYLSVGE-LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCE
C9XTQ9_CROTZ          VGIVAYLSVGE-LHLGKRRAERARAMWPSTAKWLSDLKACKHIFAEENSAVASALFQLCE
CLSA_ENT38            VGIIAYLSFGE-LHLGKRRAERARAMWPSTAKWLNDLKSCKHIFAEENSSVASSLFKLCE
D4GFZ7_PANAM          VGIIAYLSFGE-LHLGKRRAERARTMWPSTARWLNDLKKRSEIFATDYSDVARSLFQLCN
D8MSW6_ERWBE          VGIIAYLSFGE-LHLGKRRAERARTMWPSTARWLNDLKSCHHIFSHENSDVARSLFQLCE
CLSA_SODGM            VGIITYLLFGE-LNLGKRRAERSKALWPSTAKWIEDLKGCRRIFASENSEVARALFQLCE
A0A140NJ41_PROSM      VGIIAYIAFGE-LHLGKRRVDKAQQMWPSVATWLENLRHSKHIFATENSPVAEPLFQLCE
CLSA_WIGBR            IGAIIYLLLGE-LNLEKKRIKRSKIIWISALKKIKKLKNYKEIFTTKNSHIARSLFRLCK
Q9KRH2_VIBCH          VGVLCYFLFGE-LNLGRKRAERAKEMFTPFGHWFRSLNDCQAHVQEGMGAHISRIDELCN
Q7MLM7_VIBVY          LGVACYFLFGE-LNLGRKRAERAKEMFAPFATWFSQLNDCQAHAPESMGRHIYRIDELCN
D4ZK21_SHEVD          VGIVAYLLIGE-QNIGRTRAVRAQKMYKPYGEWFAHLFETQQYHTGIQSHHAQSIGRLCK
A4SKH4_AERS4          AGVGFYVLFGE-IRLGRRRAERAKAMYRPYAIWIRQLARLFPQHCCEVGSKAQPLHDLIQ
A1SZT8_PSYIN          VGMISYYIFGQ-LNLGKKRKKRRLEMAGLFKTWLADEVTEHRLSDQQISSAVTSIKHFVE
A4SYP0_POLAQ          VGISLYILIGD-RPVGRSLTRKIKRMNQEYAQITEDMRRDYAGERQKIPVEARALSLLAE
B3PB19_CELJU          LGVGLYLLFGE-RYLGVRHVHRRERLRQTQQIPALRRMDGIKQAWHNFHPASLALARLEF
Q6AJK9_DESPS          LGGLLYLCFGE-NRLSERRIKRILKAKKYYYKWLQQLAEGPQVDWSALNPEFAPIQLHTQ
M1P6W0_DESSD          FGAITYLLFGE-NRIGETRAKRIKDSLDHYRKWLEALPAIAPVNWSELNSELKAIHHLAN
F6ACQ6_PSEF1          LTLLPYVIFGRSRFYAYIDARRVVDKQMHKAMASLDWRPWVQEAIAAGESEAYGQLRALP
A0A379INJ2_PSEME      LTLLPYLVFGRSRFDAYVKARRQADKEMRHAMAEQDWRPWVEEAKAAHLSPAYDRLRALP
CLSA_PSEAE            LTLLPYLVFGRSRFDAYIEARRQANREMHLAAAELDWRPWVEEALAARQVSGYKGLKALV
CLSA_PSESM            FTLLPYLIFGRSSFDAYIKARREANKEMRAAIGSLNWRPWIEEAVAARRSDAYAALRAMP
CLSA_PSEU2            FTLLPYLVFGRSSFDAYIKARRQANQEMRIAIGDLNWRPWMEEAVAARRSEAYAALRAMP
CLSA_PSEF5            LTLIPYLVFGRSTFDAYIQARRQANVEMHKAINELNWRPWVEEALTARASKAYASLRAMP
CLSA_PSEFS            LTLIPYLIFGRSTFDAYIQARRQANQEMHTAITALNWRPWVEEALAARNSSAYASLRAMP
CLSA_PSEPW            FTLIPYLVFGARSFNAYIKARRQANQEMHVAMANLNWRPWVEEALTARESQSYAALRAMP
F8GMQ2_CUPNN          FTLVPYLVFGRSTFAGYVDARRFNDDHLRELRHGMTPREREARSACVVHAPAQVCMRALP
B2UI69_RALPJ          FTLIPYLIFGRSTFAGYVDARRFHNARLREITLSDDWRRLRDHESSVV-APQHTCMQALP
A0A3N4GJT7_BURML      LTLIPYLFLGRSKFSGYVDARRHETAALRTRTHPAPWDAEGSTLGAPKEALGAARVRALT
Q3JR13_BURP1          LTLIPYLFLGRSKFSGYVDARRHETAALRTRTHPAPWDAEGSTLGAPKEALGAARVRALT
A3NAW4_BURP6          LTLIPYLFLGRSKFSGYVDARRHETAALRTRTHPAPWDAEGSTLGAPKEALGAARVRALT
F2LG28_BURGS          LTLIPYLFLGRSKFSGYVDARRSETAALRTRSRPSSWDTHGSSLGVPADALGLAPVRALT
B1JUG4_BURCC          LTLVPYLFLGRSKFSGYVDARRHELEMLRTHTPRAPWRATDATDGPAADALGQAAVLALT
Q0BE01_BURCM          LTLVPYLFLGRSKFSGYVDARRHEMEALRTHTPRVPWLDADATNGPAADAIGRAAVLALT
D5W8V6_PARAM          LTLVPYLFLGRSKFAGYADARRVENELLRTRAHPQVWDTHASSAGLPTQQLGSRLVQSLT
H8KYX0_FRAAD          LTLLPYFFLGASRFRGYARLRQMNQQRRRYVARQWPERV-PYLQRHLPAPEHLQRFKAIN
Q1QWH1_CHRSD          LAVPIYWIFGRPRFYGYTSARGERDSVLRQVLLRF---RPRLEPYFSRPSHDVARIQAVE
E1VCS7_HALED          LAVPAYWVFGRPRFYGYVSARGERDSVLRRVLARY---RNLVEPYLA--GAKEADVLAVE
L0DUG0_THIND          LAVPAYWVFGRNKFQGYVIARRDVDSALALAMAPK---TEELRAHRFHPDEPDKHLHGVE
C4XG94_DESMR          LAVPLYWIFGRNRFQGYVASRRAGDKAVDAMAPKL---HAVQAFPDPHAPGLPGLFPVLE
                           :  .*                                                  

CLSA_BUCAI            NRQGLHGIKSKKIKLLTNTKKIMQILIRDIYLARKNIEMVFYIWKPGGMADDVAIALIDS
CLSA_BUCAP            HRQGIYGIKNNKITLLTNTQNTIEVLIRDIYSARNNIEMVFYIWKPGGIADDVAMALIDS
CLSA_YERPB            RRQGINGVKGNQLQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAA
CLSA_YERPE            RRQGINGVKGNQLQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAA
CLSA_YERPY            RRQGINGVKGNQLQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAA
CLSA_KLEP3            RRQGIGGVKGNQLQLLTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADSVAESLMAA
CLSA_KLEP7            RRQGIGGVKGNQLQLLTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADSVAESLMAA
CLSA_ECOLI            RRQGIAGVKGNQLQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAA
CLSA_SHIDS            RRQGIAGVKGNQLQLMTESDDVMQALIRDIQLARHNIEMVFYIWKPGGMADQVAESLMAA
CLSA_SHIB3            RRQGIAGVKGNQLQLMTESDDVMQALIRDIQLARHNIEIVFYIWQPGGMADQVAESLMAA
CLSA_SALDC            RRQGIAGVKGNQLQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAA
CLSA_SALTY            RRQGIAGVKGNQLQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAA
CLSA_SALPK            RRQGIAGVKGNQLQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAA
C9XTQ9_CROTZ          RRQGIAGVKGNQLQLLTSSDDVMQALIRDIQLSRHNIEMVFYIWQPGGMADQVAESLMAA
CLSA_ENT38            RRQGIAGVKGNQLQLLTTSEDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAA
D4GFZ7_PANAM          NRQGIAGVKGNQLQLLTSSDDVMKALIRDIQLARHNVEMVFYIWNPGGLADEVAESLMAA
D8MSW6_ERWBE          NRQGIAGVKGNQLQLLTSTDETLKALVRDIQLARHNIEMVFYIWQPGGLADEVAECLMAA
CLSA_SODGM            HRQGMGGLKGNQMQLLTSSDDALRALVRDIGLAQKNIEIVFYIWQSGGLVDQVAEALMAV
A0A140NJ41_PROSM      KRQGIAGVKGNRIQLMTTCEESLKSIVNDINNAQHSIEMVFYIWQPGGLVDGVTEALLNA
CLSA_WIGBR            HRQGIGGVKSEKINILNDPDNVMQSVINDINLAKISIEMIFYIWHPGGWTNYVVEVLIKA
Q9KRH2_VIBCH          NRMGIPALSGNTLSLLNSPNEILHAIIDDIERAQFQIRMVFYIWHPGGLADAVASAVIQA
Q7MLM7_VIBVY          TRLGLPALSGNTLSLQRSPEEILHSVIQDIENAQSSIRMVFYIWHPGGLADSVASALIQA
D4ZK21_SHEVD          KRLGIPPLADNDLQLLASPEQILTSMIEDIDKATLSIHLEFYIWHPGGMADSVAQALIQA
A4SKH4_AERS4          GRLAMPMLSGNRMTLLSQPESILREIARDIRQSSQSCYLEYYIWHPGGDTDDVCDALMEV
A1SZT8_PSYIN          FGSQMPMMAGNKLTLLSSTDVILTELADCIEQARHSCYLMFYICSGGGLANNILDALMRA
A4SYP0_POLAQ          TKNGTPVVSGNKLELHTNSLEILQLFIDEIDRAKASLHMEFYIWALGGDADRVGEAVIAA
B3PB19_CELJU          QTAGIPVLGGNDLEFLQSAKTTIDAMCADIRTAEISCHMEFYIWHPGGIADQVADALLDA
Q6AJK9_DESPS          NLVGIPAMAGNNISLLHSQDNILDSIIKDIEASQSTCHLQFYIWEAGGRIKEISEALIRA
M1P6W0_DESSD          SLIGIPAMDGNHLELIEEPELIMRAIIKDIDAAQSTCHLQFYIWAEGGTADEVVAAVIRA
F6ACQ6_PSEF1          RLGRMPCLAGNQVSLLVNGRATFEAILQAIADAHQVIHIQFFIVHDDKLGRRLQEALLER
A0A379INJ2_PSEME      RLSHLPGLTGNRVELLIDGEATFEAIFSALASAQQTILLQFFIIRDDALGQRLRDVLLER
CLSA_PSEAE            RMTRTPTLANNRVRLLVNGEASFEAMFKAISAARQVILVQFFIVRDDALGQRLQQLLLER
CLSA_PSESM            RLGNMPALANNKVRLLINGEETFGAIFQAIREAKQTILIQFFIIHDDNLGRQLQTLLLEK
CLSA_PSEU2            KLGNMPALANNKVKLLINGEETFGAIFQAIREAKKTILVQFFIIHDDKLGRELQSLLLEK
CLSA_PSEF5            KLGRMPCLANNQVRLLVNGDATFEAIFNAIRRSHKAVLIQFFIIHDDDLGRRLQRLLLEK
CLSA_PSEFS            KLGRMPCLANNEVHLLINGDATFSAIFEAIRNARTAVLFQFFIIHDDELGRQLHALLKEK
CLSA_PSEPW            KLGRMPCLANNQVKLLIDGRATFDAIFAAIEQAREVVLVQFFIIHNDTIGKALQQLLLRK
F8GMQ2_CUPNN          RLTGMPCLANNDVRLLVNGEQTFEAIFAAIARASQVLIVQFFIVHDDALGQRLQALLCER
B2UI69_RALPJ          RLTGTPCLARNRVRLLVNGAETFEAIFAAIAQARRVLIVQFFIVHDDTLGRRLAELLLDR
A0A3N4GJT7_BURML      RLVGMPFVAGNAVRTLVNGDATFSAILAAIDAARSYVIVQFFIVRDDALGAMLRDTLIAR
Q3JR13_BURP1          RLVGMPFVAGNAVRTLVNGDATFSAILAAIDAARSYVIVQFFIVRDDALGAMLRDTLIAR
A3NAW4_BURP6          RLVGMPFVAGNAVRTLVNGDATFSAILAAIDAARSYVIVQFFIVRDDALGAMLRDTLIAR
F2LG28_BURGS          HLGGMPFVGGNAVRLLVNGEATFAAILGAIEAARHCVIVQFFIVRDDTLGDMLRDALIAC
B1JUG4_BURCC          RLGGMPFLGGNSVRTLVNGDATFSAILSAIDDARDYVLVQFFIVRDDALGRMLRDALLAR
Q0BE01_BURCM          RLGGMPFVGGNSVRTLVNGDATFEAILSAIDSAREYVFVQFFIVRVDALGLMLRDALLAR
D5W8V6_PARAM          RLGGMPFLPGNTVRTLINGTATFEAIFDAIQNARHYVIVQFFIVRDDALGDMLKDALIAK
H8KYX0_FRAAD          AMLQQPFYSGHKLRLLINGQATFKAIFEAIAQAEQVILIQFFIIHDDDIGRRLQQALLEK
Q1QWH1_CHRSD          RLAMMPMSTGNRAELLIDGEATFKSLLAGIDSAREYILVQFFIFRADEIGTLFKQHLIQQ
E1VCS7_HALED          KLAMMPLTSGNRAELLVDGEATFESLFAGIDRAEQYVLVQFFIVRDDALGHELKQRLKNA
L0DUG0_THIND          RLAKWPMLSGNDVELLVDGEAAFNSIFEGIDAAERYLLVQFYIVRADSVGHELQRRLIER
C4XG94_DESMR          RLAELPFTAGNHVRLLIDGQATFEAIFAAIDAAEHYVLVQFFIIRDDDIGRALQKRLIAK
                                .           :  .   :  :     . ::*   .     .   :   

CLSA_BUCAI            AKRGIHCRLMLDSAGSIEFFQSPWVEIMRKSGIQVVEALKVNLLRVFLRRVDVRQHRKII
CLSA_BUCAP            AKRGVHCRLMLDSAGSVEFFRSPWFDIMKKSGIEIVEALKVSLIRIFLRRLDVRQHRKII
CLSA_YERPB            ARRGVHCRLLLDSAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIV
CLSA_YERPE            ARRGVHCRLLLDSAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIV
CLSA_YERPY            ARRGVHCRLLLDSAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIV
CLSA_KLEP3            ARRGVHCRLMLDSAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMV
CLSA_KLEP7            ARRGVHCRLMLDSAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMV
CLSA_ECOLI            ARRGIHCRLMLDSAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMI
CLSA_SHIDS            ARRGIHCRLMLDSAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMI
CLSA_SHIB3            ARRGIHCRLMLDSAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMI
CLSA_SALDC            ARRGIHCRLMLDSAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMV
CLSA_SALTY            ARRGIHCRLMLDSAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMV
CLSA_SALPK            ARRDIHCRLMLDSAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMV
C9XTQ9_CROTZ          ARRGVHCRLMLDSAGSVAFFRSPWAGMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMI
CLSA_ENT38            SRRGIHCRLMLDSAGSVAFFRSPWAGMMRNAGIEVVEALKVNLLRVFLRRMDLRQHRKMI
D4GFZ7_PANAM          SRRGVHCRLMLDSAGSVAFFRSPWVGMMRNAGIDVVEALQVSLLRVFLRRMDLRQHRKMV
D8MSW6_ERWBE          ARRGVHCRLMLDSAGSVQFFRSPWAAMMRNAGVDVVESLKVSLWRVFLRRMDLRQHRKIV
CLSA_SODGM            ARRGVRCRLMLDSAGSVDFFRSPYPALMRAAGVHVVEALHVSLLRVFLRRMDLRQHRKMV
A0A140NJ41_PROSM      AKRGVKCRIMVDSAGSWHFFRSDYPDKMRAAGIEFIESLKVNLMRFFLRRMDLRQHRKII
CLSA_WIGBR            ANRGVKCRLILDSAGSKNFLKSIQVKIMRKSGIKIVEALNLNILQIFLRRMDLRQHRKMI
Q9KRH2_VIBCH          SKRGVNVKLLLDSAGSPRFFRSPWEKMMRDAGIEVVQALEVSPWRIFLRRLDLRQHRKII
Q7MLM7_VIBVY          AKRGVDVKLLLDSAGSPRFFRSHWHQMMVNAGIHVVQALEVSPWRIFLRRLDLRQHRKII
D4ZK21_SHEVD          AQRGITIRLLLDAAGSHQFFRSEWPEKMQASGISIARALKVSPLRILFRRMDLRMHRKIV
A4SKH4_AERS4          AARGVDCRLLLDSMGSKAFFRSHWPKKLRKAGVKLVEVLPVGAWRIPFQRQDLRMHRKLV
A1SZT8_PSYIN          ARRGVSCKLLFDSVGSHDFFNSTESQRLRGAGVEVCEALPVGTFRLLFQRQDLRLHRKLV
A4SYP0_POLAQ          AKRGVKCRVLLDSLGSKDWFKSSWPGRFRNAGVQVTEALPIQIGRFQFRRADIRLHRKIF
B3PB19_CELJU          AGRGVRCRIMLDAVGSAAFFKSSLVKKLVHPNIELIKACPIRLIPAKLARYDLRSHRKTL
Q6AJK9_DESPS          RKRGVICRILLDAIGSRGFFSSASARRMEQAGIKIQASLPAGIYRAIFARMDIRNHRKII
M1P6W0_DESSD          AGRGVTCRILIDSIGSNDFLKGEKIQTLLAAGVQIEEELPAGFIKALFVRVDIRNHRKIV
F6ACQ6_PSEF1          AAAGVQVYFLYDAVGSH-ALPRNYIRRLREGGVHMHAFPTGGGVLNRF-QLNFRNHRKIV
A0A379INJ2_PSEME      AGAGVQVHVLYDGVGSH-ALPRSYIDSLRRGGAQVHAFPTRAGLFNRF-QLNFRNHRKIV
CLSA_PSEAE            AANGVEVFFLYDAIGSH-ALPHRYVERLRQGGVQMHGFSTGSGMLNRF-QVNFRNHRKVV
CLSA_PSESM            AAQGVAIFVLYDRIGSH-ALPGAYIDTLRDGGVQIKAFATRGGWLNRF-QINFRNHRKIV
CLSA_PSEU2            AAEGVAIFVLYDRIGSH-ALPGAYIDKLRDGGVQIKAFATRGGWLNRF-QINFRNHRKIV
CLSA_PSEF5            AAEGVSIHLLYDRIGSH-SLPASYVQTLRDAGVQVHAFATRSGWLNRF-QVNFRNHRKIV
CLSA_PSEFS            SAEGVAIYVLYDRIGSH-ALPHRYVQSLRDAGVQVKAFATRSGWLNRF-QVNFRNHRKIV
CLSA_PSEPW            AADGVKVFVLYDRVGSH-ALPASYSQSLRDAGVQIHAFATRRGWFNRF-QVNFRNHRKIV
F8GMQ2_CUPNN          ARAGVKVYFLFDRIGCH-ALPRRYVRTLTEAGVDARAFSTHRGFVNRF-QLNFRNHRKLV
B2UI69_RALPJ          ARAGVRVYFLFDSIGCH-ALPRRYVQRLIEGGVHAKPFSTHAGFVNRF-QLNFRNHRKLV
A0A3N4GJT7_BURML      AKAGVRCYLLYDSIGSF-DLPSSYVHALREGGVEVHPFATNKQFVNRF-QLNFRNHRKIV
Q3JR13_BURP1          AKAGVRCYLLYDSIGSF-DLPSSYVHALREGGVEVHPFATNKQFVNRF-QLNFRNHRKIV
A3NAW4_BURP6          AKAGVRCYLLYDSIGSF-DLPSSYVHALREGGVEVHPFATNKQFVNRF-QLNFRNHRKIV
F2LG28_BURGS          AGRGVRCYLLYDSIGSF-DLPHRYVNALRAGGVEVHPFATNQQFVNRF-QLNFRNHRKIV
B1JUG4_BURCC          AATGVRCCLLYDSIGSF-DLPHSYVDALRRGGVEVHPFATNRKFVNRF-QLNFRNHRKIV
Q0BE01_BURCM          AAAGVRCYLLYDSIGCF-DLPHSYVDTLRRGGVEVHPFATHRKFVNRF-QLNFRNHRKIV
D5W8V6_PARAM          AQQGVRVYFLYDSIGSF-DLPHRYVAALRAAGIEMQPFATNRRFVNRL-QLNFRNHRKIV
H8KYX0_FRAAD          AAAGVRICVLYDGIGSH-ALPRRYIETLRAAGIRIHAFATRR-WRNRF-QLNFRNHRKIV
Q1QWH1_CHRSD          AERGVRVCLLYDEIGSR-SLSGGYLRELSEAGVEVTAFNSSRGWRHRF-QINFRNHRKIL
E1VCS7_HALED          VARDVRVYFLYDEIGCH-KLPERYLRDLRGAGVAVSAFHSSRGVRHRF-QLNFRNHRKIL
L0DUG0_THIND          AQAGVEVYFLYDEIGSY-RLPASYLQALRDAGVHVHWFHSTRGRGNRF-QLNFRNHRKIV
C4XG94_DESMR          ARAGLAVYLLYDEIGSH-SLNAAYLDELKKAGVQASPFNTTLGWRNRL-QLNFRNHRKIV
                         .:   .: *  *.   :       :   .               : : :.* *** .

CLSA_BUCAI            LIDNYIAYSGSMNLVDPYLFKKSSEIGQWIDLMTRIEGPIATTMGIIYSCDWEIETG---
CLSA_BUCAP            LIDNYISYSGSMNLVDPYLFKQSSGVGQWIDLMTRIEGPVATAIGIIYSCDWEIETG---
CLSA_YERPB            LIDNYVAYTGSMNMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETG---
CLSA_YERPE            LIDNYVAYTGSMNMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETG---
CLSA_YERPY            LIDNYVAYTGSMNMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETG---
CLSA_KLEP3            MIDNYIAYTGSMNMVDPRYFKQDSGVGQWIDLMARMEGPVATSMGIVYSCDWEIETG---
CLSA_KLEP7            MIDNYIAYTGSMNMVDPRYFKQDSGVGQWIDLMARMEGPVATSMGIVYSCDWEIETG---
CLSA_ECOLI            MIDNYIAYTGSMNMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETG---
CLSA_SHIDS            MIDNYIAYTGSMNMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETG---
CLSA_SHIB3            MIDNYIAYTGSMNMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETG---
CLSA_SALDC            MIDNYIAYTGSMNMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETG---
CLSA_SALTY            MIDNYIAYTGSMNMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETG---
CLSA_SALPK            MIDNYIAYTGSMNMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETG---
C9XTQ9_CROTZ          MIDNYIAYTGSMNMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETG---
CLSA_ENT38            MIDNYIAYTGSMNMVDPRFFKQDSGVGQWIDLMARMEGPVATAMGIVYSCDWEIETG---
D4GFZ7_PANAM          LIDNYIAYTGSMNLVDPRFFKQEAGVGQWVDLMARMEGPVSTAMGIVYSCDWEIETG---
D8MSW6_ERWBE          LIDNYIAYTGSMNLVDPRYFKQDAGVGQWIDLMARMEGPVATAMGIIYSCDWEIETG---
CLSA_SODGM            LIDNYVAYTGSMNMVDPRFFKQDAGVGQWIDIMARMEGPVATAMGIIFSCDWEIETG---
A0A140NJ41_PROSM      VIDNYISYTGSMNMVDPRYFKQDAGVGEWVDILVRMEGPVSTTLGIVYAFDWEMETG---
CLSA_WIGBR            LIDNYIGYTGSMNMIDPKFFKKNRKIGEWIDIMIRMEGPVASAMRIIFSCDWEIETG---
Q9KRH2_VIBCH          VIDDEIAYTGSMNMVDPAYFKQNAGVGQWIDIMVRVTGPTVNVLSAIHCWDWEFETG---
Q7MLM7_VIBVY          VIDDEIAYTGSMNLVDPAYFKQSSGVGQWVDIMVRLTGPTVNVLSAIHCWDWEVETG---
D4ZK21_SHEVD          IIDNVIGYTGSMNLVDPSCFKANSGVGEWIDVMIRVTGTCVPLLNAIQSWDWEVETD---
A4SKH4_AERS4          VIDDRVGYTGSMNMVDPRFFKQNAGVGQWVDIMIRVQGPVVPLMWSIFVWDWEMETG---
A1SZT8_PSYIN          CIDDHVAYTGSMNLVDPAFFKKEKNIGQWVDMMVRCEGPIVQLMKSLFVWDWYLETN---
A4SYP0_POLAQ          VVDGAIVWTGSMNLVDPRTFKQDSGVGEWVDAMVRVEGPVAAQFELTFSFDWSVDNP---
B3PB19_CELJU          VIDNRVAYMGSFNLIDPSLFKKSLDVGEWIDLMARIQGPIVNVFDAVFRWYWNIETQ---
Q6AJK9_DESPS          VIDGKIAYTGSQNMVDAIFFKQESGVGHWVDIVARIRGPVVETLAATFASDWYLEAE--Q
M1P6W0_DESSD          VIDGKIAYTGSQNMVDPKFFKQDSGLGHWIDIMVRIQGPVVEALAGTFISDWFLETDSQQ
F6ACQ6_PSEF1          VVDGERGFLGGHNVGDEYLGEKPR-LSPWRDTHVEVHGPAVACLQESFAEDWFWATR---
A0A379INJ2_PSEME      VVDGEIGFLGGLNVGIEYLGQKPP-LAPWRDTHVEVRGPVVASLQEAFAEDWYWACQ---
CLSA_PSEAE            VVDGECGFVGGHNVGVEYLGEKPP-LAPWRDTHMELRGPAVACLQESFAEDWYWATH---
CLSA_PSESM            VVDGLKGYIGGHNVGDEYMGLKPP-LAPWRDTHVEVIGPVVACLQESFAEDWFWATR---
CLSA_PSEU2            VVDGLKGYIGGHNVGDEYMGLKPP-LAPWRDTHVQVIGPVVACLQESFAEDWFWATR---
CLSA_PSEF5            VVDGMLGFVGGHNVGDEYLGKKPP-LAPWRDTHVQVSGPVVACLQESFAEDWFWAAR---
CLSA_PSEFS            VVDGITGFVGGHNVGDEYLGKKPP-LAPWRDTHVQVTGPVVACLQESFAEDWFWAAR---
CLSA_PSEPW            VVDGVTGFIGGHNVGDEYLGGNPH-LSPWRDTHVQIGGPVLACLQESFAEDWYWATR---
F8GMQ2_CUPNN          IVDGSEAFVGGHNVGVEYLGERPP-LAPWRDTHIALRGSAVLDLQMAFAEDWFWAAR---
B2UI69_RALPJ          VVDGERAYVGGHNVGNEYMGEKPP-LAPWRDTHIEIVGAAVMDLQLTFAEDWYWAAR---
A0A3N4GJT7_BURML      VVDGERAFVGGHNVGVEYLGGNPR-LSPWRDTHIEVRGPAAANIQYVFAEDWHWATQ---
Q3JR13_BURP1          VVDGERAFVGGHNVGVEYLGGNPR-LSPWRDTHIEVRGPAAANIQYVFAEDWHWATQ---
A3NAW4_BURP6          VVDGERAFVGGHNVGVEYLGGNPR-LSPWRDTHIEVRGPAAANIQYVFAEDWHWATQ---
F2LG28_BURGS          VVDGERAFVGGHNVGVEYLGANPR-LSPWRDTHIELRGPVVANIRYVFAEDWHWATQ---
B1JUG4_BURCC          VVDGNRAFVGGHNVGVEYLGAKPR-LSPWRDTHIEIRGPVVASIQYVFAEDWHWATQ---
Q0BE01_BURCM          VVDGNRAFVGGHNVGVEYLGANRR-LSPWRDTHIEIRGPVVASIQYVFAEDWHWATQ---
D5W8V6_PARAM          AVDGERAFIGGHNVGVEYLGAKPP-LSPWRDTHIEVRGPAVASIQFVFIEDWYWATQ---
H8KYX0_FRAAD          LIDGWRVFLGGLNVGDEYMGKQPP-LSPWRDTHMELQGPAVADAHASFLRDWRWVTG---
Q1QWH1_CHRSD          VVDGREGWTGGFNVADEYLGRVPR-YGPWRDTHLKLTGPSVMGLQEAFWEDWYWATG---
E1VCS7_HALED          VVDGREGWVGGFNVGVEYLGQNPK-HGHWRDTHLRLAGPSVLGLQEAFWEDWHWATG---
L0DUG0_THIND          VADGERGWVGGLNVGDEYLGRDAR-TGPWRDTHLRVEGPAALALQWVFIEDWYWAKE---
C4XG94_DESMR          VTDGVAAFVGGHNVGDEYLGKSPR-LGHWRDTHVRLDGPAVALVQLSFLEDWYWATR---
                        *.   : *. *:            . * *      *.            *        

CLSA_BUCAI            ------LKILPQLPNKKMLENQS--------------NKNASIQVIASGPGFLKNMIHQA
CLSA_BUCAP            ------FKILPKLPNKEMLKKKC--------------NQNSSIQVIASGPGFPKNVIHQA
CLSA_YERPB            ------KRILPPPPDANIMPFEE--------------ETGHTIQVIASGPGFPEEMIHQA
CLSA_YERPE            ------KRILPPPPDANIMPFEE--------------ETGHTIQVIASGPGFPEEMIHQA
CLSA_YERPY            ------KRILPPPPDANIMPFEE--------------ETGHTIQVIASGPGFPEEMIHQA
CLSA_KLEP3            ------KRILPPPPDVNIMPFEE--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_KLEP7            ------KRILPPPPDVNIMPFEE--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_ECOLI            ------KRILPPPPDVNIMPFEQ--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_SHIDS            ------KRILPPPPDVNIMPFEQ--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_SHIB3            ------KRILPPPPDVNIMPFEQ--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_SALDC            ------KRILPPPPDVNIMPFEQ--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_SALTY            ------KRILPPPPDVNIMPFEQ--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_SALPK            ------KRILPPPPDVNIMPFEQ--------------ASGHTIHTIASGPGFPEDLIHQA
C9XTQ9_CROTZ          ------KRLLPPPPDANIMPFEQ--------------ASGHTIHTIASGPGFPEDLIHQA
CLSA_ENT38            ------KRILPPPPDANIMPFEQ--------------ESGHTIHTIASGPGFPEDLIHQA
D4GFZ7_PANAM          ------KRILPPPPDRNIMPFEQ--------------ESGHTVQVIASGPGFPEDLIHQA
D8MSW6_ERWBE          ------KRILPPPPDGNIMPFEE--------------ESGHTIQVIASGPGFPEDLIHQA
CLSA_SODGM            ------ERILPPLPDVNIMPFEQ--------------ATGHTIQVIASGPGFPEGVIHQA
A0A140NJ41_PROSM      ------QRILPPPPDTNIMPFEQ--------------ANGHTTQMIASGPGFPDELIQQS
CLSA_WIGBR            ------ENIFYAPYDTKKCNIIKK-------------DNNYKTQVIPSGPGVSEGVIHQV
Q9KRH2_VIBCH          ------SRMLPKNPECRLEPNQP---------------Q-HPIQVVPSGPGMPENLISQV
Q7MLM7_VIBVY          ------HRQLPRLPECPLDSTQY---------------Q-NPIQVVPSGPGMPENLISQV
D4ZK21_SHEVD          ------QRFLPEKPICQSHPAPE---------------QLDTVQVIPSGPGMPEEIIHEV
A4SKH4_AERS4          ------ERLLDSLQHDPEAWPQS----------------NYRAQLIPSGPFVGGDCIQQS
A1SZT8_PSYIN          ------VKLPFQKLYADSFAIAG----------------DQNVQLIPSGPEFGEASIYQV
A4SYP0_POLAQ          ------KITHFDDRVPPIAPYEG----------------GAIAQELASGPVSRDDILYQV
B3PB19_CELJU          ------QELPLVEHKIDIRRDKT------------------VAQVAPSGPDNLDDSILQS
Q6AJK9_DESPS          DTFQQID-DVQELRHIGDIYPQTA-------------QGTSAVQLVPSGPGFTQDAIHSL
M1P6W0_DESSD          VQFRSLDQDIRHIREIADITHQPL-------------KGNVPVQFVPSGPGFSKDAIHSL
F6ACQ6_PSEF1          --------KLPPLLLPERYPD-----------------EGMLCQVISSGPADAQETCSLL
A0A379INJ2_PSEME      --------KLPPLLMPSKQDE-----------------PGQLCQVIASGPADPQETCSLL
CLSA_PSEAE            --------SLPPLILPPQYDS-----------------EGALCQVVASGPADAQETCSLF
CLSA_PSESM            --------ELPPLSLPDEFPE-----------------DGVLCQLLTSGPADAQETCSLF
CLSA_PSEU2            --------ELPPLSLPDEFPE-----------------DGVLCQLLTSGPADAQETCSLF
CLSA_PSEF5            --------ELPPLILPDTYPD-----------------DGVLCQLLASGPADAYETCSLF
CLSA_PSEFS            --------ELPPLILPDAYPE-----------------DGVLCQLLASGPADPYETCSLF
CLSA_PSEPW            --------QLPPLILPDAYPD-----------------NGVLCQALASGPADPQETCSLF
F8GMQ2_CUPNN          --------EVPHLLMPPPEVG-----------------GRMTCQVVPSGPADAQETCSLF
B2UI69_RALPJ          --------EVPQLIVPELRPE-----------------EDMVCQVVASGPADKQETCSLF
A0A3N4GJT7_BURML      --------SLPPQAPPPAPVP----------------DADMHCLVVPMGPADKQETGSLF
Q3JR13_BURP1          --------SLPPQAPPPAPVP----------------DADMHCLVVPMGPADKQETGSLF
A3NAW4_BURP6          --------SLPPQAPPPAPVP----------------DADMHCLVVPMGPADKQETGSLF
F2LG28_BURGS          --------SLPVDSPPPAPLD----------------EEDMHCLVVPMGPADKQETGSLF
B1JUG4_BURCC          --------KLPPIALPPPAQP----------------GDGMHCLAVPMGPADKQETGSLF
Q0BE01_BURCM          --------TLPPLAAPPEALP----------------GDAMHCLAVPMGPADKQETGSLF
D5W8V6_PARAM          --------QLPELDVPSTETAVPSVEQRAAHGAVEPAGNNMHCIVLPSGPADKQETCSLF
H8KYX0_FRAAD          --------ELPPFLPPREGEG------------------NATCLVAATGPADRQETCSLL
Q1QWH1_CHRSD          --------DILSLEWEPSVTC----------------NECQHVVIVPSGPADRCETASLL
E1VCS7_HALED          --------EVASLTWTPQVTC----------------EESQNVVIVPSGPADPQETASLL
L0DUG0_THIND          --------EIPDLPWEPVRPS----------------GHGVPVLILPSGPADRFETASLM
C4XG94_DESMR          --------QTPALRWELAPAP----------------GGDMPVLVLPTGPADDIESCDLF
                                                                    . **          

CLSA_BUCAI            LLTAIYSAKRELIITTPYLVPSEDLLEAICTAAQRGVEVSIIIPLYNDSILVKWASRVFF
CLSA_BUCAP            LLTAIYSARNELIMTTPYLVPSDDLLHAICTAAQRGVKVSIIIPLYHDSILVKWASRVFF
CLSA_YERPB            LLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQRGVDVSIIVPRENDSMMVRWASRAFF
CLSA_YERPE            LLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQRGVDVSIIVPRENDSMMVRWASRAFF
CLSA_YERPY            LLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQRGVDVSIIVPRENDSMMVRWASRAFF
CLSA_KLEP3            LLTAAYAAKEHLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSLLVGWASRAFF
CLSA_KLEP7            LLTAAYAAKEHLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSLLVGWASRAFF
CLSA_ECOLI            LLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSMLVGWASRAFF
CLSA_SHIDS            LLTAAYSAREYLIMTTPYFVPSDDLFHAICTAAQRGVDVSIILPRKNDSMLVGWASRAFF
CLSA_SHIB3            LLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSMLVGWASRAFF
CLSA_SALDC            LLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSLLVGWASRAFF
CLSA_SALTY            LLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSLLVGWASRAFF
CLSA_SALPK            LLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSLLVGWASRAFF
C9XTQ9_CROTZ          LLTSVYAAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSVLVGWASRAFF
CLSA_ENT38            LLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIIMPRKNDSVLVGWASRAFF
D4GFZ7_PANAM          LLTAVYSAREQLIMTTPYLVPSDDLLHAICTAAMRGVNVSLVVPLHNDSLLVGWASRSFF
D8MSW6_ERWBE          LLTAVYAAREQLIMTTPYFVPSDDLLHAICTAALRGVDVSIIVPRHNDSMLVGWASRAFF
CLSA_SODGM            LLTSIYAAREQLVMTTPYLVPSDDLLQAICTAAQLGVEVHIIVPRHNDSMLVGWASRAFF
A0A140NJ41_PROSM      LMTAIFSARKQLIMTTPYFVPSDDLLHAICTAAMRGVDVSIVMPRQNDSFLVRWASRSFY
CLSA_WIGBR            LLTAIYSAKKILIMTTPYLVPSDDILHAICTASQRGVSVYIIIPKFIDSILVKWASRSFF
Q9KRH2_VIBCH          LTLAINQANRSVCITTPYFVPSADLLATLKMTAQRGIKVDIIIPKKNDSLMVQWASRAFY
Q7MLM7_VIBVY          LILAINQANHSVTITTPYFVPSINLLDTLKMTAQRGIDVQLIIPHKNDSLMVQWASRSFY
D4ZK21_SHEVD          LLQSLYQAERKVVITTPYFVPSENLQVALIAAAHRGLCVNIIIPDKNDSLMVEWASRSFF
A4SKH4_AERS4          LLLAIYQARHHLVLTTPYFVPDDPLAAALSSAAARGVQVQLVLPARNDSIMANHACNAFM
A1SZT8_PSYIN          LLIAIYEAKYSLVLTTPYFVPDESLHEALKVAALRGVDVKVILPAKNDSFMVDYASRAFF
A4SYP0_POLAQ          MLSAIIDAREELTITTPYFGPDDGLLQAMMASARRGVNVTLIVPKLNDSTLVAWSSKSYY
B3PB19_CELJU          LLQGIYSAVRQVDIVTPYFVPGEALEQAMIIAARRGVSVNLILPRKVDSFLARHAGHSYF
Q6AJK9_DESPS          LLTVIYSARKELIMTTPYFIPDESLLTALKAAALRGVRVILIIPQSNDSKLVKYASRAKY
M1P6W0_DESSD          LLTTIYASRKNITLTTPYFVPDESILTALQSAARRGVDVRIIVPEKNDSRLVHYASWARY
F6ACQ6_PSEF1          FVEMLNAARERIWLTSPYFIPDEALFAALRLAVLRGVDVRILLPSRPDHRIVYAASNLFA
A0A379INJ2_PSEME      FVEAIHAARDRVWLSSPYFVPDEALFAALRLAVMRGVDVRLLLPARPDHHIVYAASSLYA
CLSA_PSEAE            FVEMINAAHERVWITSPYFVPDEAVMAALRLAVLRGVDVRLLIPSRPDHRTVYAASSLYA
CLSA_PSESM            FVEAIHAAEERVWITSPYFIPDEAVSAALTLAVLRGVDVRLLLPSRPDHYVVYAASSLYA
CLSA_PSEU2            FVEAIHAAEERVWITSPYFIPDEAVTAALTLAVLRGVDVRLLLPSRPDHYVVYAASSLYA
CLSA_PSEF5            FVEAIHAATERVWITSPYFIPDEAVFAALRLAVLRDVDVRILLPARPDHRIVYAASSLYA
CLSA_PSEFS            FVEAIHAATERVWITSPYFIPDEAVFAALRLAVLRGVDVRLLLPSRPDHRIVYAASSLYA
CLSA_PSEPW            FIEAIHSATRRVWITSPYFIPDEAVFAALRLAVLRGVDVRILIPARPDHRIVYAASSLFA
F8GMQ2_CUPNN          FVEAIQSARHRLWITSPYFVPDEAVFAVLRLAVLRGVDVRILIPARPDHLVVYAASTIYA
B2UI69_RALPJ          FMEAIQSARKRLWITSPYFIPDEAVFAALRLAVLRGVDVRILIPSRPDHHMVFLASTLYA
A0A3N4GJT7_BURML      FAEAINAARERVWITTPYLVPDEAVISALKLAVMRGVDVRVMIPSRRDHYVVFEASKLYA
Q3JR13_BURP1          FAEAINAARERVWITTPYLVPDEAVISALKLAVMRGVDVRVMIPSRRDHYVVFEASKLYA
A3NAW4_BURP6          FAEAINAARERVWITTPYLVPDEAVISALKLAVMRGVDVRVMIPSRRDHYVVFEASKLYA
F2LG28_BURGS          FVEAIHAARERVWITTPYLVPDEAVIAALKLAVMRGVDVRILIPSRRDHYVVFEASKLYA
B1JUG4_BURCC          FVESINAARERVWITTPYLVPDEAVVSALKLAVMRGVDVRILIPSRRDHYVVFEASKLYA
Q0BE01_BURCM          FVGAINAAHERVWITTPYLIPDEAVIAALKLAVMRGVDVRILIPCRRDHYVVFEASKLYA
D5W8V6_PARAM          FVEAINAARERIWITTPYLVPDEAVFAALRLAALRGVDVRILIPSRRDHRVVFEASKLYA
H8KYX0_FRAAD          FVTLIHAATTRIWLTSPYFVPDPSVFSALRLAVMRGVDVRILIPSRPDHRVVFLASSLHA
Q1QWH1_CHRSD          IQHVIHGAHERLWVTSPYFVPDQGVQDALKLAALRGVDVRVMIPERPDHLLVFLSAFSFL
E1VCS7_HALED          VQHAIHSAHERLWVTSPYFVPDHSVQDALRLAAMRGVDVRIMMPERPDHLLVFLSAFSFL
L0DUG0_THIND          MQQAIHAARERIWIASPYFVPDEGVLGMLKLAVLSGVDVRILIPERPDNRLTYYAAYAFI
C4XG94_DESMR          FFQAISAAQKRLWIVSPYFVPDREIISALQLAVLRGVDVRVMLPHKADHHMVYLASFSYL
                      .      :   : : :**: *.  :   :  :   .: * :::*   *   .  :     

CLSA_BUCAI            SELLEAGVKIFQFQKGLLHSKSILVDQQLSLIGTVNLDMRSLWLNFEITLVIDDSDFGRN
CLSA_BUCAP            SELLEAGVKIYQFKKGLLHSKSILIDQQLSLIGTVNLDMRSLWLNFEITLVIDDRKFSHH
CLSA_YERPB            TELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTVNLDMRSLWLNFEITLVIDDDGFGAD
CLSA_YERPE            TELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTVNLDMRSLWLNFEITLVIDDDGFGAD
CLSA_YERPY            TELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTVNLDMRSLWLNFEITLVIDDDGFGAD
CLSA_KLEP3            TELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDAGFGSD
CLSA_KLEP7            TELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDAGFGSD
CLSA_ECOLI            TELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLAIDDKGFGAD
CLSA_SHIDS            TELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLAIDDKGFGAD
CLSA_SHIB3            TELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLAIDDKGFGAD
CLSA_SALDC            SELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDTGFGAD
CLSA_SALTY            SELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDTGFGAD
CLSA_SALPK            SELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDTGFGAD
C9XTQ9_CROTZ          SELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDAGFGAD
CLSA_ENT38            TELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDAGFGGD
D4GFZ7_PANAM          GELLEAGVKIYQFEDGLLHTKSVLVDGQLSLVGTVNLDMRSLWLNFEITLAVDDAGFGSD
D8MSW6_ERWBE          AELLAAGVKIYQFEDGLLHTKSVLVDGQLSLVGTVNLDMRSLWLNFEITMVIDDDGFGGD
CLSA_SODGM            AELLEAGVLIHQFEGGLLHTKSVLVDGQLSLVGTVNLDMRSLWLNFEITLVIDDDDFGSD
A0A140NJ41_PROSM      TELLEAGVKIYQFEDGLLHTKSVLVDGELSLVGSVNLDMRSLWLNFEITVVIDDKNFGSD
CLSA_WIGBR            SELLHAGVLIYQFEGGLLHTKSILVDDQLSLVGTVNLDMRSLWLNFEITLMVDNRNFGKK
Q9KRH2_VIBCH          GELLEAGVQIHEFDGGLLHTKSVVIDQQFCLVGTVNLDMRSLWLNFELTLAVDDLEFTQQ
Q7MLM7_VIBVY          SELMEAGVKIFEFYGGLLHTKSVVIDQEFCLVGTVNIDMRSLWLNFELTLAVDDEQFTQQ
D4ZK21_SHEVD          AELLQAGVNIHRFKGGLLHTKSVVIDEAFSLIGSVNLDMRSLWLNFELTLAVDDLSFTQD
A4SKH4_AERS4          EELLEAGVEVYRYDAGLLHTKSVLVDDDFALVGTVNLDRRSLWLNFEVTLLIDNPLFVAE
A1SZT8_PSYIN          EELLVAGVKIYKFHGGLLHSKSIVIDEKIALLGTVNLDRRSFWLNFEMTMLVDNDFFADE
A4SYP0_POLAQ          EDLLDSGVKIAEFHGGLLHTKSLLVDGRTAIFGSVNFDQRSLRLNFEISLIVYNEEFCTQ
B3PB19_CELJU          DKLMKAGVHIYQFEQGLLHTKCVIIDRQLAFFGTVNMDLRSLWLNFEMTMIIYDKPTAKR
Q6AJK9_DESPS          DDLTYAGVEIMLFNGGLLHSKTITVDGDLALFGSVNLDMRSFWLNFEVTLVIYCRETTQD
M1P6W0_DESSD          EDLVSDGVSIKLFKGGLLHSKTITVDDEFALFGSVNLDMRSFWLNFEATLFIYNRDFTRE
F6ACQ6_PSEF1          LEALRAGVRIFRYLPGFLHQKVALIDGDIGVVGSANLDNRSFRLNFEITLVTVDPEFARQ
A0A379INJ2_PSEME      FEALRAGVRIFRYQPGFLHQKALLIDHDACVLGSANLDNRSFRLNFEASLLTFDETFNAQ
CLSA_PSEAE            LEAIRAGVKVFRYQPGFLHQKVVLVDRDTAAVGSANLDNRSFRLNFEVMVVTVDEGFAGE
CLSA_PSESM            FDAVRAGVRVFRYEPGFLHQKVVLVDNDITAIGSANLDNRSFRLNFELMLLTVDSDFSSQ
CLSA_PSEU2            FDAVRAGVRVFRYEPGFLHQKVVLVDNEITAIGSANLDNRSFRLNFELMLLTVDSDFSSQ
CLSA_PSEF5            FEAVRAGVRVFRYQPGFLHQKVVLIDNEISAIGSANLDNRSFRLNFEVMLLTVDDDFATE
CLSA_PSEFS            IEAVRAGVRVFRYTPGFLHQKVVLVDSEISAIGSANMDNRSFRLNFEVMLLTVDEAFAKE
CLSA_PSEPW            FEAVRAGVRMFRYQPGFLHQKVVLVDDEVSAIGSANLDNRSFRLNFEITLLTVDRDFADQ
F8GMQ2_CUPNN          YQAVSAGIKLYRYQPGFLHQKVILVDDEAAAVGTANLDNRSFRLNFELMVMTADKGFAAS
B2UI69_RALPJ          YQAIRAGVKIYRYLPGFLHQKVVLIDDEAAAVGSANLDNRSFRLNFELMIMTADSRFAND
A0A3N4GJT7_BURML      RDLVDAGVRIFRYRPGFLHQKVVLIDRAAAAVGSANLDNRSFRLNFEIMVLTVDAGFAAE
Q3JR13_BURP1          RDLVDAGVRIFRYRPGFLHQKVVLIDRAAAAVGSANLDNRSFRLNFEIMVLTVDAGFAAE
A3NAW4_BURP6          RDLVDAGVRIFRYRPGFLHQKVVLIDRAAAAVGSANLDNRSFRLNFEIMVLTVDAGFAAE
F2LG28_BURGS          RDLIDAGVRIFRYRQGFLHQKVVLIDGSAAAVGSANLDNRSFRLNFEIMVLTVDAGFAAN
B1JUG4_BURCC          RDLVDAGVKVFRYRPGFLHQKVVLIDRIAAAVGSANLDNRSFRLNFEVMVMTVDRAFAGE
Q0BE01_BURCM          RDLIDAGVKVFRYRPGFLHQKVVLIDRIAAAVGSANLDNRSFRLNFEIMVLTVDRAFADE
D5W8V6_PARAM          YDSLRAGIRIFRYQPGFLHQKVVLIDSSAAAIGSANLDNRSFRLNFEIMVLTVDRGFALE
H8KYX0_FRAAD          AEAHKAGIKMFRLQPGFIHQKVALIDDDTSMIGSMNLDNRSFRLNFEIGAINIDRDFACQ
Q1QWH1_CHRSD          PEMIRHGVRIFRYQPGFLHQKAVLVDDHTALLGSVNLDNRSFRLNFEITAYIPDAAFAHD
E1VCS7_HALED          PDMLRAGVRVYRYQPGFLHQKVILIDDVAASVGTVNLDNRSFRLNFEITAVVPDRRFAAE
L0DUG0_THIND          GPLLDAGVRVYRYQAGFLHGKSFVVDDAGGAVGTVNLDNRSFRLNFEVTALVMDRDFAGE
C4XG94_DESMR          ADLETLGVKFYRYQNGFLHQKIILVDDVMASVGTANCDNRSFRLNFELTLAVAHKGFIAD
                            *: .     *::* *   :*     .*: * * **: ****             

CLSA_BUCAI            LFCIQNKYISDSQLIDKKAWSMRAYWKRILEKIFYFLSPLL------------
CLSA_BUCAP            LSAIQKEYIDNSRLLDKNTWSMRAYWTRILEKIFYFLSPLL------------
CLSA_YERPB            LAQVQDDYIARSALLDGERWNKRPLWHRVTERLFYFFSPLL------------
CLSA_YERPE            LAQVQDDYIARSALLDGERWNKRPLWHRVTERLFYFFSPLL------------
CLSA_YERPY            LAQVQDDYIARSALLDGELWNKRPLWHRVTERLFYFFSPLL------------
CLSA_KLEP3            LAAVQDDYISRSRLLDARRWLKRPLWQRIVERLFYFFSPLL------------
CLSA_KLEP7            LAAVQDDYISRSRLLDARLWLKRPLWQRIAERLFYFFSPLL------------
CLSA_ECOLI            LAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFYFFSPLL------------
CLSA_SHIDS            LAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFYFFSPLL------------
CLSA_SHIB3            LAAVQDDYISRSRLLDARLWLKRPLWHRVAERLFYFFSPLL------------
CLSA_SALDC            LAAVQDDYISRSRLLDARLWVKRPLWQRITERLFYFFSPLL------------
CLSA_SALTY            LAAVQDDYISRSRLLDARLWVKRPLWQRITERLFYFFSPLL------------
CLSA_SALPK            LAAVQDDYISRSRLLDARLWVKRPLWQRITERLFYFFSPLL------------
C9XTQ9_CROTZ          LAEVQDDYISRSRLLDARLWVKRPFWQRVVERLFYFFSPLL------------
CLSA_ENT38            LAAVQDDYISRSRLLDASLWVKRPLWQRITERLFYFFSPLL------------
D4GFZ7_PANAM          LACVQDDYIARSRLLDPKRWAKRAWWQRIVERLFYFFSPLL------------
D8MSW6_ERWBE          LARVQDDYIARSRLVDGQRWSRRAYWQRIVERLFYFFSPLL------------
CLSA_SODGM            LARVQEDYIARSRLIEPKVWSKRPYWQRIVERLFYFFSPLL------------
A0A140NJ41_PROSM      LTLVQYDYIARSTRLEIEEWEQRPFWNRVVERLCYFFSPLL------------
CLSA_WIGBR            LKKIQTNYMSLSKVLHLKEWSKRPYWKRIIERFFYFFSPLL------------
Q9KRH2_VIBCH          MHWLQQQYIDQSHSVVYAEWEQRPWYNRFLERVFYLFNPLL------------
Q7MLM7_VIBVY          MHQLQQNYKSRAHPVHLSEWNKRSLYSRFLERLYYLFNPLL------------
D4ZK21_SHEVD          LTQLQQEYMDNSTLVDYSLWRKRPVHKRVTEQFFYLFSPLL------------
A4SKH4_AERS4          MTHLVQGYMTEATPMSLAKWRDRPRYKKVMENIFYLFSPLL------------
A1SZT8_PSYIN          LLQLQMRYLLLSDPLILEDWQKRSYHKRLLESVMYLFSPLL------------
A4SYP0_POLAQ          LKQLIESYLKQSDYLDSKAWAQRPRWHHYLENAAHLTSPLL------------
B3PB19_CELJU          LAQIVNDYRHQAKRLDLHRWQQRGRFSRLLENITHLFSPLI------------
Q6AJK9_DESPS          IRRAQMAYLRQSAPLDLRHFHRRHFFEKLKENCALLVSPTTITHPNNCSAQQL
M1P6W0_DESSD          LRAVQAGYEVQSQTLLPADFADRSIMQKFFENVSLIIGPLL------------
F6ACQ6_PSEF1          VEAMLLDDFSQSRELIGADRREVHRLQQLGMRVARLISPIL------------
A0A379INJ2_PSEME      VANMLEEDFSRSRELVNADRRNLHRLQQLGMRVARLISPIL------------
CLSA_PSEAE            VEAMLEADFAESLEFTPEDRRSVRRLQQLGMRVARLVSPIL------------
CLSA_PSESM            VEAMLTADFAAAREISLQESHETRRLHQLGMRVARLISPIL------------
CLSA_PSEU2            VESMLTADFNLAREISVQESHETRRLHQLGMRVARLISPIL------------
CLSA_PSEF5            VEHMLEADFAKAREIAKEESRQTHRLQQLGMRVARLISPIL------------
CLSA_PSEFS            VEHMLLDDFALAHEVSQEESRETRRLQQLGMRVARLISPIL------------
CLSA_PSEPW            VETMLTTDFEQAREITPEDSSKTHRIQQLGMRIARLISPIL------------
F8GMQ2_CUPNN          VATMLEADFAQARRISVDEFLDAPAPLRVAMHVAKLFAPIL------------
B2UI69_RALPJ          VAQMLEVDFAEAARVGRDEYEHAHPLRRVIMHVAKLFAPIL------------
A0A3N4GJT7_BURML      VEAMLARDFDQAFEVDLSEYRRSPAWRRVAMHVARLFAPIL------------
Q3JR13_BURP1          VEAMLARDFDQAFEVDLSEYRRSPAWRRVAMHVARLFAPIL------------
A3NAW4_BURP6          VEAMLARDFDQAFEVDLSEYRRSPAWRRVAMHVARLFAPIL------------
F2LG28_BURGS          VDAMLSQDFAAADEVDLGEVRRAGAWRRVLMHVARLFAPIL------------
B1JUG4_BURCC          VETMLDADFAQAYEVDADEYRQSPAWRRIAMHVARLFAPIL------------
Q0BE01_BURCM          VGAMLDADFAQSYEVDANEYRHSPAWRRIAMHVARLFAPIL------------
D5W8V6_PARAM          VETMLLDDFAESREIDRDEYRKANALRRMLMHVARLFSPIL------------
H8KYX0_FRAAD          VETMLEHDFEQALPVTTEEYLGAPFPRRLAMNIARLMGPVL------------
Q1QWH1_CHRSD          VETMLLHDFESCREVTLQELDDRPAWRKLVSRAAYLLAPIQ------------
E1VCS7_HALED          VHEMLVHDFTACREVTLEEIQSRALWRKLLSRAAYLLSPVQ------------
L0DUG0_THIND          LEAMFVADFARSREMTRADIDSQPLWHRVASRAAYLLAPVL------------
C4XG94_DESMR          VEAMLREDFQHCLRATADDYADRSFFFKTGVMVSRLFSPIL------------
                      :          .               :       :  *