CLUSTAL format seed alignment for MF_00191

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ISPH_BUCAI       ------------------------------------------------------MNIILT
ISPH_BUCAP       ------------------------------------------------------MNIILA
ISPH_WIGBR       ------------------------------------------------------MNIFLA
ISPH_WOLPM       ------------------------------------------------------MEIILA
ISPH_RHILO       ---------------------------------------------MLQTTNKPPLTIRLC
ISPH_RHIME       ------------------------------MPTSGFVRSTGVFMMAPSAAAKTPITIRLC
ISPH2_RHOPA      ------------------------------------------------MLAKSPLKIVLC
ISPH_CAUVC       --------------------------------------------MNAQTPIRRPISLVLA
ISPH1_RHOPA      --------------------------------------------------------MFLA
ISPH_NEIMA       ---------------------------------------------------MNEKTIILA
ISPH_CHRVO       ----------------------------------------------------MTKTIMLA
ISPH_RALSO       --------------------------------------MSTTENAAIEPVTGADAEVLLA
ISPH_BORPE       ---------------------------------------------MTAEVTAADAEVLLA
ISPH_NITEU       -----------------------------------------------------MIRVLLA
ISPH_ECOLI       ------------------------------------------------------MQILLA
ISPH_HAEDU       ------------------------------------------------------MNILLA
ISPH_PSESM       ------------------------------------------------------MQIKLA
ISPH_SHEON       ---------------------------------------------MKFDPTSPSLNIMLA
ISPH_VIBVY       ------------------------------------------------------MKILLA
ISPH_XYLFA       ------------------------------------------------------MKVLLA
ISPH_RHOBA       ---------------------------------------------------MTPMKIILA
ISPH_CORDI       ---------------------------------MCMTSPDQLTASESADTASAHKRVLVA
ISPH_COREF       ------------------------------MFGQRLDTLGAMSSSVSSPSPETGKKILLA
ISPH_MYCPA       --------------------------------MPPTVDMGIPGASSSVAVNPTRKRVLLA
ISPH_STRAW       --------------------------------------MVSMTASSG-------RRVLLA
ISPH_TROWT       --------------------------------------MHHTGLGSGVA-----KRVLLA
ISPH_BIFLO       ------------------------------MTADSCNPCLTLENTIDVQEVPMTKSVVLA
ISPH1_MYCTU      -------------------------------------MAEVFVGPVAQGYASGEVTVLLA
ISPH_CHLCV       -----------------------------------------------------MRRVILN
ISPH_CHLPN       -----------------------------------------------------MRKLILC
ISPH_CHLTR       -----------------------------------------------------MRKIILC
ISPH_PARUW       ------------------------------------------------------MKLLLS
ISPH_DEIRA       ----------------------------------------------------MIERIYLA
ISPH_THET2       -----------------------------------------------MGGMSGLRRVYLA
ISPH_LEPIN       ----------------------------------------------------MLEKIYLA
ISPH_BACSU       ------------------------------------------------------MDVIKI
ISPH_BACC1       ------------------------------------------------------MKIVKI
ISPH_BACHD       ------------------------------------------------------MNVVKI
ISPH_LISMO       ------------------------------------------------------MEIIKI
ISPH_MYCPE       ------------------------------------------------------MKIIKI
ISPH_HELPY       ------------------------------------------------------MEIKMA
ISPH_WOLSU       ------------------------------------------------------MKVKLA
ISPH_HELHP       ------------------------------------------------------MKVKFA
ISPH_CAMJE       ------------------------------------------------------MIIELA
ISPH_CLOPE       ----------------------------------------------------MERNVILA
ISPH_CALS4       ------------------------------------------------------MEILIA
ISPH_AQUAE       -----------------------------------------------------MVDIIIA
ISPH_GEOSL       ------------------------------------------------------MEIVLA
ISPH_TREPA       -----------------------------------------------MRKVNCIKVITRA
ISPH_TREDE       ------------------------------------------------------MVVKRA
ISPH_BACTN       ----------------------------------------------------MIKVEID-
ISPH_PORGI       ----------------------------------------------------MIPIEID-
ISPH_CHLTE       -----------------------------------------------------MKINLDR
ISPH_NOSS1       MDTKTFKRTLQHSENYNRKGFGHQAEVATQLQSEYQSSLIQEIRDRNYTLQRGDVTIRLA
ISPH_THEEB       MDTRAFKRSLHSSENYHRKGFGHGEEVNQQLQGEYQSSLIQQIRANGYRWQQGDVTIRLA
ISPH_PROMP       MDTQAFRRSLHHSDRYNRRGFDSPTKRAQALEEAYQSDLITSIRNNSFTYKKGRLNIKLA
ISPH_SYNPX       MDTHAFKRSLHHSERYNRRGFGRAEEVAESLEQAYQSGLIGTIRDNGYKLSHGRLTVRLA
ISPH_GLOVI       ----------MQSKNYFRKGFGLKAEVQDDLKAEYESSLIHEIRANGYTLRRGGVTVRLA
ISPH_THEMA       ------------------------------------------------------MKIVVA
ISPH_DESVH       ------------------------------------------------------MNVIRA
                                                                             

ISPH_BUCAI       NPRGFCAGVKRAILIVE---NALKVYK--------KTIYIRHELVHNQYVINTLRQKG-V
ISPH_BUCAP       KPRGFCAGVKRALLIVE---NALKIYK--------KTIYVQHELVHNQYVIETLRQKG-V
ISPH_WIGBR       NPRGFCAGVDRAINIVK---NAIEIYG--------PPIYVYNEVVHNKYVVNSLKKIG-S
ISPH_WOLPM       EPRGFCAGVKRAVDILA---ITLEKYKNE------RQVYVLHEIVHNKYIVEDFKKQG-V
ISPH_RHILO       QPRGFCAGVDRAIQIVV---LALKKYG--------APVYVRHEIVHNRYVVEGLQSLG-A
ISPH_RHIME       GPRGFCAGVDRAIQIVV---LALKEFG--------APVYVRHEIVHNRYVVEGLEAKG-A
ISPH2_RHOPA      SPRGFCAGVVRAIDTVE---RALALYG--------APVYVRHEIVHNKYVVDSLRAKG-A
ISPH_CAUVC       SPRGFCAGVDRAIQIVE---RAVEKFG--------APVYVRHEIVHNRHVVDRLKALG-A
ISPH1_RHOPA      QPRGFCAGVVRAIEIVE---RALEKYG--------PPVYVRHEIVHNKYVVESLKAKG-A
ISPH_NEIMA       NPRGFCAGVDRAISIVE---RALEEFG--------APIYVRHEVVHNKFVVDNLREKG-A
ISPH_CHRVO       NPRGFCAGVDRAIAIVE---RAIELYG--------APIYVRHEVVHNRFVVDDLRGKG-A
ISPH_RALSO       QPRGFCAGVDRAIEIVE---RALQRFG--------APIYVRHEIVHNAYVVSDLRSKG-A
ISPH_BORPE       QPRGFCAGVDRAIDIVE---RALELHG--------APIYVRHEIVHNRYVVEDLRGKG-A
ISPH_NITEU       NPRGFCAGVDRAIEIVE---RALAMYG--------APIYVRHEVVHNRFVVEDLEKKG-A
ISPH_ECOLI       NPRGFCAGVDRAISIVE---NALAIYG--------APIYVRHEVVHNRYVVDSLRERG-A
ISPH_HAEDU       NPRGFCAGVDRAISIVE---LALEVHG--------APIYVRHEVVHNRFVVDDLKAKG-A
ISPH_PSESM       NPRGFCAGVDRAIEIVN---RALEVFG--------PPIYVRHEVVHNKFVVEDLRSRG-A
ISPH_SHEON       NPRGFCAGVDRAISIVE---RALELFS--------PPIYVRHEVVHNRYVVQNLKDRG-A
ISPH_VIBVY       NPRGFCAGVDRAISIVE---RALELYQ--------PPIYVRHEVVHNRFVVEGLKQRG-A
ISPH_XYLFA       NPRGFCAGVDRAIEIVK---RTIDMLG--------TPIYVRHEVVHNRFVVDDLKQRG-A
ISPH_RHOBA       APRGFCAGVNMAIDSLD---LTLQKFG--------PPVYVYHEIVHNQFVVKTFREKG-A
ISPH_CORDI       APRGYCAGVDRAVETVE---KALEKYG--------APVYVRKEIVHNRYVVDTLAERG-A
ISPH_COREF       APRGYCAGVDRAVETVE---RALEEYG--------APIYVRKEIVHNRYVVDTLAEKG-V
ISPH_MYCPA       EPRGYCAGVDRAVETVE---RALEKHG--------PPVYVRHEIVHNRHVVSTLEKAG-A
ISPH_STRAW       APRGYCAGVDRAVIAVE---KALEQYG--------APIYVRHEIVHNKYVVQTLERKG-A
ISPH_TROWT       SPRGYCAGVDRAVIAVE---KALERHG--------PPVYVRKQIVHNVHVVGSLEKRG-A
ISPH_BIFLO       DPRGFCAGVDRAILTVQTILKAAEASGKRTREDGLPPVYVRRQIVHNKHVVEDLAGQG-A
ISPH1_MYCTU      SPRSFCAGVERAIETVK---RVLDVAE--------GPVYVRKQIVHNTVVVAELRDRG-A
ISPH_CHLCV       NPRGFCAGVVRAIQVVE---TALEKWG--------APIYVKHEIVHNRHVVDDLKRRG-A
ISPH_CHLPN       NPRGFCSGVVRAIQVVE---VALEKWG--------APIYVKHEIVHNRHVVNALRAKG-A
ISPH_CHLTR       SPRGFCAGVIRAIQTVE---VALEKWG--------RPIYVKHEIVHNRHVVDKLREKG-A
ISPH_PARUW       KPRGFCAGVERAIETVE---KALLLWG--------SPIYVKHEIVHNRHVVQGLKTKG-A
ISPH_DEIRA       KPRGFCAGVVMAIQAVEK--AAVREDK---------PVTVYHSIVHNHTVVERLSEGGRV
ISPH_THET2       RPRGFCAGVVMAIEAVERWAEALKEKG---------ELVVYHEIVHNRVVVERLQAKG-V
ISPH_LEPIN       NPRGFCAGVKYAISYVE---QVQANSE--------EQIYVRKEIVHNRRVVEDMKKNG-I
ISPH_BACSU       SPRGYCYGVVDAMVIAKNASLDKSLPR---------PIYILGMIVHNKHVTDAFEEEG-I
ISPH_BACC1       SPRGYCYGVVDAMVIARNAALDTSLPR---------PIYILGMIVHNKHVTDAFEEDG-I
ISPH_BACHD       SPRGYCYGVVDAMVLARQAAQNLDLPR---------PIYILGMIVHNKHVTDAFEEEG-I
ISPH_LISMO       SPRGYCYGVIDAMVIAKNASLDPNLPR---------PIHILGMIVHNKHVTDAFESIG-I
ISPH_MYCPE       TPRGFCKGVVDAYATCKKIA-KLYPNH---------EKYLIGWLVHNKEIIKELEELG-I
ISPH_HELPY       KDYGFCFGVKRAIQIAE--KNQ--------------NSLIFGSLIHNAKEINRLEKNFNV
ISPH_WOLSU       DKHGFCFGVKRAIKLAE--SHQ--------------GGITLGPLIHNKKEIERLKNDFGV
ISPH_HELHP       KKYGFCFGVKRAIRIAE--RNQ--------------HATTFGPLIHNSREIERLQKDFDV
ISPH_CAMJE       KNYGFCFGVKRAIKKAE--QIK--------------DAATIGPLIHNNEEISRLQKNFNV
ISPH_CLOPE       KNAGFCFGVKRAVDEAI--KYQ-KEFG--------KKIYTLGPLIHNNDVVNYLEDNNIF
ISPH_CALS4       EHAGFCFGVKRAIEIAY--EELNKQKD--------TRLYTLGEIIHNPQVVKDLEEKGVR
ISPH_AQUAE       EHAGFCFGVKRAVKLAE--ESLKES-Q--------GKVYTLGPIIHNPQEVNRLKNLGVF
ISPH_GEOSL       KRAGFCFGVKRATQMAF--EAAEK--E--------GETFTLGPIIHSPQVVQRLEGMGVK
ISPH_TREPA       HTLGYCGGVRMAVRMA---EHARAHHR--------GSVYTLGPLVHNPVTLARLRARGIE
ISPH_TREDE       EVLGYCSGVRRAVDTVLKLAKENTENK--------SGLYTFGPLIHNPSTMLRLKQMGVR
ISPH_BACTN       EGSGFCFGVVTAIHKAEEELAKG------------ETLYCLGDIVHNSREVERLKAMGLI
ISPH_PORGI       SGSGFCFGVVNAIRHAEKQLEKSS-----------DKLYCLGDIVHNTLEVERLGKKGLE
ISPH_CHLTE       TSSGFCIGVQGTIHVAEEKLAQS------------GELYCLGDVVHNEVEVKRLEALGME
ISPH_NOSS1       QAFGFCWGVERAVAMAYETRKHFPTER----------IWITNEIIHNPSVNQRMQEMQVG
ISPH_THEEB       EAFGFCWGVERAVALAYETRTHFPTER----------IWITNEIIHNPSVNERLRQMAVE
ISPH_PROMP       QAFGFCWGVERAVAMAYETRRHYPDEN----------IWITNEIIHNPSVNDHLRKMNVK
ISPH_SYNPX       EAFGFCWGVERAVAMAYETRKHYPAER----------LWITNEIIHNPSVNDHLREMDVQ
ISPH_GLOVI       EAFGFCWGVDKAVSMAYETHRMFAGRQ----------LWITNEIIHNPLVNQHLRAMGIR
ISPH_THEMA       KNIGFCFGVERAIRTVEELLDEGK------------KVVTDGEIVHNKQVMEQLTKKGLK
ISPH_DESVH       RTAGFCMGVSLALRKLDREVDRAEEKAAQGSP--RCRIATFGPIIHNPQVLEAYAGMGVR
                    .:* **  :                               ::*.             

ISPH_BUCAI       VFVEKIEQIP-----------DY-SV-----VIFSAHGVSKKVVQEAVKKKLIILDATCP
ISPH_BUCAP       VFVEDISDIP-----------NN-SI-----VVFSAHGVSKKIKKKAIKKNLTILNATCP
ISPH_WIGBR       IFVKKICDVP-----------EK-SI-----LIFSAHGVSKSILKEANKRKLIIFDATCP
ISPH_WOLPM       VFVSSIEEIE-----------DNEGI-----LIFSAHGVSKNIEDEAKRKGIQVIDATCP
ISPH_RHILO       VFIEELSEIPA---------EHRRSP-----VVFSAHGVPKSVPADAQARNLFYLDATCP
ISPH_RHIME       IFVEELDEIPP---------EHRKQP-----VVFSAHGVPKSVPADADERNLFYLDATCP
ISPH2_RHOPA      IFVEELEEIP-----------DTKAP-----VVFSAHGVPKSVPEHALSRNFFSIDATCP
ISPH_CAUVC       VFIEELEEAP------------DDRP-----VVFSAHGVPKSVPAEAKARQMIYLDATCP
ISPH1_RHOPA      IFVEELSEVP------------PKAV-----TVFSAHGVARSIEEEAAARDLPVLNATCP
ISPH_NEIMA       VFIEDLAEVP------------PGAT-----LVYSAHGVSKAVRQEAAERGFRVFDATCP
ISPH_CHRVO       VFIEELKDVP------------PGST-----LIYSAHGVPLSVRAEAEALGLTVFDATCP
ISPH_RALSO       VFVQELDDVP------------VGGT-----VIFSAHGVSRAVRQAAEARGLRVFDATCP
ISPH_BORPE       VFIDELDQAP------------AGAI-----VVFSAHGVSQAVRGEAEARGLRVFDATCP
ISPH_NITEU       VFVENLEEVP------------EGSM-----LIFSAHGVSHEVRREAAARKLQIFDATCP
ISPH_ECOLI       IFIEQISEVP------------DGAI-----LIFSAHGVSQAVRNEAKSRDLTVFDATCP
ISPH_HAEDU       IFVEELDEVP------------DSAI-----VIFSAHGVSQAVRQEAKRRGLKVFDATCP
ISPH_PSESM       IFVEELEQVP------------DDVI-----VIFSAHGVSQAVRTEAAGRGLKVFDATCP
ISPH_SHEON       VFVEELDQVP------------DNNI-----VIFSAHGVSQAVRAEAKARGLRVFDATCP
ISPH_VIBVY       IFVEELHEVP------------DDNI-----VIFSAHGVSQAVRQEAKERALTVFDATCP
ISPH_XYLFA       IFVEELHQVP------------DGAT-----VIFSAHGVSQAVRRQAAQRGLKVFDATCP
ISPH_RHOBA       VFVDTIDEVP------------EGGV-----LLFSAHGVSPEIRKAAQARKLHALDATCP
ISPH_CORDI       IFVDETTEAP------------EGAH-----LVFSAHGVSPAVHKEAEALSLKTLDATCP
ISPH_COREF       IFVEEASEAP------------EGAH-----MVFSAHGVSPAVKEEAAAKNLQAIDAACP
ISPH_MYCPA       VFVEETDEVP------------EGAI-----VVFSAHGVAPTVHAAAAERNLHTIDATCP
ISPH_STRAW       IFVERTAEVP------------EGAI-----VMFSAHGVAPVVHEEAARGKLATIDATCP
ISPH_TROWT       IFVDQVDQIP------------PGAV-----TIFSAHGVSPAVVHSANERGLQVIDATCP
ISPH_BIFLO       VFVQELAEIP------------DAAAQAGIPVVFSAHGVSPVVKAEAERRGMHVVDATCP
ISPH1_MYCTU      VFVEDLDEIP------------DPPP-PGAVVVFSAHGVSPAVRAGADERGLQVVDATCP
ISPH_CHLCV       IFIEDLSDVP------------SGEK-----VVYSAHGIPPEVREEARTRNLFDIDATCV
ISPH_CHLPN       IFVEELVDVP------------EGER-----VIYSAHGIPPSVRAEAKARKLIDIDATCG
ISPH_CHLTR       IFIEDLQEVP------------RNSR-----VIFSAHGVPPSVREEAEERGLIAIDATCG
ISPH_PARUW       IFIEDVEDVP------------VGAR-----LIYSAHGVSPAVREQAKKRQLIEIDATCG
ISPH_DEIRA       HFVEDLDAVDA---------LPDS----GDTVIFSAHGISPAVRERARSLGLSTIDATCP
ISPH_THET2       HFVEDLAEVER---------LRRERR-LADTVVFSAHGHPPAVRRQAAEMGLTVLDATCP
ISPH_LEPIN       RFINDLDEAP------------NGAT-----VIFSAHGVSPSVVEAAKQRGMKIGDATCP
ISPH_BACSU       FTLDGSNR------------LDILKQVDKGTVIFTAHGVSPEVRRIAEEKGLVAIDATCP
ISPH_BACC1       ITLDGPSR------------LDILDKIDSGTVIFTAHGVSPEVKQRAKEKGLTTIDATCP
ISPH_BACHD       ISLDGPNR------------LDILKQVDKGTVIFTAHGVSPQVRKLAKEKGLTVVDATCP
ISPH_LISMO       YTVDGANR------------EEILDKITTGTVIFTAHGVSPSVKAKAVAKGLTTIDATCP
ISPH_MYCPE       QTKDDKNHSRSEIIDS----IEIKDKNNPPIVIFSAHGTDQKTIDKAREKGLVVFDTTCI
ISPH_HELPY       KIE-EDPKKIP----------------KNKSVIIRTHGIPKQDLEYLKNKGVKITDATCP
ISPH_WOLSU       TVE-ESVENLP----------------RGSEVIIRTHGIPKDDLAKLTQSAEKIIDATCP
ISPH_HELHP       SLS-RSLEEAQ----------------KFKSVIVRTHGITKDDLQVLKEHHTHIIDATCP
ISPH_CAMJE       KTL-ENIQALS----------------NEKKAIIRTHGITKQDLEELRKKDIEIFDATCP
ISPH_CLOPE       AIELSDADSLK----------------KGDVVLIRSHGVKESVIKDLTDKGLIVKNATCP
ISPH_CALS4       VIEEEELEKLL----------------KGDRLIIRSHGISKKLYEFLEQKGVEIIDVTCP
ISPH_AQUAE       PSQ---GEEFK----------------EGDTVIIRSHGIPPEKEEALRKKGLKVIDATCP
ISPH_GEOSL       VLS---DLEGI----------------GNGTVIIRSHGVTSAELEDAVRRQLEVVDATCP
ISPH_TREPA       CLDPAHLSFALHAPAAPGAAPHAVEEKTARTVVIRAHGVAPEVYEALERSGAQVVDATCP
ISPH_TREDE       TIDTENFTED--------------EDYKDSVIVIRAHGIPPSKKSELEKSGAKVIDATCS
ISPH_BACTN       TINRDEFRQLR-----------------NAKVLLRAHGEPPETYQIAHKNNIEIIDATCP
ISPH_PORGI       TIDYDAFSRLR-----------------GAKVLLRAHGEPPEIYRMAGENGVTIIDATCP
ISPH_CHLTE       TIDIPAFEELR-----------------NAEVLIRAHGEPPSTYETARKNNLAITDTTCP
ISPH_NOSS1       FIPVEAG------------NKDFSVVGNNDVVILPAFGASVQEMQLLSEKGCKIVDTTCP
ISPH_THEEB       FIPVVNG------------VKDFSGVRPGDVVILPAFGASVQEMQLLNERGCTIVDTTCP
ISPH_PROMP       FISAKNG------------IKDFSLVSDGDVVILPAFGATVQEMKLLHEKGCHIIDTTCP
ISPH_SYNPX       FIPVEQG------------VKDFSGVTSGDVVILPAFGATVQEMQLLNERGCHIVDTTCP
ISPH_GLOVI       FLDEDESGRRV--------PKDFERVSEKDVVILPAFGASTQEMQILDEKNCVIVDTTCP
ISPH_THEMA       VSSEMTDGEV---------------------FVVRAHGIPKDRLEELKKIFPEVVDLTCP
ISPH_DESVH       CLRQVDEVEAG------------------DHVVIRAHGVPQQQEKALRSRDAVVVDATCP
                                                 :  :.*                 : :* 

ISPH_BUCAI       LVEKVHIEVSKSSE----KAIETILIGH-RGHPEVEGTIGQYNNKN--------------
ISPH_BUCAP       LVTKVHLEVSKSSK----NGIETILIGH-RGHPEVIGTIGQYDNKK--------------
ISPH_WIGBR       LVSKVHHEIKRASK----LRSEVIIIGH-KNHPEIIGTIGQYNNPN--------------
ISPH_WOLPM       LVNKVHKEAKRYEN----SGKELILIGH-ENHPEVKGIRGRVNNP---------------
ISPH_RHILO       LVSKVHKQAMRHQR----LGRHVLLIGH-AGHPEVIGTMGQLPE----------------
ISPH_RHIME       LVSKVHKQAMRHHR----MGRHVVLIGH-AGHPEVIGTMGQLPE----------------
ISPH2_RHOPA      LVTKVHREAAIHFK----RGREILLIGH-SHHPEVVGTLGQLPA----------------
ISPH_CAUVC       LVSKVHVEAQKHYD----AGREIVLIGH-AGHPEVIGTMGQLPE----------------
ISPH1_RHOPA      LVTKVHNQGKRYTS----KGRTLILIGH-AGHPEVEGTMGQVP-----------------
ISPH_NEIMA       LVTKVHKEVARLDA----QDCEIIMIGH-KGHVEVEGTMGQLAPGK--------------
ISPH_CHRVO       LVTKVHVEVKRMNK----AGMEIIMIGH-AGHPEVEGTMGQVDAG---------------
ISPH_RALSO       LVTKVHVEVSKMRT----QGFEIIMIGH-KGHPEVEGTMGQADDG---------------
ISPH_BORPE       LVTKVHIEVARMRA----AGREIVMIGH-KGHPEVEGTLGQAQGG---------------
ISPH_NITEU       LVTKVHVEVAKMDK----EGKEIVMIGH-QGHPEVEGTMGQIAKSK--------------
ISPH_ECOLI       LVTKVHMEVARASR----RGEESILIGH-AGHPEVEGTMGQYSNP-EG------------
ISPH_HAEDU       LVTKVHMQVARASK----KGTKAILIGH-QGHPEVIGTMGQYYNE-QA------------
ISPH_PSESM       LVTKVHIEVARYSR----DGRECILIGH-AGHPEVEGTMGQYDAV-NG------------
ISPH_SHEON       LVTKVHLQVTRASR----KGIECILIGH-AGHPEVEGTMGQYDNP-NG------------
ISPH_VIBVY       LVTKVHMEVARASR----KHMEVVLIGH-AGHPEVEGTMGQYASL-QG------------
ISPH_XYLFA       LVTKVHLDVARHCR----TGRDMILIGH-AGHPEVEGTMGQWDQERGT------------
ISPH_RHOBA       LVTKVHLEAIKYAK----AGYTIILIGH-EGHDEVLGTMGEAPEA---------------
ISPH_CORDI       LVTKVHNEVKRFAR----DGYHILLVGH-EGHEEVEGTAGEAPDV---------------
ISPH_COREF       LVTKVHNEVKRFDK----QGFHILFIGH-EGHEEVEGTMGHSLDR---------------
ISPH_MYCPA       LVTKVHNEARRFAR----NDYDILLIGH-EGHEEVVGTAGEAPDH---------------
ISPH_STRAW       LVTKVHKEAVRFAN----EDFDILLIGH-EGHEEVIGTSGEAPEH---------------
ISPH_TROWT       LVTKVHREVIRFSK----AGYFILLIGH-SGHEEVEGTSGHAPDR---------------
ISPH_BIFLO       LVGKVHREVLRFVR----EGYEIVYIGH-KGHDEAVGVVGESPEH---------------
ISPH1_MYCTU      LVAKVHAEAARFAA----RGDTVVFIGH-AGHEETEGTLGVAPRS---------------
ISPH_CHLCV       LVTKIHSAVKLYAS----KGYQIILIGK-KKHVEVIGIRGEAPES---------------
ISPH_CHLPN       LVTKVHSAAKLYAS----KGYKIILIGH-KKHVEVIGIVGEVPEH---------------
ISPH_CHLTR       LVTKVHSAVKMYAK----KGYHIILIGK-RKHVEIIGIRGEAPDQ---------------
ISPH_PARUW       LVTRVHSAVKRYAL----QGYQIILIGH-HNHVEIIGTAGEAPDV---------------
ISPH_DEIRA       LVTKVHTEAKKYAR----EGYTILLIGDSAGHQEVIGTRGEAPENTIL------------
ISPH_THET2       LVTKVHTEAKRYAK----EGYWILLIGDSADHQEIKGTYGEAPERTIL------------
ISPH_LEPIN       LVTRVHRKARKI-K----DTHQIIYIGH-EGHDEAIGTMGEAE-----------------
ISPH_BACSU       DVTKTHNLILEMKE----KGYHVIYIGK-KGHPEPEGAVGVAPEIVH-------------
ISPH_BACC1       DVTKTHDLIEAKKA----EGYHVIYIGK-KNHPEPEGAVGIAPDIVH-------------
ISPH_BACHD       DVTRTHDLIREKSQ----EGYKFIYVGK-KGHPEPEGAIGVAPEFVH-------------
ISPH_LISMO       DVLHTYNLILEKQA----AGYEIIYIGK-KGHPEPEGAYGTAPDVVH-------------
ISPH_MYCPE       YVTKTHDLIKEKIE----QGYQIFYIGV-NNHPETISTLSIDKSII--------------
ISPH_HELPY       YVIKPQQIVESMSK----EGYQIVLFGD-INHPEVKGVISY-------------------
ISPH_WOLSU       FVTKPQKICEIMSQ----EGYQIIIFGD-INHPEVQGVMSY-------------------
ISPH_HELHP       FVTKPQQIVEKMSQ----EGYQIIIFGD-NSHPEVKGVASY-------------------
ISPH_CAMJE       FVTKPQQICEQMSK----EGYEVVIFGD-ENHPEVKGVKSY-------------------
ISPH_CLOPE       YVTNIQLKVKKCYE----QGYKIIIVGD-KNHPEVIGINGW-------------------
ISPH_CALS4       FVKKVQNIVEEYYK----KGYDIVIVGD-KNHPEVIGVNGW-------------------
ISPH_AQUAE       YVKAVHEAVCQLTR----EGYFVVLVGE-KNHPEVIGTLGYLRA----------------
ISPH_GEOSL       FVKKAQEHVKRLSH----DGYTVVVVGD-ADHPEVQGIVSY-------------------
ISPH_TREPA       RVKESQRRAQGFAA----QGLHVILAGD-RNHGEIVGIEGYVRAGAAQACSHLPGGAPDG
ISPH_TREDE       RVKASQALAKKHSE----EAF-VILAGD-KNHGELISIAGYAEG----------------
ISPH_BACTN       VVLRLQKRIKQEFRKEDFEEKQIVIYGK-NGHAEVLGLVGQ-------------------
ISPH_PORGI       VVLRLQNKIKSRYEATRSLGAQVVIYGK-RGHAEVNGLVGQ-------------------
ISPH_CHLTE       VVAKLQRTAKMLHQ----LGYQVVIYGK-KVHPEVIGINGQ-------------------
ISPH_NOSS1       WVSKVWNTVEKHKK----GDHTSIIHGK-YKHEETIATSSFAGKYLIVLNLKEAQYVADY
ISPH_THEEB       WVSKVWHSVEKHKK----VSFTSIIHGK-YNHEETIATSSFAGTYLIVLNLEEARYVCDY
ISPH_PROMP       WVSKVWHTVEKHKK----HTFTSIIHGK-FKHEETLATSSFADKYLVVLNLEEANYVSEY
ISPH_SYNPX       WVSKVWTTVEKHKK----HTITSIIHGK-VKHEETLATSSFAGTYLVVLDMEEAQIVADY
ISPH_GLOVI       WVSAVWNRVGKYDR----AEFTSIIHGK-YQHEETVATASRARRYLVVLNLEEAQQVCDY
ISPH_THEMA       IVSQLFKTAQRYAK-----ERKVIVFGK-EDHPEMVALRGYAPAI---------------
ISPH_DESVH       KVKKAQLGIEEQCR----AGRTLLLFGE-AEHPEVRGLLSYAGEG---------------
                  *                     .  *    * *  .  .                    

ISPH_BUCAI       ----GKIYLVES-----IEDVHNLS----VQNSKKLNFFTQTTLSITNTKKIIAALKNKF
ISPH_BUCAP       ----GKIHLIED-----IEDVNQLT----IKIDKKLNFFTQTTLSIKNTQSIILALKKKF
ISPH_WIGBR       ----KKVFVIQS-----IEEICKLK----IKDPNNLFYFTQTTLSVDDTNKIIFAIKKKY
ISPH_WOLPM       ------ITLVQT-----LQDVYDLK----VKDPDNLSYVTQTTLSIDDTRDIIAALKLRF
ISPH_RHILO       ----GAVTLVET-----EADAARLV----PADPKALGFVTQTTLSVEDTAGIIRALRERF
ISPH_RHIME       ----GAVSLVET-----VEDADVYM----PPDADNLGFVTQTTLSVDDTAGVIKRLHERF
ISPH2_RHOPA      ----GAVTLIET-----AADAEAYQ----PKDPNNLAFVTQTTLSIDDTAGIVTVLRERF
ISPH_CAUVC       ----GAVTLIED-----LKDAAAWE----PKDAANVAFLTQTTLSVDDTADMVALLRERF
ISPH1_RHOPA      ----GPVLLVQN-----LDDVAALT----LPPETPVAYITQTTLSVDDTKDIIVALSKKF
ISPH_NEIMA       ------MLLVET-----VGDVAKLE----VRNPDKLAYVSQTTLSVDETKDIIAALNARF
ISPH_CHRVO       ------IYLVQT-----VDDVATLR----VVNEDQLSYVSQTTLSVDETRDIIAALKARF
ISPH_RALSO       ------MLLVES-----VDDVARLA----VKDPARLAYVTQTTLSVDETQEIVAAIKARF
ISPH_BORPE       ------MYLVET-----VEDVAALQ----VSDPGNLAYVTQTTLSVDDAAAVAGALKARF
ISPH_NITEU       ----GTMYLVET-----AEDVARLQ----VKNESNLAYVTQTTLSVDDAARVIEALKQRF
ISPH_ECOLI       ----G-MYLVES-----PDDVWKLT----VKNEEKLSFMTQTTLSVDDTSDVIDALRKRF
ISPH_HAEDU       ----G-IFLVET-----VEDIANLP----IHHHEDLTFMTQTTLSVDDTSGMIEALKNKY
ISPH_PSESM       ----GAIYLVED-----EADVASLE----VRNPESLAFVTQTTLSMDDTSRVIDALRKRF
ISPH_SHEON       ----G-VYLIES-----PADVETLE----VRDPNNLCFVTQTTLSVDDTLDIISALLKRF
ISPH_VIBVY       ----G-MYLVEK-----PEDVLGLKA--IVKDPSNLHYVSQTTLSVDETADVIDELRRVF
ISPH_XYLFA       ----GRIYLVEN-----IDDVATLH----VAQPHHLAYTTQTTLSVDDTRNIIDALRQRF
ISPH_RHOBA       ------IVLVED-----EADVDRLE----FEPGTQLAYLTQTTLSVDDAGRVIRRLRERF
ISPH_CORDI       ------THLVDG-----VESVDKLPE--FLHDE-KLIWLSQTTLSVDETMTIVKKLHERF
ISPH_COREF       ------THLVDG-----IESIPGLPA--FLADEPNLIWLSQTTLSVDETMEIVRELKKVY
ISPH_MYCPA       ------VQLVDG-----VAAVDNVR----VRDEDKVVWLSQTTLSVDETMEIVERLRQRF
ISPH_STRAW       ------ITLVDG-----PGDVAKVE----VRDPSKVVWLSQTTLSVDETMETVDALKEKF
ISPH_TROWT       ------VLIVNS-----PDEADTID----VPHTDKLVWLSQTTLSVDETLETVKRLRLRF
ISPH_BIFLO       ------VHLIEH-----ESDVDSLD----FAPDTKLVLLSQTTLSVDETADTIAALKAKF
ISPH1_MYCTU      ------TLLVQT-----PADVAALN----LPEGTQLSYLTQTTLALDETADVIDALRARF
ISPH_CHLCV       ------VTVVEK-----VEDVANLP----FEESVPLFFVTQTTLSLDDVAEITQALKVRY
ISPH_CHLPN       ------ITVVEK-----VADVEALP----FSSDTPLFYITQTTLSLDDVQEISSALLKRY
ISPH_CHLTR       ------ITVVEN-----IAEVEALP----FSAQDPLFYVTQTTLSMDDAADIVAALKARY
ISPH_PARUW       ------TTIVES-----VEDVKNLN----FSSQDKLFYITQTTLSLDDVKEITQALIVKY
ISPH_DEIRA       ----VGVLGKTG---PGLNDPHAVQ----VPDPERLVVLTQTTLSVDDTRKTVDILKARF
ISPH_THET2       ----VAVHTHVGKD-PRLADPRTVE----VPDPERVVVLTQTTLSVDDTLATIAILKKRF
ISPH_LEPIN       ------MFLVES-----LEDIISLKD--KIDPNKPLTYLMQTTLSVADTKNIIDQISKTF
ISPH_BACSU       --------LVETE-----EDVKNLD----IQSEK-LIVTNQTTMSQWDVHDIMELVKEKY
ISPH_BACC1       --------LIERA-----DDLKTLE----IPTDK-ILVTNQTTMSQWDVQHLMEDIQKKF
ISPH_BACHD       --------LVENV-----EDVESLD----ISADK-IIITNQTTMSQWDVSEIMKKAMEKY
ISPH_LISMO       --------LVETK-----ADIDALS----LLSDK-IFVTNQTTMSKWDVADLMHYIKGKF
ISPH_MYCPE       --------LIETV-----NDIENIR----TESEKPIFVTNQTTISIYEFEEITETLKSKY
ISPH_HELPY       --ATNQALVVNS-----LEELQ------EKKLQRKVALVSQTTKQTPKLLQIASYLVER-
ISPH_WOLSU       --SSSEPIVVMS-----PKELF------GAKLKEKVALVSQTTKKIEDFLGVASFLVQR-
ISPH_HELHP       --GDDVAIIAN------IDELK------HLTLKKKVALVSQTTKQPEHFGKIAALLVSL-
ISPH_CAMJE       --VSTKAYVVLD-----KKELQ------NIKLPNKIAVVSQTTKKPEHFMEIVNFLILK-
ISPH_CLOPE       --CNDSAIITNG-----KTELE------NIP--AKVCVVSQTTEKKETWNKVLNEIVRA-
ISPH_CALS4       --CEDKAYIVNS-----VEEAE------NLPFFEKACAVSQTTLIEKHWEDILEVLKSK-
ISPH_AQUAE       --CNGKGIVVET-----LEDIG------EALKHERVGIVAQTTQNEEFFKEVVGEIALW-
ISPH_GEOSL       --AEGPVHVVGS-----GEEAA------RLPNMKKVGVVAQTTQSFETLKNVVKECLLK-
ISPH_TREPA       MLPQVQCFVVQN-----AREAA------ALPCLARAALLAQTTITQGEYDAIAAAARTR-
ISPH_TREDE       -----KCLIVQN-----AEEAALIDLPSSLSANGSAVLIAQTTIKESEYEAIASALKKR-
ISPH_BACTN       --TGGQAIVIE-----SAEEAK------KLDFTKSIRLFSQTTKSLDEFQEIVEYIKL--
ISPH_PORGI       --TEGTAIVIE-----SEEELD------KIDYTRPVILFSQTTKSLEGFGQIIDSIST--
ISPH_CHLTE       --CDDEGVVIKHPDLSDPEEIA------PLDLSRKTALISQTTMDVPGFYELKRNLEKLF
ISPH_NOSS1       ILHGGNREEFLQKFAKACSAGFDPD-----RDLERVGIANQTTMLKGETEQIGKLFEHTM
ISPH_THEEB       ILHGGDRAAFMAKFAKACSPGFDPD-----RDLVRVGIANQTTMLKGETEQIGKLFERTM
ISPH_PROMP       ILGRGNKNHFLNKFAQAFSNGFDPD-----KDLDRVGVANQTTMLKSETEEIGKVFEKTM
ISPH_SYNPX       ILGKGDRDAFMQRFSAACSPGFDPD-----RDLSRLGVANQTTMLKSETEEIGRLFERTM
ISPH_GLOVI       ILHGGDRRAFLAHFGMAACEGFDPD-----RDLVRVGIANQTTMLKGETERIGKLFERTM
ISPH_THEMA       -----------------VTKVPFKLE------EKKVVFLSQTTSSLEEYKEFVAAMIRMN
ISPH_DESVH       ------ALVFGS-----VDELEGLP----LQPETEYFLAAQTTQDRVAFEVARAWLHERL
                                                         ***                 

ISPH_BUCAI       P-------------------------------EISGPNKEDICYATTNRQIAVRQLSKI-
ISPH_BUCAP       L-------------------------------NISGPKKEDICYATTNRQNAIIKLSKI-
ISPH_WIGBR       P-------------------------------YIIEPRKKDICYATENRQKSIKKIIKL-
ISPH_WOLPM       P-------------------------------GITGPDLKDICYATQNRQNAVKKLAEI-
ISPH_RHILO       P-------------------------------DLQAPAAESICYATTNRQEAVKDTAPG-
ISPH_RHIME       P-------------------------------NLTAPAADSICYATTNRQEAVKQAAPG-
ISPH2_RHOPA      P-------------------------------NISGPHKEDICYATTNRQAAVKKVAPV-
ISPH_CAUVC       P-------------------------------GIAAPHKEDICYATTNRQDAVKHLAEQ-
ISPH1_RHOPA      H-------------------------------DIEGPDTRDICYATQNRQSAVRQMSKL-
ISPH_NEIMA       P-------------------------------NIRNPHKEDICYATTNRQTAVKELAEQ-
ISPH_CHRVO       P-------------------------------NIHSPKKDDICYATQNRQDAVKLLADQ-
ISPH_RALSO       P-------------------------------AVHEPKKQDICYATQNRQDAVKFMAPQ-
ISPH_BORPE       P-------------------------------GIVEPKKSDICYATQNRQDAVKLLAPE-
ISPH_NITEU       P-------------------------------KIIGPKKDDICYATQNRQDAVKKLVKL-
ISPH_ECOLI       P-------------------------------KIVGPRKDDICYATTNRQEAVRALAEQ-
ISPH_HAEDU       P-------------------------------AIQGPRKNDICYATTNRQQAVRELAKQ-
ISPH_PSESM       P-------------------------------AIGGPRKDDICYATQNRQDAVKQLADE-
ISPH_SHEON       P-------------------------------SIEGPRKDDICYATQNRQDAVRNLSAD-
ISPH_VIBVY       P-------------------------------EIQGPRKDDICYATQNRQDAVRELAKD-
ISPH_XYLFA       P-------------------------------TIQGPKNNDICYATQNRQDAVRELARE-
ISPH_RHOBA       P-------------------------------EIHSPPKDDICYATQNRQEAVKLLRED-
ISPH_CORDI       A-------------------------------HLQDPPSDDICYATQNRQVAVKAIAAE-
ISPH_COREF       P-------------------------------QLQDPPSDDICYATQNRQVAVKAIAER-
ISPH_MYCPA       P-------------------------------KLQDPPSDDICYATQNRQVAVKAMAPE-
ISPH_STRAW       P-------------------------------QLISPPSDDICYATQNRQLAVKQMGEE-
ISPH_TROWT       P-------------------------------HIQDPPSDDICYATQNRQAAVKKIAPL-
ISPH_BIFLO       P-------------------------------WIQEPPSSDICYATSNRQAAVKLVAQQ-
ISPH1_MYCTU      P-------------------------------TLGQPPSEDICYATTNRQRALQSMVGE-
ISPH_CHLCV       P-------------------------------HIITLPSSSVCYATQNRQEALRSVLPK-
ISPH_CHLPN       P-------------------------------SIITLPSSSICYATTNRQKALRSVLSR-
ISPH_CHLTR       P-------------------------------RIFTLPSSSICYATQNRQGALRNILPQ-
ISPH_PARUW       P-------------------------------HVETLPSSSICYATTNRQMALREITDL-
ISPH_DEIRA       P-------------------------------ALVVPPSEDLCYATKNRQDAVKNIAPN-
ISPH_THET2       P-------------------------------KLVVPSRKDLCYATQNRQEAVKRIAPK-
ISPH_LEPIN       P-------------------------------FVEHPSKDDICYATTERQEAVSLMMDK-
ISPH_BACSU       P-------------------------------HVE--YHQEICLATQVRQEAVSEQAKK-
ISPH_BACC1       P-------------------------------TAE--FHKEICLATQVRQEAVAKQADV-
ISPH_BACHD       P-------------------------------QAE--VHNEICLATQVRQEAVAEQARE-
ISPH_LISMO       P-------------------------------KAI--QHQEICMATQVRQEAVALQAKD-
ISPH_MYCPE       K-------------------------------NIE--FKNDICNAAKDRQDAVINMPSE-
ISPH_HELPY       --------------------------------CTEVRIFNTICNATSYNQKAALDLSKE-
ISPH_WOLSU       --------------------------------CAEVRIFNTICNATFDNQEAARHLSQE-
ISPH_HELHP       --------------------------------VNECRIFNTICSATFENQFAVDELSRE-
ISPH_CAMJE       --------------------------------TKEVRVFNTICDATFKNQDAIKELSLK-
ISPH_CLOPE       --------------------------------SKEIVAFNTICSATDVRQKSVQELSKE-
ISPH_CALS4       --------------------------------AKELVYFNTICNATQKRQEAADALSKK-
ISPH_AQUAE       --------------------------------VKEVKVINTICNATSLRQESVKKLAPE-
ISPH_GEOSL       --------------------------------GGEIRVFNTICDATAVRQDEAKALARE-
ISPH_TREPA       --------------------------------VRELTVARTICAATARRQAALRALAPT-
ISPH_TREDE       --------------------------------ISDLKVFNTICPATSDRQAALKKLAYE-
ISPH_BACTN       ----HISPDA------------------------TFEYYDTICRQVANRMPNLREFAAT-
ISPH_PORGI       ----RMQPGV------------------------TFEHHDTICRQVANRIPHIGAFATA-
ISPH_CHLTE       AEHGHRNPGTQSGEWMAVRDIDITAEKTGALAMPKLVFKDTICRQVSSRNGKLRDFALA-
ISPH_NOSS1       LQKYGPVE-----------------------LNQHFQSFNTICDATQERQDAMLELVQEN
ISPH_THEEB       IQKYGPDR-----------------------LNEHFMSFNTICDATQERQDAMLSLVKEP
ISPH_PROMP       LHKFGPEK-----------------------LNSHFLAFNTICDATEERQDAMFSLVDED
ISPH_SYNPX       LSKYGPAE-----------------------LNDHFVAFNTICDATQERQDAMFSLVDEP
ISPH_GLOVI       MRRYGPAN-----------------------LADHFMSHDTICDATQERQDAMFKLVEEP
ISPH_THEMA       E-------------------------------FEEAVFLNTICPVTVNREREVEELSKI-
ISPH_DESVH       G--------------------------------HEVPVLETICDATRLRQQEAIDIARK-
                                                          :*  .  .           

ISPH_BUCAI       ADIIFVIGSNNSSNSNRLAELGKETGTF----TKLISSFLDIKKKW--------------
ISPH_BUCAP       TDIILVIGSKNSSNSSRLSELGKETGVF----TKQIESFSDIKEEW--------------
ISPH_WIGBR       VDIIFIIGSKNSSNSNRLFEIANKSGKK----SYLIDTYKEIKKSW--------------
ISPH_WOLPM       VDMVLVVGSKNSSNSNRLLDLCTARGKR----AYLIDNYSCVNKSW--------------
ISPH_RHILO       ADLYLIVGAPNSSNSRRLVEVAERAGAT---MSLLVQRAAEIPWND--------------
ISPH_RHIME       CDLFLVVGAPNSSNSKRLVEVALRAGAK---KAVLVQRASEIDWST--------------
ISPH2_RHOPA      VDAMIVVGAPNSSNSQRLREVAEREGCK---VAVLVQRASDLDWSQ--------------
ISPH_CAUVC       SELILVVGSKNSSNSVRLKEVGLKAGAR---DAHLIDDASGIDWTW--------------
ISPH1_RHOPA      VDLILVVGANNSSNSNRLREIGTEAGIP----SYLIADGSELDPAW--------------
ISPH_NEIMA       CDIVIVVGSPNSSNSNRLREVAASRGID----AYMVDNAGYLQRAW--------------
ISPH_CHRVO       CDIVVVVGSPNSSNSNRLREVAALKGVD----AYMVDNASLLEPEW--------------
ISPH_RALSO       VEVVIVVGSPNSSNSNRLRELAEKLGVP----AYMVDTPEQVRPEW--------------
ISPH_BORPE       CDLVLVVGSTNSSNSNRLREVAERKGVA----AYLIDGAHAIDPAW--------------
ISPH_NITEU       CDLVVVVGSPNSSNSNRLCEVARNENVE----AYMVDQAEQLQESW--------------
ISPH_ECOLI       AEVVLVVGSKNSSNSNRLAELAQRMGKR----AFLIDDAKDIQEEW--------------
ISPH_HAEDU       AQLVLVVGSKNSSNSNRLAELASRMGVL----AKLIDGPQDILPEW--------------
ISPH_PSESM       CDVVLVVGSPNSSNSNRLRELAERMATP----AYLIDGAEDMQKGW--------------
ISPH_SHEON       VDLLIVVGSKNSSNSNRLRELALKTGTQ----SYLVDTADDIDSSW--------------
ISPH_VIBVY       VDVVVVVGSKNSSNSTRLKELAEKLGTP----AYLTDCPQDIEPQW--------------
ISPH_XYLFA       CDLVLVVGSPNSSNSNRLSELAQREGVA----SYLIDSAAEIDPAW--------------
ISPH_RHOBA       ADVIVVLGSQNSSNSQRLKELAAEQGKR----AMLVDGPQDLAVDQ--------------
ISPH_CORDI       SDVVIVVGSQNSSNSKRLVEVALQAGA--GA-SYLVDYAHQIDESW--------------
ISPH_COREF       CDLMIVVGSTNSSNSVRLVEVALQAGA--KN-AYLVDYAHQIDEAW--------------
ISPH_MYCPA       CDLVIVVGSRNSSNSVRLVEVALGGGA--GA-AHLVDWADDIDPAW--------------
ISPH_STRAW       ADLVIVVGSRNSSNSVRLVEVAKLAGA--RD-AYLVDFADEIDEAW--------------
ISPH_TROWT       SDLVIVVGSANSSNSVRLVEVALENGA--KA-AVRLDYADELDPAL--------------
ISPH_BIFLO       SDCVVIVGSANSSNSVRLMEVAQEGLGERGK-AYRVDDASELDPAW--------------
ISPH1_MYCTU      CDVVLVIGSCNSSNSRRLVELAQRSGT---P-AYLIDGPDDIEPEW--------------
ISPH_CHLCV       VNFVYVIGDVQSSNSNRLREVAEKRNIP----ARLVNSPDHISDEI--------------
ISPH_CHLPN       VNYVYVVGDVNSSNSNRLREVALRRGVP----ADLINNPEDIDTNI--------------
ISPH_CHLTR       VDFVYVIGDTQSSNSNRLREVAERRGVT----ARLVNHPDEVTEEI--------------
ISPH_PARUW       TDLVLVVGDPQSSNSNRLREAASTRGIE----SYLINDEKEIHPEW--------------
ISPH_DEIRA       VDAFLVLTSTHSSNGMRLLELAEAECGR----AYRLETAADLTRLEQNGD----------
ISPH_THET2       VEAFLVLTSPHSSNGMRLLELAQSLVGR----AYRLERPEELRPEW--------------
ISPH_LEPIN       IDAMLVIGADNSSNSLRLLQLAQKSKPH----SFKVSTADDLSKEYIQ------------
ISPH_BACSU       ADLTIVVGDPKSNNSNRLAQVSEEIAG---TKAYRIGDLSELKLEW--------------
ISPH_BACC1       ADLTIVVGDPKSNNSNRLAQVSQEIAG---TKAYRVADVSEIKLEW--------------
ISPH_BACHD       CDLVIVVGDPKSNNSNRLAQVSEQIAG---TKAYRIGDVTELQQEW--------------
ISPH_LISMO       ADLTIVVGDPRSNNTARLAQVSIEKAG---TKAYRIADITELDIEW--------------
ISPH_MYCPE       VDLLLVVGDIKSNNSKKLVEIGIKKQ----IESHLIWNTKNIKDEW--------------
ISPH_HELPY       VDIMIVVGGKTSSNTKQLLSIAKQHCKD----SYLVEDENELELAWFKDK----------
ISPH_WOLSU       VDIMIIAGGKNSSNTKQLLSICLEHCQD----SYLIEDESELDPQWFTNK----------
ISPH_HELHP       ADIMVIVGGKNSSNTKQLFKIAKEYCTD----SYLIEDENEIDNTWFVGK----------
ISPH_CAMJE       SDVMVVVGGKNSANTKQLFLIAKTNCED----SYLIETEEELKKEWFLDK----------
ISPH_CLOPE       ADLVFVIGGKNSSNTTKLYEICKKECPK----SYHIENVKELDESLLEDES---------
ISPH_CALS4       VDVMFVIGGKHSSNTQKLRKICEKNCKN----TYHIERADEITFEMLKGH----------
ISPH_AQUAE       VDVMIIIGGKNSGNTRRLYYISKELNPN----TYHIETAEELQPEWFRGV----------
ISPH_GEOSL       VDCMIVIGGFNSANTKRLAEVCSELQPR----TYHIETAQELDASWFQGV----------
ISPH_TREPA       VEALLVIGGAHSANTQRLLHTARETSLP----TWLVERVEDIPPDIYAFS----------
ISPH_TREDE       VDALLVIGGKNSANTKRLFQTAVDTKKP----AWLIEDASEIPKEIFSYS----------
ISPH_BACTN       HDLIFFVSGKKSSNGKMLFEECLKVNAN----SHLIDNEKEIDPTLLRNV----------
ISPH_PORGI       HELVFFVAGEKSSNGKVLFGHCLAANPR----SIFISSPEVIVPDMLVPLP---------
ISPH_CHLTE       NDCIVFAAGRKSSNGQVLYSICKDANPH----SYFIEDVDEIRPEWFVGEN---------
ISPH_NOSS1       LDLMIVIGGFNSSNTTQLQQISQERGLP----SYHIDVVERIKS-INSIEHRQLNGE-LV
ISPH_THEEB       LDLMVVIGGYNSSNTTHLQEIAIEHGIP----SYHIDSADRIGP-GNRIEHKPLHQN-PT
ISPH_PROMP       LDILVVIGGYNSSNTTHLQEIAINKNIS----SFHIDTPERISVKENSILHKPLKSE-MV
ISPH_SYNPX       LDLMVVIGGFNSSNTTHLQEIALSRGIR----SFHIDTPDRLDAQANAIEHKPLNEN-LR
ISPH_GLOVI       LDLLVVIGGYNSSNTTHLQEIAVERGLP----SFHIDGADRLVS-AQFIEHRDLHSKSLV
ISPH_THEMA       CDLSIVVGGKHSSNTGKLFRIASKHSKT-----IWIESPDELPADV--------------
ISPH_DESVH       VDAMVVVGGFDSGNTRRLADVAAAQGVF----TVHVENESQLPVEQ--------------
                  :   .     * *   *                       :                  

ISPH_BUCAI       ------LKNVNYIGITAGASAPEILVTEVIQYLRKIGAHKP------IEMIGVREKKIFK
ISPH_BUCAP       ------LKNKKNIGITAGASAPDILVEEVIKHLKKLGFKNPP-----KEMLGDEEKTIFK
ISPH_WIGBR       ------LNGVNNIGITAGASAPEILVQQVVNYLKIFYKNSVNI----YQVDGDIEKTKFM
ISPH_WOLPM       ------FQGVEKIGITAGASAPDILVDELIDYLKVNLSVKIS-----VMPGGITENVQFK
ISPH_RHILO       ------IGTISTLGLSAGASAPEIIVDEIIDAFRQRFDVTID------LAITATETEDFP
ISPH_RHIME       ------VGDISMVGLSAGASAPEVIVNEIIEAFRDRYDATVE------LADTVEENEHFL
ISPH2_RHOPA      ------FEGIKVLGLTAGASAPEVIVEEIMGAFAERFDLSVE------TVSAAEENEFFP
ISPH_CAUVC       ------FDGISRVGLTAGASAPEDLVQGVIDAISARFDTTVE------ELVEARETITFK
ISPH1_RHOPA      ------LDGKKAVGITAGASAPEVLVDDVIEALRRIVPVTVS------VLPGREENIEFV
ISPH_NEIMA       ------FEGKNKVGVTAGASAPEVLVREVLATIRGWGHETVR------EGEGAEESIVFV
ISPH_CHRVO       ------FAGKRRVGVTAGASAPEVLVQAVIDRIKAFDVTQVT------ELPGVEESTVFA
ISPH_RALSO       ------LAGKRRVGLTAGASAPEELAQSIVDRLRALGARSVR------PLDGIQENMSFP
ISPH_BORPE       ------LQGRRSIGITAGASAPEVLVQQVVERVRELGAVSVR------TMPGLEESVAFP
ISPH_NITEU       ------LTNKRCIGITAGASAPEILVQQVLERLEQIAAKQSNQGVIIEELSGVLESVTFP
ISPH_ECOLI       ------VKEVKCVGVTAGASAPDILVQNVVARLQQLGGGEAI------PLEGREENIVFE
ISPH_HAEDU       ------LDNVETIGITAGASAPEILVQSVVAHLQTLGATSVA------NLVGCEENMVFE
ISPH_PSESM       ------FDGVERIGITAGASAPEVLVRGVIQQLQAWGATGAD------ELAGREENITFS
ISPH_SHEON       ------FENITKVAVTAGASAPEVLVQQVVQAIAKLAPSVVT------EVEGRKEDTVFA
ISPH_VIBVY       ------FDGKVKVGVTAGASAPEELVNQILTRIKELGAQSVE------EVLGREENMFFE
ISPH_XYLFA       ------VIDKHHIGVTAGASAPQVLVDGVLARLYELGATSVS------EHSGKPESMVFA
ISPH_RHOBA       ------FSDDDRVLITAGASAPESVVQSTIDWLKENFDASVD------TQVVREEDVQFP
ISPH_CORDI       ------LDGATTVGVSSGASVPEILVRGVLEFLDARGFHDVK------EITTAAEKITFA
ISPH_COREF       ------LDGVQTIGISSGASVPEILVTGVLERLAGYGFDDVE------EVTTAAEKIVFA
ISPH_MYCPA       ------LEGVTTVGVTSGASVPEVLVQGVLERLAECGFDVVQ------PVTTAQETLVFA
ISPH_STRAW       ------LEGVSTVGVTSGASVPEILVEQVLEWLSQRGFEDVE------IVKAAEESITFS
ISPH_TROWT       ------LDKVDVVGVTSGASVPEILVRDLLEVLARAGYTKVE------SVQTAVEDLVFS
ISPH_BIFLO       ------FEGLESVGISSGASVPDELVSGVIDALQNLGFTGMK------SVETIKENMHFV
ISPH1_MYCTU      ------LSSVSTIGVTAGASAPPRLVGQVIDALRGYASITVV------ERSIATETVRFG
ISPH_CHLCV       ------LNYSGDIAITAGASTPEHIVQSCISRLKELIPDLQVEED-----IFAIEDVVFQ
ISPH_CHLPN       ------VNHSGDIAMTAGASTPEDVVQACIRKLSSLIPGLQVEND-----IFAVEDVVFQ
ISPH_CHLTR       ------LQYSGNIGITAGASTPEDVVQACLMKLQELIPDLSIEMD-----LFVEEDTVFQ
ISPH_PARUW       ------LLGKQVIGLTAGASTPEEIVQKCIQCLIELGVN-EVEDI-----VYTHEDVVFQ
ISPH_DEIRA       ------LGGVRSVGITSAASTPDDLVQDVVAHFRALNPALEV------IEEGEWENIEFR
ISPH_THET2       ------LEGVESLGITSAASTPEDLVQGVVARLKAQNPGLEV------VEEGAWETIAFR
ISPH_LEPIN       ------NNEIKILGLTAGASTPQVLVDEIISKLKIFYPNANVE----LFPGSRDDSMNFK
ISPH_BACSU       ------LKGVNTVAVTAGASTPTPITKEVIRFLEQFDHEDPS-----TWTTEHNIPLKKI
ISPH_BACC1       ------LQGVENVAVTAGASTPTPITKEVIAFLEQYDPMNPA-----TWERVRKVPLQKI
ISPH_BACHD       ------FDGVETVGVTAGASTPTPITKEVIAFIEKYDPSKPE-----TWTPERKVTLQKI
ISPH_LISMO       ------IKDAKKVAVTAGASTPTQLVREVLLFLEQFDAADKT-----TWKREHNQDFERI
ISPH_MYCPE       ------FINKKCLAITSGCSTPTWLANYVIIFLEKKLGTAND------------------
ISPH_HELPY       ----------KLCGITAGASTPDWIIENVKQKISTI------------------------
ISPH_WOLSU       ----------KTCGVTAGASTPEWIIERVVRTIEGYKG----------------------
ISPH_HELHP       ----------ELCGITAGASTPDWIISRVQEKIEQI------------------------
ISPH_CAMJE       ----------KHCGISAGASTPDWIIQKVIAKIENFRIN---------------------
ISPH_CLOPE       ---------VKTIGITAGASTPDWIINEVISKIKEL------------------------
ISPH_CALS4       ----------DIIGITAGASTPDYVIEEVIEKIKSLKGEDENE-----------------
ISPH_AQUAE       ----------KRVGISAGASTPDWIIEQVKSRIQEICEGQLVSS----------------
ISPH_GEOSL       ----------ERVGVTAGASTPKWLIDEVIERIQEFDNKKKG------------------
ISPH_TREPA       -----------AVGISAGASTPDCVIAAVEQALRTGGAPVASRVSSSALPKVSTCRAVCA
ISPH_TREDE       -----------VIGLTAGASTPDFIIDEVEKKLLEG------------------------
ISPH_BACTN       ----------KSIGVCGATSTPKWLMEKIHDHIQLLIKD---------------------
ISPH_PORGI       ----------ASIGICGATSTPRWQMEEVASHIKALL-----------------------
ISPH_CHLTE       ------GKPVESVGICGATSTPMWLLEKVANYIDKTFGDGSSNPNA--------------
ISPH_NOSS1       TTENWLPAGKIVVGVTSGASTPDKVVEDVIEKIFALKATAAVF-----------------
ISPH_THEEB       VAENWLPDRPITIGITSGASTPDKVVEEVLNKIFALRSVATVS-----------------
ISPH_PROMP       LKKNFIPDGEIKVGITSGASTPDKIVADVIEKLIAITK----------------------
ISPH_SYNPX       LESNFLPAGPVTVGITSGASTPDRAVEEVIEKLMLLSES---------------------
ISPH_GLOVI       RTKNWLPAGEVTVGVTAGASTPDRVVAEVIARIFELKGVGESGATGAISSPVLSSAEGGP
ISPH_THEMA       -------VKYGTVCVFSGTSTPNSLIENVVRKLKEMEGKRDGTI----------------
ISPH_DESVH       ------LRGCGIIGLTAGASTPKSIIDATQRFLESL------------------------
                               : .. *.*          .                           

ISPH_BUCAI       IPKKLLNIKTILDENG-------------
ISPH_BUCAP       IPKNL-NVQN-------------------
ISPH_WIGBR       IPKKLILKIK-------------------
ISPH_WOLPM       IPNLV------------------------
ISPH_RHILO       VMRVLRDVELTPADMAFVNGAA-------
ISPH_RHIME       VNRELRHVELTGADMAFVNGE--------
ISPH2_RHOPA      VPRVLRPDAAE------------------
ISPH_CAUVC       LPRLLTA----------------------
ISPH1_RHOPA      LPAELATA---------------------
ISPH_NEIMA       LPKELRREGETKPDLCKR-----------
ISPH_CHRVO       LPPALRPLF--------------------
ISPH_RALSO       LPRGLQIN---------------------
ISPH_BORPE       LPKGLSRKIAQTESLE-------------
ISPH_NITEU       LPKAEPVSFNKYI----------------
ISPH_ECOLI       VPKELRVDIREVD----------------
ISPH_HAEDU       VPKELRV--REVK----------------
ISPH_PSESM       MPKELRV--KSLL----------------
ISPH_SHEON       VPAELR-----------------------
ISPH_VIBVY       VPKELQIKQID------------------
ISPH_XYLFA       LPKALRLQLVD------------------
ISPH_RHOBA       LPKPLRAFAAEQAAAK-------------
ISPH_CORDI       LPRDLRPART-------------------
ISPH_COREF       LPRVLRPAR--------------------
ISPH_MYCPA       LPREIRSAR--------------------
ISPH_STRAW       LPKELRRDLRAEAAALVEQRTGNGPSAE-
ISPH_TROWT       LPKGLRESRK-------------------
ISPH_BIFLO       LPAELRRKK--------------------
ISPH1_MYCTU      LPKQVRAQ---------------------
ISPH_CHLCV       PPKELRN----------------------
ISPH_CHLPN       LPKELRCS---------------------
ISPH_CHLTR       LPKEL------------------------
ISPH_PARUW       LPKPIVNARFSVD----------------
ISPH_DEIRA       EPKKIAPTQELPRTMQ-------------
ISPH_THET2       EPKPLSPEEVLKGA---------------
ISPH_LEPIN       LPGVLLS----------------------
ISPH_BACSU       LPKVKAKN---------------------
ISPH_BACC1       LPRVKVKKEQ-------------------
ISPH_BACHD       LPKVKIKK---------------------
ISPH_LISMO       LPKTKNKYMAEKRSQRLAHLKNGGS----
ISPH_MYCPE       -----------------------------
ISPH_HELPY       -----------------------------
ISPH_WOLSU       -----------------------------
ISPH_HELHP       -----------------------------
ISPH_CAMJE       -----------------------------
ISPH_CLOPE       -----------------------------
ISPH_CALS4       -----------------------------
ISPH_AQUAE       -----------------------------
ISPH_GEOSL       -----------------------------
ISPH_TREPA       AATSSVGSAGASGAVSPGAVRPFAVGSVR
ISPH_TREDE       -----------------------------
ISPH_BACTN       -----------------------------
ISPH_PORGI       -----------------------------
ISPH_CHLTE       -----------------------------
ISPH_NOSS1       -----------------------------
ISPH_THEEB       -----------------------------
ISPH_PROMP       -----------------------------
ISPH_SYNPX       -----------------------------
ISPH_GLOVI       SLS--------------------------
ISPH_THEMA       -----------------------------
ISPH_DESVH       -----------------------------