CLUSTAL format seed alignment for MF_00192

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOK_THEAC      ----------------------------MKYTKFEKARIIGARALQIAMGAPVIIDVPKN
RPOK_THEVO      ----------------------------MKYTKFEKARIIGARALQIAMGAPVIIDIPKN
RPOK_PYRHO      ---------------------------MFKYTRFEKARIIGARALQIAMGAPVLIDVPEG
RPOK_ARCFU      --------------------MGIKVKFPFEYTRFEKARIIGARALQIAMGAPVLIETDKT
RPOK_HALMA      ------------------------MNAQE--SRYEKARKLGARALQLAHGAPVLIETEHT
RPOK_HALSA      ------------------------MSDSQHFSRYEKARIIGARALQVAYGAPVLVDTDQT
RPOK_SULAC      -------------MTIDKINEIFKENWKNKLTKYEIARIISARALQLSMGALPLIDTSNL
RPOK_SULTO      ----------------MSINKIFEESWKNRLTKYEIARIISARALQLAMGASPLIDTNNL
RPOK_SACS2      ----MGLERDEILSQDLHFNEVFISLWQNRLTRYEIARVISARALQLAMGAPALIDINNL
RPOK_METJA      ----------------------------MKLTKFEIARILGARSLQISSGAYATIETKCD
RPOK_AERPE      -----------------------MKIGPPYLTKYERARIIGVRAFQLSIGAPPLVDPERA
RPOK_PYRAE      MTTSELIERINKLIDVVDKAINKREFYPPRLTKYETARIIGARALQLAMGAQPLVDIQEV
RPOK_METTH      -----------------------MHMASKKLTRFERARLIGARALQISMGARPLVEIKE-
                                               :::* ** :..*::*:: **   ::    

RPOK_THEAC      I-IDPVDIAMLEFENNVIPITIKKASK----ILN------------------
RPOK_THEVO      V-IDPVDIATIEFENNVIPITIKRVSK----VLN------------------
RPOK_PYRHO      --ITPLEAAIMEFEKGVIPITVIRPS--------------------------
RPOK_ARCFU      ---EPLEIALEEFNRGVIPITVRRRRN----EFVWLERYDLF----------
RPOK_HALMA      ---QPILIAAEEYDAGVLPFTVNRSD--------------------------
RPOK_HALSA      ---EPILIAAEEYDADALPFTVRREGT-------------------------
RPOK_SULAC      KSDDVISIAEEELKRGVLPITIRRIYPNGQVELISVRKIENR----------
RPOK_SULTO      PFNDVISIAEEELKRGVLPITVRRVYPNGKIELVSVKKVEFK----------
RPOK_SACS2      SSTDVISIAEEEFRRGVLPITIRRRLPNGKIILLSLRKS-------------
RPOK_METJA      ---SSLKIAYEEIKQGKVPLKPIRPVKA------------------------
RPOK_AERPE      GSRNPLDIARYEVDNGILPVSIYRYLPGGGGQSLSLSRLVELAREILGSEYV
RPOK_PYRAE      GSVDPVLIAMEELRRGLLDFIIVREMPDGKTMRIRLKELLELERTL------
RPOK_METTH      -SLDPVDIARKELEKKVMPLDVRRDK--------------------------
                     :  *  *     : .   :