CLUSTAL format seed alignment for MF_00193

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G7ZAJ1_AZOL4      --------MLNALSSPLAQFDSKALDLDCAAAAREIENAMQRIVAQDLRRQGIVLGVSGG
A1ASZ5_PELPD      ---------MNGTVHHLREALRL----NPDNEASRISREIREMMLGQIKRRGLVVGLSGG
B8GVB4_THISH      --------MSQKLSPDVLKI-------DAEAEVERISAALREILRKDLNRRGLIIAISGG
NADE_RHIME        ------MNIRPDQNRLVFSADTLKI--DEAAEADRIVAGLRAQ-LRSLRKRGLVLGLSGG
NADE_AGRRK        ------MNPSPLSIHSALSSDALRI--DAAAEVDRIAQAMRDQVRNKMRRRGLVIGLSGG
A9GWW2_SORC5      --------------MFSRDVLRI----DAPAVAQEIEQAIRDQVFGTLRRRGAVVGISGG
NADE_RHILO        -------------------MLAL----DARAEVDRIVDTLRKQVLGTLRRRGVVVGLSGG
NADE_FUSNN        --------------MNKLDLNLK----EVHNEL---VEFLREN-FKKAGFSKAVLGLSGG
NADE_PELPB        -----------MKVQDLHL--------DYHLVEDILKAFLFNE-LRKFGFSSVVLGLSGG
NADE_HELHP        ----------------------------MKHFVNPCIHFIQKQ-LQERGFKKVVLGLSGG
D5V1U5_ARCNC      -------------------MEWK----NIKEQL---IVFLKDE-VKKAGLERVTVGLSGG
NADE_HELPY        --------------------MQK----DYQKLIVYLCDFLEKE-VQKRGFKKVVYGLSGG
NADE_CAMHC        -------------------MNFI----KTEKKL---IKFLKKS-LSKTYTENFIVGISGG
L0EGX2_THECK      ------MSMQQEIIAKLGVKPQI----DVEQEIRRRVDFLKQY-VKDAGATGLLIAISGG
NADE_PSEAE        -----MQQIQRDIAQALQVQPPFQSEADVQAQIARRIAFIQQC-LKDSGLKTLVLGISGG
D7AZ08_NOCDD      MTDTELSQARREIIRDLAVPEHF----DARVEIERRVAFLAER-LISTGSTALVLGISGG
NADE_BURP1        MSRPDQAARRRAIAAELHVSPTF----DARDEAERRIGFVADY-LRTAGLRACVLGISGG
NADE_BURCC        MTSADYASRQRAIIAELNVAPHF----DAEAEIARRIDFLAQY-LRSTGLRTYVLGISGG
Q47X94_COLP3      -------MNQQIIIAEMKVLPEI----DVQFEINRRVAFIKKQ-LVQSGLTNLVLGISGG
NADE_PHOPR        --------MEQLIRAEMHVLPEI----DVDFEIQRRVAFIQKK-MKVSGCKSIVLGISGG
NADE_VIBCH        --------MEHKIREEMRVLPSI----DPQFEIERRVAFIKRK-LTEARCKSLVLGISGG
NADE_TROW8        --------MCCDISKTLCVKPFI----DPEEEISHRVSFLADY-LRHSRASGYVLGISGG
NADE_STAAN        -----MSKLQDVIVQEMKVKKRI----DSAEEIMELKQFIKNYVQSHSFIKSLVLGISGG
NADE_STAS1        -----MSNLQDIVVKEMKVKPSV----ESKSETRHIIQFIKNYVQSHSFIKSLTLGISGG
NADE_COREF        -----MTDTRDHIISQLSVVPSI----EPAAEVEARVQFLVDY-LRVSHARGYVLGISGG
NADE_CORGL        -----MTNTQTEIINELKVSPAI----DVAKEVEFRVQFLVDY-LRASHTKGFVLGISGG
NADE_BUCAI        ------MTLQKKIIELLGVKPAI----IPEIEIKNCVDFLKKYLVNHVHIKSLIVGVSGG
NADE_BUCAP        ------MTLQKKIIELLGVKPLI----IPKKEIENRIQILKRYLIENTHLKTLIVGISGG
NADE_LACPL        -----MRPLQAEIIKALHVAPTI----DPEVEIRRSIDFLKAYLTKNTFLKTYVLGISGG
NADE_ECOLI        ------MTLQQQIIKALGAKPQI----NAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGG
NADE_STRR6        ------MSLQETIIQELGVKPVI----DAQEEIRRSIDFLKRYLKKHPFLKTFVLGISGG
NADE_LACLA        ------MTLQDEIIKELGVKPVI----DPKEEIRVSVDFLKDYLKKYPFIKSFVLGISGG
NADE_STRT1        ------MTLQETIIAQLGVKPSI----NPKEEIRKSVDFLKAYMIKHPFLKTYVLGISGG
NADE_STRP8        ------MTLQEEIIRQLGVKASI----DPKEEIRKTVDFLKTYLRKHSFLKTYVLGISGG
NADE_BACHD        --------MQQQIIKELHVSQMV----EPKEEIRKRVTFLKNY-LKHSGAKGYVLGLSGG
NADE_OCEIH        -----MSDLQKTIIEDLHVEPEI----DPKQEIRTRVDFLKSYLKKHTFSTGYVLGMSGG
B8HBG4_PSECP      -----MRELQATIIEEMGVQPRI----DPAGEVRKRVTFLKEY-LKATGTKGFVLGISGG
NADE_BACSU        ------MSMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQY-VKKTGAKGFVLGISGG
NADE_BACC3        ------MTLQEQIMKALHVQPVI----DPKAEIRKRVDFLKDY-VKKTGAKGFVLGISGG
NADE_COPPD        ---------------------MN----TAMEETQRIEQFLRKA-LVSERKHGYLIGVSGG
NADE1_THEMA       ----------------------------MKESL---ISFIKEK-IEEYNYRGAVVGVSGG
C5CFF8_KOSOT      ----------------------------MKEEI---MEFIEKT-VYEYEFQGAVVGISGG
NADE_MYCPE        --------------------MKK----DYIKIIDKIANWMNQT-LTEAKSNGFVYGVSGG
NADE_MYCGE        ---------------------MT----NLIKYLKELQNWLFDY-VKKSKAKGVIFGLSGG
NADE_MYCPN        --------------------MTK----NLLNYLNELEAWLTNY-VNEAHAQGVVVGLSGG
NADE_METB6        --------------------MAQ----ELGCRMGQVEQMIRYA-YWNSKSQGIVVGVSGG
NADE_THEVO        -------------------MP------DYQKEIERIGEFLRKI----IADRKAVIGISGG
NADE_PICTO        -----------------MVERLD----GVFKSI---SDFLRQE----LNGKNAVIGVSSG
NADE_HALSA        ------MSAPDTVSPLDLRFSAA----ELAERRDRIQSFIRDT-VAAAGAERCVLGLSGG
NADE_MANSM        -------------------MKTA----AYADYL---IQWLENQRTELYGMDGYTLGVSGG
NADE_MESFL        ----------------------M----ELKEYLDYLVEFIKET-VKKANAKGVVIGISGG
L0RXV0_MYCC1      ------MSKISKYIGNVVSYDID----IAKNYIKKIQNFLKNR-LKQANANGFIIGISGG
NADE_MYCPU        ------MKSNTEIYKNLKLLE------DYGTYL---IEWIKLK-VQQANKKGVIVGISGG
NADE_ALKOO        --------------------MTQ----NIQKNIDQVVEWLREQ-VRNAGAKGLTVGISGG
NADE_ALKMQ        --------------------------MEIAMKVERVVAWLREQ-VEESGTTGLVVGISGG
NADE_SYNWW        ----------------------M----NPEAVVNYLMEWSRQK-VKEAGALGIVLGVSGG
G7VA68_THELD      --------------------MYR----DPALLADKISEWLALK-IKEAKKSGGIVGLSGG
NADE_FINM2        -------------------MNYA----KLCEDL---TKWIKEE-VESANLKGAVFGISGG
NADE_METKA        ------MAKYEPVIPELEV--------NPEGEVSKIAEFLRGK-FEEAGREIAVVGLSGG
NADE_META3        -------------------MNCE----ELTNKL---TNFVLSK-VGEANAKGVVLGLSGG
NADE_ARCFU        --------------------------MNFEKVVERICDFIRGV-VSSSGSTGVVLGLSGG
D7E5X2_METEZ      -------------------MDYD----RARSII---VNFIRSK-VKEADSTGVVIGLSGG
A0RXA1_CENSY      -------MAAPPWVSPLNQDVLDELTGDCSGHAEQMGRLLLEQ-VGQSGANGIVLGLSGG
A9A2F1_NITMS      --------------------------------------------MEKNHAEGLILGLSGG
D9Q043_ACIS3      ------MNSKRILLDDVINI-------DYEKAIDAITSFIKDF-LESSSVKGFVIGVSGG
NADE_STAMF        ---------MVITIKDIINIPYD----KAEKTI---IEFIKNK-IEEANLKGAVIGLSGG
I3TCE8_THEC1      ---MVSRGVPTISVEDLLKFPLE----KTVAEI---TDGIRGF-LAETGRRLLVIGVSGG
NADE_PYRAE        -------------MFVYDVVNAL----DYEKARSIITAFISQY-VQRAGSRGVVVGISGG
NADE_SACS2        ------------MHEYIRKSLTI----DCEAVTNYIVERIREY-LEFSNKKGGVIGVSGG
A1RZ14_THEPD      ------------MGVSGGVLPEL----DWRVVEEVITRELRRYVFEEAGKSGGVVGVSGG
                                                                         .:*.*

G7ZAJ1_AZOL4      IDSSVCATLAVRAL----------GPE---RVLCILMPEKE-NSPKSTRLGTLLCEHLGV
A1ASZ5_PELPD      IDSSVTAALAVKAL----------GQD---RVLGLLMPERN-SSGDSLHLGKMVAGYLGI
B8GVB4_THISH      VDSAVCAALCVKAL----------GPG---KVFGLLLPERD-SSSNSVRLGRMVAEQLGI
NADE_RHIME        IDSSVSVALAVRAV----------GAK---NVFCLFMPEND-SDPESLRLGRLVAETFGV
NADE_AGRRK        VDSSVCAALAAYAL----------GAQ---NVFAIFMPEND-SDPESLSLGQEVAKAFSL
A9GWW2_SORC5      IDSSVVSTLCVRAL----------GKD---KVLGIFMPERD-TSDDALRLGKLLAEGLGI
NADE_RHILO        IDSSVVATLCTRAF----------GKD---KVLGLFMPERD-SSGDSLRLGRRVAAQLGI
NADE_FUSNN        IDSALVAYLLRDAL----------GKE---NVLAIMMPYKS-SNPDSLNHAKLVVEDLKI
NADE_PELPB        IDSAVVCELAVRAL----------GRQ---NVLGLMMPYAS-SSMESLEHAELMIKKLGI
NADE_HELHP        IDSAVVATLATLAL----------GSE---NVRALLMPSLS-SNEEHFNDAFNLAHNLEL
D5V1U5_ARCNC      LDSAIVAILSKEAF----------GA----NMSCVLMPSHY-SSEGSISHALEVCKKFDI
NADE_HELPY        LDSAVVGVLCQKVF-----------KE---NAHALLMPSSV-SMPENKTDALNLCEKFSI
NADE_CAMHC        LDSAVVSALCAKA-----------KPK---NTFGLILPAKS-SDKKNLNDAISHCEKWGI
L0EGX2_THECK      VDSATAAALCKRATDELTAE---TGREY--MTLGVFQPY---HKQEDIEDSYAVAKALGL
NADE_PSEAE        VDSLTAGLLAQRAVEQLREQ----TGDQAYRFIAVRLPYQVQQDEADAQASLATIRADEE
D7AZ08_NOCDD      VDSLTAGRLCRLAVDRAREN----GHEC--EYVAMRLPYGEQKDEEDAARSVEFTAPERC
NADE_BURP1        IDSSTAGRLAQLAVERLRAS----GYDA--RFVAMRLPYGAQHDEADARRALAFVRADET
NADE_BURCC        VDSSTAGRLAQLSVERLRAD----GYDA--RFIAMRLPNGVQNDEEDAQRALAFVRADEV
Q47X94_COLP3      VDSSTCGRLAQLAVNELNGQLDEGEDKTHYQFIAVRLPYGIQADEDDAQQAVDFIQPSHC
NADE_PHOPR        VDSTTCGRLAQLAVNGLNDE----SNSSTYQFVAVRLPYGEQHDEHEAQMALSFIKPSHS
NADE_VIBCH        VDSTTCGRLAQLAVEELNQQ----HNTTEYQFIAVRLPYGEQKDEDEAQLALSFIRPTHS
NADE_TROW8        QDSALAGRLCQIAVESVRSI----GFDA--TLWAIRLPYGQQFDESDAQTAMQFISPDEE
NADE_STAAN        QDSTLVGKLVQMSVNELREE----GIDC--TFIAVKLPYGVQKDADEVDQALRFIEPDEI
NADE_STAS1        QDSTLAGKLCQLAVNELKED----GNDC--EFIAVKLPYGEQKDAAEVEDALTYIQPDKI
NADE_COREF        QDSTIAGRLAQLAVERIRRE---DGSDH--QFVGVRLPHGLQADEDDALVALDFIQPDRS
NADE_CORGL        QDSTLAGRLTQLAVERIRAE----ENSTDYVFYAVRLPYAIQADEDDAQVALEFIAPDKS
NADE_BUCAI        QDSTLTAKLCQMTAETLRKE----KNDITYQFIALRLPYGIQYDEKDCQDAIRFIQPDQI
NADE_BUCAP        QDSTLTGKLCQLSIQELRKE----KKEKSYQFIALRLPYGVQIDEKDCRDAINFINPDQI
NADE_LACPL        QDSTLAGKLTEMAITEMRQE----TGDDRYQFIAVRLPYGNQADEADAMAAIDFMQADVT
NADE_ECOLI        QDSTLAGKLCQMAINELRLE----TGNESLQFIAVRLPYGVQADEQDCQDAIAFIQPDRV
NADE_STRR6        QDSTLAGRLAQLAMEELRAE----TGDDSYKFIAVRLPYGVQADEADAQKALAFIQPDVS
NADE_LACLA        QDSSLAGRLAQIAIEEMRQE----TADETYKFVAIRLPYGVQADEEDAQRALAFIQPDVS
NADE_STRT1        QDSTLAGRLAQLAVEELRA-----ETEKDYQFIAIRLPYGVQADEDDAQRALAFIKPDVS
NADE_STRP8        QDSTLAGKLAQMAIAELREE----TGDQAYQFIAVRLPYGVQADEADAQKALAFIMPDQT
NADE_BACHD        QDSTLAGKLAQMAIDELNEE----EQDTSYVFIAVRLPYGVQKDEADAQDAIAFIKPSRS
NADE_OCEIH        QDSTLLSKLTQIAVNELNEE----NSTNTYQFIGMKLPYGVQKDADDVDDAIKFVEPSKV
B8HBG4_PSECP      LDSSLAGKLAQQAVEELEAE----GVEA--NFVAVRLPYGVQHDEEDAQAALDFIKAKTE
NADE_BACSU        QDSTLAGRLAQLAVESIREE----GGDA--QFIAVRLPHGTQQDEDDAQLALKFIKPDKS
NADE_BACC3        QDSTLAGRLAQLAVEEIRNE----GGNV--TFIAVRLPYKVQKDEDDAQLALQFIQADQS
NADE_COPPD        LDSAVVLKLLVQAV----------GKE---NVLGLILPDRD-TEKKSTTLARSLLEQEKV
NADE1_THEMA       VDSAVVLSLCVQAL----------GKD---RVFALILPERD-SSKDSLKDAVDFCERLGV
C5CFF8_KOSOT      IDSAVVGKLCVEAL----------GRD---RVYGLILPERD-SSPETVSDATLVCKYLGI
NADE_MYCPE        IDSALICAIASKFF-----------KD---RSLAVRLDIF--NSVNDTKDANLVISHFKV
NADE_MYCGE        IDSAVVAAIAKETF----------GFE---NHLALIMHIN--NSKLDFQATSELVKKMQF
NADE_MYCPN        VDSAVVAAMTKKLF-----------PQ---NHLTLVMHIN--NSELDHKATTALVEQLQL
NADE_METB6        VDSALAAAFCCRAI----------GPE---KVLGLSLPASV-SNPQDLSDAQELCAMLGM
NADE_THEVO        IDSSVTLGILSKFF----------LHE---NIKAVFMPDAT-TPKSDYDDVDVLASTFGV
NADE_PICTO        IDSALVLTILSKAI----------DKD---RIHAFFMPDRF-TRSADFDDIRSLEGSTGV
NADE_HALSA        IDSTTVAHLTVDEL----------GAD---ALHGLVMPGAV-SRDQNMSDAERVAEDLGI
NADE_MANSM        IDSAVCAHLAART-----------GA----PVQALILPAEV-TSPSDVADAQATLESAGI
NADE_MESFL        IDSAVVACLAKKAF-----------PN---DYTAVWMPIE--SSDEDYKCKQELIDQCGI
L0RXV0_MYCC1      IDSSLVYMLAKSIK-----------PN---DTLGVVMPIKK-MTEMDLRHIRELQNVHRD
NADE_MYCPU        IDSALVACLAKKAF-----------PE---NSLGITMPIGN-SMKLDFDDIAKLQKLTKL
NADE_ALKOO        IDSAVVACLIKKAF-----------PE---NSLGVILPIK--SSTKDVEHGILTAEACGI
NADE_ALKMQ        IDSAVVANLIYRAF-----------PN---QSLGVILPIR--SHQDDIDDGLAVAIACGI
NADE_SYNWW        VDSAVAAIIAKKAF-----------PE---NCMTLLLPCE--SDVVDRMDSQALVEKFNI
G7VA68_THELD      VDSAVVAALLRRVC----------GKD----MLALILPCQ--SLASDIEDAKLVAEVLDV
NADE_FINM2        IDSAVLACLCKKAF----------G-D---NALGLIMPIK--SNPKDEEDARILAKSIGL
NADE_METKA        VDSSTTLGLAVEAL----------GRE---NVVALILPERD-TPEEDVEDAVEAAERFGV
NADE_META3        IDSSLVATICVKAL----------GKD---NVLGVIMPEKN-SNTQDKEHAELLANQLGI
NADE_ARCFU        VDSATVAYLCVRAL----------GSE---RVFALIMPETGVTPEQDVEDAINVAESLGM
D7E5X2_METEZ      IDSAVTANLAVEAL----------GSE---NVLGIHLPEEGVTSTKDSKDSEIIANSLGI
A0RXA1_CENSY      VDSAVAAAAAARVL-----------RD---RTLALVMPDSDVSPESETVDALGLVDRLRI
A9A2F1_NITMS      IDSAVLAYICKRKF-----------AN---KTTALIMPDTAITPKTETDDALKMISLTGI
D9Q043_ACIS3      VDSAATYFAAVKAV----------GPE---KVMALIMHDSTVTPKEDVDDAKHLIEIART
NADE_STAMF        VDSSVTLLLTMKAI----------GIE---RVTALIMPDTRVTPKRDIEDALWLVKKYGI
I3TCE8_THEC1      LDSSVALTLLAKSV----------PRD---RILALVMPDTRVNKPSDTVDAVELAGSLGV
NADE_PYRAE        VDSTVAAALAVEAL----------GRQ---RVLGLLMPSLY-TPPEDLKDALDVINALGV
NADE_SACS2        VDSAVTATLLAKA------------TD---NFFILLMPSSS-TPKIDLDDSFEMIKFLNA
A1RZ14_THEPD      VDSAVTLLLTARAL----------GPE---NTYALIMPSSA-TPEEDLRDAYEVVRIAGL
                   **                               .                         

G7ZAJ1_AZOL4      ---TPVMENITGPLEALGCYERRDNAIRRLFPEFGPGWKQKIGLAGNLLDADRVNYFTLT
A1ASZ5_PELPD      ---ETVTEEITNILEVVGFYQKYDSAVCRVIPEYGRGWKSKIVIS-NALKQHSYASFYIV
B8GVB4_THISH      ---EYTVEDIAPTLEAIGCYRWRDDAIRSVFPDYDGTWKNKLVIQ-GGQQGQ-INRFALV
NADE_RHIME        ---EAVVEDIGPTLDAMGCYQRRDAFIRELVPDYGPGWASKIVIA-NALEGDGYNISSLV
NADE_AGRRK        ---EGAIEDIGSALAAMGCYERRDDFIRQVEPAYGSGWSCKVVIS-SPLAGEGYALSTLV
A9GWW2_SORC5      ---EAVIENIKPALTGLRCYERQDEAIRMVYPDYNESWKFKITLP-SILESDRLNVSQLT
NADE_RHILO        ---ENILEDIGPAVEAVGAYRRQLEAIRTVVPDYGDGWKCKLVIE-PVLESNGLNITRLT
NADE_FUSNN        ---NSKTIEITDM----------------------------------------IDAYFKN
NADE_PELPB        ---QAEEMPITPV----------------------------------------VDAFFSS
NADE_HELHP        ---ESKIIQLAPF----------------------------------------QENFAKQ
D5V1U5_ARCNC      ---DHEIVEIAPM----------------------------------------VEAYEKF
NADE_HELPY        ---PYTEYSIAPY----------------------------------------DAIFSSH
NADE_CAMHC        ---KYEIISIEPF----------------------------------------LQAFRDS
L0EGX2_THECK      --KYTVETQIGDA----------------------------------------VDEIALE
NADE_PSEAE        -----QTVNIGPS----------------------------------------VKALAEQ
D7AZ08_NOCDD      -----LTVDVGPA----------------------------------------SDAMADS
NADE_BURP1        -----LTVDVKPA----------------------------------------ADAMLAA
NADE_BURCC        -----LTVDVKPA----------------------------------------ADAMLRS
Q47X94_COLP3      -----LTTNVLAG----------------------------------------ADGIHHE
NADE_PHOPR        -----VSVNIKDG----------------------------------------VDGIHAS
NADE_VIBCH        -----VSVNIKAG----------------------------------------VDGLHAA
NADE_TROW8        -----LSFDIRSA----------------------------------------TDNLCVD
NADE_STAAN        -----VTVNIKPA----------------------------------------VDQSVQS
NADE_STAS1        -----ITVNIKPA----------------------------------------VDQSIQS
NADE_COREF        -----ISINIREA----------------------------------------TDVLSAA
NADE_CORGL        -----VTVNVKDA----------------------------------------TDATEAT
NADE_BUCAI        -----FNVNIKKA----------------------------------------VLSSEKS
NADE_BUCAP        -----FTINIKNA----------------------------------------VLNSERS
NADE_LACPL        -----DRVDIQPA----------------------------------------TDAMVTA
NADE_ECOLI        -----LTVNIKGA----------------------------------------VLASEQA
NADE_STRR6        -----LVVNIKES----------------------------------------ADAMTAA
NADE_LACLA        -----LTVNIKAA----------------------------------------VEGQVAA
NADE_STRT1        -----LTINIKEA----------------------------------------VDGQVAE
NADE_STRP8        -----LTINIKAA----------------------------------------VDGQVAA
NADE_BACHD        -----ITVNIKDA----------------------------------------VDASTKS
NADE_OCEIH        -----LTVNIKES----------------------------------------VDASVKA
B8HBG4_PSECP      -----WTFNISAA----------------------------------------VDGFEDE
NADE_BACSU        -----WKFDIKST----------------------------------------VSAFSDQ
NADE_BACC3        -----VAFDIAST----------------------------------------VDAFSNQ
NADE_COPPD        ---PYKVISMTPLLRHLGVYKDMPLFLLPTRGLKESIVRRF------------YNDYTKK
NADE1_THEMA       ---EYRKRSITPILRKIGVYRLFPPRLFLPDSIVKRYVLNRWNTLS-------KDPFLDD
C5CFF8_KOSOT      ---DYAIKPITKLLRVMGVYKLEPAAMFIPRKLQENY----------------VRKKMRE
NADE_MYCPE        ---NSVDKNLEQV----------------------------------------FNTFIKD
NADE_MYCGE        ---NSINIELEES----------------------------------------FNLLVKT
NADE_MYCPN        ---NNKQVDLEPP----------------------------------------YRAMLQA
NADE_METB6        ---EHRVVLIDPM----------------------------------------LAAFKTI
NADE_THEVO        ---KYSTVNIQNI----------------------------------------VDTFSKT
NADE_PICTO        ---KINEINIENI----------------------------------------VNGYKST
NADE_HALSA        ---EYDVVEIDPF----------------------------------------VTQLTDV
NADE_MANSM        ---DGQIISIAPW----------------------------------------YDLIMQQ
NADE_MESFL        ---KAIDVELKET----------------------------------------FLSFKKA
L0RXV0_MYCC1      ---NFLTVDLSDS----------------------------------------FKTLTKT
NADE_MYCPU        ---EIINIDLTLS----------------------------------------YDALAKT
NADE_ALKOO        ---EYIEIDLGEE----------------------------------------HNTVANK
NADE_ALKMQ        ---KHTTVNLDNE----------------------------------------HENVLSK
NADE_SYNWW        ---PYRIIDLDNA----------------------------------------YHLLSTQ
G7VA68_THELD      ---PYRELDLTST----------------------------------------YETLMKE
NADE_FINM2        ---RFTKVDLNES----------------------------------------YDALIGT
NADE_METKA        ---EYHVHDITEV----------------------------------------LRAFGTG
NADE_META3        ---KYTVSDITDV----------------------------------------LKSFGAG
NADE_ARCFU        ---EYKLIEINDI----------------------------------------VRVFKEK
D7E5X2_METEZ      ---NFKNIDISRI----------------------------------------LNCFISE
A0RXA1_CENSY      ---GYKLLDISPI----------------------------------------VRAYSLY
A9A2F1_NITMS      ---QYKLLDINPI----------------------------------------VNEYSMY
D9Q043_ACIS3      ---QYNIIDIAPI----------------------------------------VETYRST
NADE_STAMF        ---KYYVIRIDDI----------------------------------------VDSYSAM
I3TCE8_THEC1      ---SYRVIPIDSI----------------------------------------VDSYLVL
NADE_PYRAE        ---EWKRVDITPI----------------------------------------YDAFVKT
NADE_SACS2        -QNKYKLINIDEI----------------------------------------VKSFSNK
A1RZ14_THEPD      PGGNVETVDIEPI----------------------------------------LSRFEES
                           :                                                  

G7ZAJ1_AZOL4      VESPEGERQTSRMPVD--VYLDVVAATNLKQRIRKTVEYTHADRLNYAVLGTPNRLEYEL
A1ASZ5_PELPD      AQPKEGAVIKKRLSLE--PYLEIVAATNFKQRIRKMLEYYHADRLNYAVAGTPNRLEYDQ
B8GVB4_THISH      VQKPNGELAEERLDLK--SYLQIVAATNFKQRIRKTLEYFHADRLNYAVVGTPNRLEYDQ
NADE_RHIME        VQDPEGKQTKLRMPPS--VYLGIVAATNMKQRTRKQIEYYHADRLNFAVLGTPNRLEYDQ
NADE_AGRRK        LQAPDGSQTRHRMPAS--VYLGIVAATNMKQRTRKQMEYYHADRLNYAVLGTPNRLEYDQ
A9GWW2_SORC5      AQPPGEEPRVKRMPLN--AYLQLVAATNFKQRIRKMMEYYHADRLNYAVAGTPNLLEYDQ
NADE_RHILO        VQDPEGKVDTVRLSPA--AYLQIVAATNYKQRLRKMTEYYHADRLKYAVAGTPNRLEYDQ
NADE_FUSNN        EKEAT-------------SLRMG----NKMARERMSILFDYSSKENALVVGTSNKTEIYL
NADE_PELPB        VPENQ-------------LLRRG----NIMARTRMILLYDVSARDGRLVTGTSNKTELLL
NADE_HELHP        EGMDLSGKYMEKLDMNQ-KMRMG----NFCARIRMTMLYDCASADNALVLGTSNKSEILL
D5V1U5_ARCNC      MDGD--------------KLRIG----NFSARMRMSVLYDVSARDKSLVVGTSNKSEILL
NADE_HELPY        FKDAS-------------LTRKG----NFCARLRMAFLYDYSLKSDSLVIGTSNKSERML
NADE_CAMHC        RNDEIS------------RIRLG----NFAARVRMSLLYDFSAKISGVVVGTSNLSERML
L0EGX2_THECK      VEHAFKAIGRPRHLS---KEAKG----NAKARTRMVVQYALAFDLNLLVVGTDHASEAIT
NADE_PSEAE        LEALEGLEPAKS------DFVIG----NIKARIRMVAQYAIAGARGGLVIGTDHAAEAVM
D7AZ08_NOCDD      LAAAGMTYASESSA----DFVLG----NVKARQRMIAQYAVAGGLRGLVVGTDHAAEAVT
NADE_BURP1        LAAGGLAYLDHAQQ----DFVLG----NIKARERMIAQYAVAGARNGVVIGTDHAAESVM
NADE_BURCC        LVASGHAFETPAQQ----DFVHG----NIKARERMIAQYAVAGARRGIVIGTDHAAESLM
Q47X94_COLP3      VLQAMSKAQILTSSDAQIDFSKG----NVKARARMVSQYHIAGIIGALVIGTDHSAENIT
NADE_PHOPR        TLFALKGTGLTPEKDAKIDFVKG----NVKARARMIAQYEIAGLVGGLVLGTDHSAENIT
NADE_VIBCH        SHHALANTGLIPSDPAKVDFIKG----NVKARARMVAQYEIAGYVGGLVLGTDHSAENIT
NADE_TROW8        LNRSLGSKIS--------DFNRG----NIKARLRMVVQYAVAAHHDALVVGTDHAAEAVT
NADE_STAAN        LKEAGIVLT---------DFQKG----NEKARERMKVQFSIASNRQGIVVGTDHSAENIT
NADE_STAS1        LKEAGVNLT---------DFQKG----NEKARERMKVQFSIASKQKGIVVGTDHSAENVT
NADE_COREF        TAAALGIDELG-------DFNKG----NVKARQRMVAQYAIAGELGLLVVGTDHAAENVT
NADE_CORGL        VAAALELPELT-------DFNRG----NIKARQRMVAQYAIAGQLGLLVIGTDHAAENVT
NADE_BUCAI        LKKSGVIIS---------DYVRG----NEKARERMKVQYSIAAMKQGLVVGTGHAAENIT
NADE_BUCAP        LKKQGIQIS---------DYIKG----NEKARERMKVQYSFAAITNGLVVGTGNAAENVT
NADE_LACPL        LEANQLTIH---------DFNKG----NIKARQRMIVQYGIAGEMHGAVVGTDHAAEAVT
NADE_ECOLI        LREAGIELS---------DFVRG----NEKARERMKAQYSIAGMTSGVVVGTDHAAEAIT
NADE_STRR6        VEATGSPVS---------DFNKG----NIKARCRMIAQYALAGSHSGAVIGTDHAAENIT
NADE_LACLA        LNEAGIEVS---------DFNKG----NIKARQRMITQYAVAGQYQGAVLGTDHAAENIT
NADE_STRT1        LAKAGVNVS---------DFNKG----NIKARQRMITQYAVAGENSGAVIGTDHAAENLT
NADE_STRP8        LQEAGIEIS---------DFNKG----NIKARQRMISQYAIAGQMAGAVIGTDHAAENIT
NADE_BACHD        FEQATGEVLS--------DFNKG----NTKARERMKAQYDVGAHYGCLVIGTDHAAEAIT
NADE_OCEIH        LDGAGVEIS---------DFLKG----NEKARERMKAQYSVAGAFNCFVLGTDHAAEAVT
B8HBG4_PSECP      FEKTAGSEIS--------DFHKG----NTKARTRMIAQYALAGEFNYLVIGTDHGAESVT
NADE_BACSU        YQQETGDQLT--------DFNKG----NVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVT
NADE_BACC3        YENLLDESLT--------DFNKG----NVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVT
NADE_COPPD        LNKPVFFAQWEEPPTQLPYFYEGIAYYRIKHRVRMATLYYYAEKNDYLLVGCTNLSERLI
NADE1_THEMA       LRNTGPE-----------EFLKGLAYYRIKHRIRMCLLYFEAEKRGYAVVGTTNRTEYLT
C5CFF8_KOSOT      LSYSDNPFIDDLESKGNAEFLKGLAYYRVKHRARMCMLYLEAERRNYVVVGTTNKTEEAT
NADE_MYCPE        LPDN--------------KLALM----NLKSRLRMVCLYYYAQTYNYLVCGTSNADELYT
NADE_MYCGE        LGIDPKKD----------FLTAG----NIKARLRMITLYAYAQKHNFLVLGTGNFVEYTL
NADE_MYCPN        LTIDPQKE----------LMVAG----NLKARLRMACLYTHAQKHNYLVLGTGNFIEYSL
NADE_METB6        PGFVET------------PYLLG----NLMARIRMTVLYYHANRDHRLVCGTSNRSEAML
NADE_THEVO        LSAVD-------------KGAIG----NIKSRIRMIVLYYFANIYNGIVVGTTNRTELLL
NADE_PICTO        LGIND-------------KKYEG----NIRSRVRSVILYYNANLLNGLVVGTTNRTEYLI
NADE_HALSA        FPDAAGD-----------EVAVG----NARARTRAVINYFVANHGDGVVLGTGNRAEAMT
NADE_MANSM        LSPVLNSEPERV------NVLKG----NLMARLRMIALFTTAQSHRSIVLGTDNAAEWLT
NADE_MESFL        IKDSTTPEH---------KLAIA----NAKARLRMTTLYTVAQTNSYLVLGTDNLDEWHI
L0RXV0_MYCC1      LNLCN-------------DLSIA----NIKPRLRMTTLYALAQERNYLVVGTDNADEVFI
NADE_MYCPU        LDVKN-------------KLAKA----NIKPRLRMASLYAMAQEKDYLVLGTDNLDEWYL
NADE_ALKOO        VVHQLNNKNLFNTGME--RAMDS----NLRARLRMSTLYAVANNLNYLVVGTDNAAEIYT
NADE_ALKMQ        AINALQKLELYDENKL--RISDA----NLRARLRMSTLYTIANNVNSLVVGTDNAAELHT
NADE_SYNWW        FESYLKCEGLKG------KLLRG----NIKSRLRMMALYYSAQARNYLVLGTSNKSELCV
G7VA68_THELD      AEALEGPFE---------RLPAA----NVKPRLRMTALYLFGQQRNFLVCGTGNKAEITM
NADE_FINM2        FEKNSV------------EMAAS----NIKPRLRMITLYYYAQNNGYMVLSGSNRSEFMT
NADE_METKA        SYVPCHPFS---------RKSDA----NLKPRVRMCVLYYFANELDGLVLGTGNRTEWLT
NADE_META3        GYIPTKEFD---------KMADG----NLKPRIRMCILYYFANKNNLLVAGTSNKSEIYM
NADE_ARCFU        AGEGS-------------KIAEA----NLKPRIRMVLNYYHANSMNRLVAGTGNKSELMV
D7E5X2_METEZ      IPDESGEK----------PPVVG----NLKSRIRMCLLYYYANSFYKMVVGTGNKSEIML
A0RXA1_CENSY      LEPD--------------ERARG----NLRARVRMCILYYYANLEGRLVVGAGDKSERLL
A9A2F1_NITMS      LEPN--------------ERAKG----NLRARVRTNILYYYANAKNYLVLGSSDKSEYLI
D9Q043_ACIS3      IPVYDPAD----------TVPLG----NLRARIRMSLLYYYANKFNYAVLGTGDRSEAFL
NADE_STAMF        PFFNINY-----------NIPTG----NLRARIRMNILYYYANLHNYIVVGTGDRSEILI
I3TCE8_THEC1      PGISGRE-----------RVPLG----NLRARIRMSILYLYANALNGVVIGTSDRSELLI
NADE_PYRAE        LPDFSQEN----------RVAAG----NILPRIRMTVLYYYANKYNLLVMGTGDRSELLL
NADE_SACS2        IETEN-------------KYIIG----NIKARVRMIILYAYAQMLDYLVVGTGDKSELLL
A1RZ14_THEPD      LGPLT-------------RVERG----NLAARVRMCILHARAYRRNSLVIGTGDKSELLL
                                             .   * *    .  .      : .     *   

G7ZAJ1_AZOL4      GFFVRGGDGLADLKPIAHLYKSQVYRMAAYLGLPAEIQ-AQSPSTDTYTL-PQSQEEFYY
A1ASZ5_PELPD      GFFVKLGDGAADIKPIAHLYKSQVYQLAEYFGIPEEIR-QRKPTTDTYSLEQGQ-DEFFF
B8GVB4_THISH      GFFVKNGDGSADVKPIAHLYKTQVYQLARHLGLPEEIC-TAKPTTDTYSL-PQGQDEFYF
NADE_RHIME        GFFVKNGDGAADVKPIAHLYKSQVYALAGHLGIPEEIR-RRPPTTDTYSL-EQTQEEFYF
NADE_AGRRK        GFFVKNGDGAADLKPIAHLYKSQVYQIAEYLGVPEEVR-RRPPTTDTWSL-TQTQEEFYF
A9GWW2_SORC5      GFFVKQGDGAADFKPIAHLYKSQVYALAEYIGVPADIR-RRAPTTDTFSM-PQGQDEFYF
NADE_RHILO        GFFVKQGDGTADVMPIVHLYKTQVYQLAEYLGVDEEIR-QRPPTTDTFSM-AQSQEEFYF
NADE_FUSNN        GYSTQFGDAACALNPIGDLYKTNIWDLSRYLKIPNELI-EKKPSADLW---EGQTDEQEM
NADE_PELPB        GYGTLFGDMASAINPIGDLYKTQVRGLARHLAIPEPLI-VKAPSADLW---EGQSDEDDL
NADE_HELHP        GYGTIFGDLAYAINPIGGLYKTQIFAFARALNVPQEII-AKKPSADLF---ANQSDETDL
D5V1U5_ARCNC      GYGTIYGDVACAINPIGEMYKSDEYEFGKFLGVPESIL-EKRPSADLW---EGQSDEDEL
NADE_HELPY        GYGTLFGDLACAINPIGELFKTEVYELARRLNIPKKIL-NKPPSADLF---VGQSDEKDL
NADE_CAMHC        GYGTIYGDLACAFNPIGELFKTEIFEFAKFLNIDEKII-SKAPSADLW---EGQSDEGDL
L0EGX2_THECK      GFYTKWGDGAVDLTPLSTLNKRQVRQLARALGVPDRVV-DKAPTAGLW---EGQTDEGEL
NADE_PSEAE        GFFTKFGDGACDLAPLSGLAKHQVRALARALGAPENLV-EKIPTADLEDLRPGHPDEASH
D7AZ08_NOCDD      GFFTKYGDGGADLVPLTGLTKRRVRAVAAELGAPEDLV-RKVPTADLETLSPQKPDEEAL
NADE_BURP1        GFFTKFGDGGADVLPLAGLTKRRVRALARMLGADEPLV-LKTPTADLETLRPQRPDEHAY
NADE_BURCC        GFFTKFGDGGADILPLAGLSKRRVRGVARALGGEELIV-MKVPTADLEELRPLRPDEHAY
Q47X94_COLP3      GFFTKWGDGACDLAPLFGLSKRQVRAIAKELGAPSILV-DKAPTADLEELEPGKTDEDAL
NADE_PHOPR        GFYTKFGDGACDLAPLFGLNKRQVRLIASKLGAPDVLV-QKVPTADLEELAPQKADEDAL
NADE_VIBCH        GFYTKFGDGACDLAPLFGLNKRQVRLLAKTLGAPEQLV-YKTPTADLEELAPQKADEAAL
NADE_TROW8        GFFTKFGDGAADILPLYGLTKGQGRALLKALGACDSII-EKVPTADLLDDLPCLPDETEL
NADE_STAAN        GFYTKYGDGAADIAPIFGLNKRQGRQLLAYLGAPKELY-EKTPTADLEDDKPQLPDEDAL
NADE_STAS1        GFYTKYGDGAADIAPLFGLNKRQGKQLLAYLAAPKHLY-EKTPTADLEDDKPQLPDEEAL
NADE_COREF        GFFTKYGDGAADVLPLAGLTKRQGALLLQHLGAPESTW-TKVPTADLEEDRPALPDEEAL
NADE_CORGL        GFFTKFGDGAADLLPLAGLSKRQGAAILEHLGAPSSTW-TKVPTADLEEDRPALPDEEAL
NADE_BUCAI        GFFTKYGDSGTDINPIAKLNKRQIRLLLKNLNCPKHLY-LKKPMADLEDEHPQQDDESVL
NADE_BUCAP        GFFTKYGDNGTDVNLISKLNKRQGKFLLKELNCPKHLY-LKKPTADLEDEKPQKEDEVAL
NADE_LACPL        GFYTKYGDGGADIVPLWRLNKRQGKQMLAALDAPKHLY-DKVPTADLEEDRPALPDEVAL
NADE_ECOLI        GFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLY-KKAPTADLEDDRPSLPDEVAL
NADE_STRR6        GFFTKFGDGGADILPLYRLNKRQGKQLLQKLGAEPALY-EKIPTADLEEDKPGLADEVAL
NADE_LACLA        GFFTKFGDGGADLLPLFRLNKRQGKALLAELGADPAIY-EKVPTADLEEGKPGLADEIAL
NADE_STRT1        GFFTKFGDGGADILPLFRLNKRQGAALLAELGADKALY-EKVPTADLEEDKPGIADEVAL
NADE_STRP8        GFFTKFGDGGADILPLFRLNKRQGKALLKVLGADAALY-EKVPTADLEDQKPGLADEVAL
NADE_BACHD        GFFTKHGDGACDVAPLFGLTKRQGKSLLKELGAPTHLY-TKAPTADLEDDRPGLPDEEAL
NADE_OCEIH        GFYTKHGDGACDLAPLFGLNKRQGKQMLVALNCPEHLY-NKKPTADLEDDRPALPDEEAL
B8HBG4_PSECP      GFFTKFGDGGADILPLFGLNKRQNRALLAELGAPARIW-EKVPTADLLDDRPGRTDEDEL
NADE_BACSU        GFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLY-LKEPTADLLDEKPQQSDETEL
NADE_BACC3        GFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLY-LKMPTADLLDEKPGQADETEL
NADE_COPPD        GFYVKYGDDVCDVAPIAHLYKTEVRQLSEYLSVPEDIR-NRPPSPDLI---PGITDEYSL
NADE1_THEMA       GLYVKWGDEAVDIEPIMHLYKTQVFELAKEMNVPEKIL-KKPPSPDLI---PGITDEMAF
C5CFF8_KOSOT      GFYVKWGDDAVDVEPIMHLYKTQVYQLAELLGVPERIR-RKAPSPDLV---PGITDEFMF
NADE_MYCPE        GYFTKFGDSGSDFIPLANLTKTDVRECSKILGVPSQII-NKDPSAGLF---ENQKDEDDL
NADE_MYCGE        GYFTKWGDGACDIAPLAWLLKEDVYKLAKHFNIPEIVI-TRAPTASLF---EGQTDETEM
NADE_MYCPN        GYFTKWGDGACDVAPLAFLLKSDVYALSQHFNVPELVI-ERAPTASLF---AGQTDEAEM
NADE_METB6        GYCTKYGDNAADFQPIVHLYKTDVYEMAKEVKIPKAIL-EKTPSAGLW---AGQSDEGEI
NADE_THEVO        GYYTKYGDGGCDVEPIEHLYKRDIYEIARLLGVPESII-KKKPTAGLW---QGQTDEDEI
NADE_PICTO        GYFTKYGDGACDLEPIEHLYKSDVRELASYLKVPESII-RKKPSAGLW---GDQYDEDEL
NADE_HALSA        GYYTKYGDQAVDCNPIGNLYKMQVRQLARDLGVPEDLV-TKAPTAELW---ADQTDAGEL
NADE_MANSM        GYFTKFGDGAADVLPLAGLRKEQVFELGRYLGVPQSVL-DKKPSAGLW---AGQTDEAEM
NADE_MESFL        GYFTKFGDGGVDMVPLVHLLKREVREAARILGVPTSII-NRAPTASLW---EDQTDESEL
L0RXV0_MYCC1      GYFTKYGDGGVDLLPISKLTKGEVKFISKIMQVPDSII-NKKPSAGLW---DGQTDESEL
NADE_MYCPU        GYFTKYGDGGVDLLPISYLTKSEVISLAQIYKVDKGII-EKKPSAGLW---ENQEDEKEL
NADE_ALKOO        GYFTKYGDGGVDILPIASLKKYEVYEWAKVLGVPKEVL-EKEPSAGLW---EGQTDEGEM
NADE_ALKMQ        GYFTKYGDGGVDILPIAGLTKREVYQWGEYLGVPQSVL-NREPSAGLW---EGQTDEKEM
NADE_SYNWW        GYSTKYGDAGVDLQLLGDLLKREVYELAQFLGVPETIV-NKPPSGGLW---SGQTDEGEM
G7VA68_THELD      GYFTKYGDSGVDVLPLGDLLKGEVFKLAEYLGVPEKIY-KKPPSAGLW---EGQTDEEEM
NADE_FINM2        GYFTKYGDSGADLMPLLNLYKTDIFEMAKVLGVPDVII-NKKPSAGLW---EGQTDEDEF
NADE_METKA        GYFTLHGDGACDVAPIRHLYKTQVYVIAEHLGVPERIVEEKEPSARLW---PGQTDEGEL
NADE_META3        GYGTKYGDLGSDFLLIGNLFKTEVRELSKYLGVPDEII-NKAPSAGLW---EGQTDEKEL
NADE_ARCFU        GYFTKYGDGGVDFLPIGDLYKTEVFQLAAYLGVPRRII-EKKPSARLW---PGQTDEEEM
D7E5X2_METEZ      GYFTKYGDGGVDLEPIGDLYKTEVFELAKLLSIPEHII-NKKPSAGLW---SGQTDENEL
A0RXA1_CENSY      GYFTKFGDGASDVELLAGLFKSQVRKVAGHLGVPGNII-SKKSSPHLW---SGHLAEKEL
A9A2F1_NITMS      GYFTKFGDGASDITPIVSLYKLQVREIAKYLGVPENVI-LKKSSPHLW---KDHEAENEL
D9Q043_ACIS3      GYFTKYGDGGVDLLPIAPLLKSQVRRLALKLGVPEKVA-FKPSSPRLW---PGQTAEGEL
NADE_STAMF        GYFTKYGDGGVDILPIGSLFKTQVRKMGDYLGLPEKIT-SKPSSPALW---LGHKAEEEL
I3TCE8_THEC1      GYFTKYGDGASDFLPQASLYKTQLRRLARYLGLPEKIV-SKPSSPALW---ENHYAEEEL
NADE_PYRAE        GYFTKYGDGGVDFLPIGSLFKLQVRELAARLGFAD-IA-KKPSSPRLW---QGHTAEGEL
NADE_SACS2        GYFTKYGDGGVDVLPIGDLYKTQVRMLGKCLGLPERIV-TKPSSPALW---EGQTAEGEL
A1RZ14_THEPD      GYFTKYGDGGVDVLPIGDLYKTQVRRLGLHLGLPERIA-FKPSSPRLW---PGHVAEEEL
                  *  .  **          : *                     .                 

G7ZAJ1_AZOL4      ALPYDKLDLALCAYGHGATE---------EETAAALDLTLPQVRRVYKDITAKRRTSARI
A1ASZ5_PELPD      TLPYDQMDLCLFGKNNSVPA---------GDIANALGMPEQHIEIIYKDIDTKRATTRYL
B8GVB4_THISH      ALPYDKMDLALWSLNHQVPA---------EELAAVLGCETRQAEWIYRDIEAKRRTTRYL
NADE_RHIME        SLPYDRMDLCLFGLNNGLSA---------DEVGRAANLGVAQVKRVWADIAAKRKATRYL
NADE_AGRRK        ALPYDRMDLCLHALNEGLGV---------EETAKATQLTTDQVERVWLDIHSKRKATRPL
A9GWW2_SORC5      ALPYDKMDLCLYAYNNNVPA---------ADAASAVGITPQQVERVFKDIEAKRRVAQYL
NADE_RHILO        ALPYHLMDLCLYGLNHGIAS---------DEVAAVAGLTEPQLQKVYKDIDAKRRAAHYL
NADE_FUSNN        GLTYKEADQVMYRLLEENKTVEE------VLAEGFNKDLVDNIVRRMNRSEYKRRMPLIA
NADE_PELPB        GFSYEAVDLLLYMMLEKRMDKHAI-----LGQ-GIEEPFYDRVRKMVVRNQYKRMMPVIA
NADE_HELHP        GYNYADIDTFLEAFEKL------------GGVEATQNKEREHIKEKLKNAGFECNMIESL
D5V1U5_ARCNC      GYSYKQMDEILKKLVDEKVSADD------LKSNGVDKELIDMINYRMKANAFKGKLPTIA
NADE_HELPY        GYPYSVIDPLLKDIEALFQTKPIDTET--LAQLGYDEILVKNITSRIQKNAFKLELPAIA
NADE_CAMHC        GYDYASLDEILRAILRK------------KSLAKFDQETINFIQNRIKNNKFKLKMPKIL
L0EGX2_THECK      GISYEDNSDYL------------------EGK-AIDPKAAAELERRYRATEHKRRPIPGI
NADE_PSEAE        GVTYAEIDAFL------------------HGQ-PLREEAARVIVDTYHKTQHKRELPKAP
D7AZ08_NOCDD      GLTYDQIDDFL------------------EGL-PVPGHVETALVDRYRVTAHKRALPTAP
NADE_BURP1        GITYEQIDDFL------------------EGK-PMDDAVAETVLRFYDATRHKRALPYTM
NADE_BURCC        GVTYDEIDDFL------------------EGK-PVADRVYETVLRFYDGSRHKRALPYTM
Q47X94_COLP3      GISYEQLDNFL------------------EGK-QVTTAVSEHIINIYKKTQHKRQAIPTI
NADE_PHOPR        LVSYDQIDDFL------------------EGK-TVDSEVSERLISIYKMTQHKRQPIPTI
NADE_VIBCH        NLTYEQIDDFL------------------EGK-AVPAEVSQRLVAIYHATQHKRQPIPTI
NADE_TROW8        GLQYRDIDAFL------------------EGK-PVSEDITMAITERYKSTLHKRMPPITP
NADE_STAAN        GVTYEAIDNYL------------------EGK-PVTPEEQKVIENHYIRNAHKRELAYTR
NADE_STAS1        GVSYDDIDDYL------------------EGK-SVSSESKEIIENHYIKNAHKRELAYTR
NADE_COREF        GVTYREIDTYL------------------ENSGEVSPEAAARIEHLWKVGQHKRHMPVTP
NADE_CORGL        GVSYADIDNYL------------------ENKPDVSEKAQQRIEHLWKVGQHKRHLPATP
NADE_BUCAI        GVTYDAIDSYL------------------EQK-KIDIRSQKIIEALYLNTLHKRNLPITQ
NADE_BUCAP        GIKYNIIDDYL------------------EGK-KVNSLNKQIIERLYLTTEHKRKIINLG
NADE_LACPL        GVRYDDIDDYL------------------EGR-TVSDAAAEKIEAWYLKTAHKRHAAITV
NADE_ECOLI        GVTYDNIDDYL------------------EGK-NVPQQVARTIENWYLKTEHKRRPPITV
NADE_STRR6        GVTYAEIDDYL------------------EGK-TISPEAQATIENWWHKGQHKRHLPITV
NADE_LACLA        GVTYNDIDDYT------------------EGK-VISEDAKAKIEAWWKKTQHKRHLPISV
NADE_STRT1        GVTYHEIDDYL------------------EGK-EVSAKAQETIETWWRKGQHKRHLPITI
NADE_STRP8        GVTYQDIDDYL------------------EGK-LISKVAQATIEKWWHKGQHKRHLPITI
NADE_BACHD        GLTYEQLDDYL------------------EGK-QVHDAIRKKIESRYLATEHKRQLPVTI
NADE_OCEIH        GVTYEQIDEFL------------------EGK-EVAEDSKRTIEGHYLKTMHKREGEVTL
B8HBG4_PSECP      GISYDKIDDYL------------------EGR-EVPESVAESIEQKYLRTRHKRTVPVTV
NADE_BACSU        GISYDEIDDYL------------------EGK-EVSAKVSEALEKRYSMTEHKRQVPASM
NADE_BACC3        GITYDQLDDYL------------------EGK-TVPADVAEKIEKRYTVSEHKRQVPASM
NADE_COPPD        GINYETLDQILAGLEEGKTAE--------DLKQLFPADIVELVINQVKFTQKLEGKPYML
NADE1_THEMA       NMSYLELDRILMKLEKN------------EDLSDEDPKKVERVKKILELSEKYRRDIPIT
C5CFF8_KOSOT      GMSYEELDRILMKLEKG------------KTLKGESNENVEKVRKILEAAKKRKLRQISL
NADE_MYCPE        KVSYLEIDNFL------------------ENN-PISESSKNRILDLHKISEHKRNMPKTI
NADE_MYCGE        GITYKELDQYL------------------KGDLILSSEKQKIVLDLKAKAEHKHNSPLKF
NADE_MYCPN        GLTYKELDQYF------------------QGHLQLSATKQQRVDHLRQSSQHKRSLPKTF
NADE_METB6        GLSYAEIDAALKNLE--------------ANGWKAGTPSEEKVLSRAQANAHKRLAAPNL
NADE_THEVO        GMPYSKIDDILSSIFD-------------KGELREDPD-FKKILDLHSKSDHKRRLPYSL
NADE_PICTO        GMGYEELDSILKDLF--------------EKKTGILDDRYKMVYDMYIRSQHKRKLPKSM
NADE_HALSA        GVDYDTIDAVLAVHVDGGLPASAT-----ATHLDIDPSVVETVRDLYGASKHKRAMPPAP
NADE_MANSM        GVTYAEIDAYL------------------RGE-TVSPQALQQIRFWHNRSHHKRMLPPKP
NADE_MESFL        GITYDQIDAYL------------------AGE-INDENVKSRVDHLHKISEHKRNGAVAP
L0RXV0_MYCC1      GFSYDDLDFYLNHQNQKE-----------LIEQHINPKVIEKIEYKHKITKHKREKIYTV
NADE_MYCPU        GYSYSEVDLFL------------------RKK-QIDSQIATKIEKQHQMTEHKRQLASKP
NADE_ALKOO        GTSYKYIDEFL------------------EGK-AIPEKDLTVIERLHRNSAHKRTMPPSP
NADE_ALKMQ        GTTYEMIDDFL------------------EGK-EVPQKDKEIIERLHGISHHKRVMPPLP
NADE_SYNWW        GLTYEELDNYL-------------------ASGDGSPEVINKIEGMMAGSQHKRKMPPVA
G7VA68_THELD      GISYHMLDLYL------------------AGK-EVPPDVAEKIRKASLRAEHKRKTPPIC
NADE_FINM2        GFTYEELDDYL--------------------MNNSNTKSKDLIDKKIKQSEHKRKFAKSF
NADE_METKA        GIDYPTLDALLYALVDEGLGPRKAVDWLGERGVEATEEDAEKVLDLVRSSSFKRRPAPGL
NADE_META3        GITYELLDKVLMAIEQNKEKEDI------SKELTVPIEKIEEILNRIESNKHKSQPIPIP
NADE_ARCFU        GISYAELDEILKLI---------------EKGERRDDEKFRRVVQMVERSRHKREMPPVA
D7E5X2_METEZ      GLPYEIIDRILNLVFHGEKPENL------QEIFDLTPDQIDLLLSRMKSNIHKRKVPPIA
A0RXA1_CENSY      GASYEEIDSILYCTLDRGMDTLEA-----AAHCDIDKDRALRIMEMHRKSAHKRSPPAGA
A9A2F1_NITMS      GISYEEVDSILYCLFEKKLSTEDT-----QKTTGIEMSTIEKIQELNKNSEHKRLPAQKP
D9Q043_ACIS3      GVSYDQVDLVIHAIEDLKMTPSEA-----AEATGVSMDIINRVLQLNKSTQHKRSLPPSP
NADE_STAMF        GIKYETIDLVLYALFDKHIEPEKV-----PEHTGVDPSIVAKILEMHRKTRHKRLSPPIP
I3TCE8_THEC1      GMKYEDIDRVLYALFDMRMGVEEA-----ANATGLPVSVVERVLSLHRSTRHKRQGFRYV
NADE_PYRAE        GASYEVIDQVLYAVFDLKKPP--------EEVRGFFGEVVDIVITRVKKNIHKLTPPAYP
NADE_SACS2        GIDYETIDSILYLRFDEMRSEDEI-----VKMLGIPIDIVKKVDRLVKISQHKRLPPEIF
A1RZ14_THEPD      KLTYEVADKILYLLFDRGVDPSEV-----PGMLGVGRELVERVLELHRRSEHKRRPPYVI
                     *   .                                                    

G7ZAJ1_AZOL4      -LRNAQLVQPVSVGDEA-----
A1ASZ5_PELPD      -HLSALVMENGILSYTA-----
B8GVB4_THISH      -HARPAMVGSPTAASGVGTGMD
NADE_RHIME        -HLGPQLVQPVEEIE-------
NADE_AGRRK        -HLAPLLVQPVF----------
A9GWW2_SORC5      -HAQPLLVRDQGHA--------
NADE_RHILO        -HARPLLSVEIGED--------
NADE_FUSNN        -KIKR-----------------
NADE_PELPB        -KLSGRTPGIDFRYARDWQEVR
NADE_HELHP        -STRVWNNTFKRTKPTILEYKV
D5V1U5_ARCNC      -KIKWS----------------
NADE_HELPY        -KRFNPE---------------
NADE_CAMHC        -HLKG-----------------
L0EGX2_THECK      ----------------------
NADE_PSEAE        ----------------------
D7AZ08_NOCDD      ----------------------
NADE_BURP1        --FDWPGHPA------------
NADE_BURCC        --FDWPAA--------------
Q47X94_COLP3      -YG-------------------
NADE_PHOPR        -YDDE-----------------
NADE_VIBCH        -YD-------------------
NADE_TROW8        -HSTWWRK--------------
NADE_STAAN        -Y-TWPKS--------------
NADE_STAS1        -Y-TWPKN--------------
NADE_COREF        -QDQWWRQ--------------
NADE_CORGL        -QENWWR---------------
NADE_BUCAI        ----------------------
NADE_BUCAP        ----------------------
NADE_LACPL        -FDDFWK---------------
NADE_ECOLI        -FDDFWKK--------------
NADE_STRR6        -FDDFWE---------------
NADE_LACLA        -FDDFWK---------------
NADE_STRT1        -FDDFWK---------------
NADE_STRP8        -FDDFWK---------------
NADE_BACHD        -FDSWWK---------------
NADE_OCEIH        -YDQWWK---------------
B8HBG4_PSECP      -FDTWWKDEGR-----------
NADE_BACSU        -FDDWWK---------------
NADE_BACC3        -FDDWWK---------------
NADE_COPPD        KRA-------------------
NADE1_THEMA       -FDRI-----------------
C5CFF8_KOSOT      -R--------------------
NADE_MYCPE        LKLGEIIK--------------
NADE_MYCGE        -KHLYNFQN-------------
NADE_MYCPN        -KPLYSFQI-------------
NADE_METB6        LSVP------------------
NADE_THEVO        -SPD------------------
NADE_PICTO        -MNDDFRYNV------------
NADE_HALSA        ----------------------
NADE_MANSM        KSPDEAEC--------------
NADE_MESFL        -KEFKRK---------------
L0RXV0_MYCC1      -KNIK-----------------
NADE_MYCPU        MDIVDFENKER-----------
NADE_ALKOO        -KIG------------------
NADE_ALKMQ        -NI-------------------
NADE_SYNWW        -MIPPELRN-------------
G7VA68_THELD      -KIG------------------
NADE_FINM2        EFDRRNY---------------
NADE_METKA        -DLPEPEDPAMSG---------
NADE_META3        -N--------------------
NADE_ARCFU        -RVRDLL---------------
D7E5X2_METEZ      -IVDAARHYME-----------
A0RXA1_CENSY      -PVQ------------------
A9A2F1_NITMS      -DRDSR----------------
D9Q043_ACIS3      -SLESVVRYMPR----------
NADE_STAMF        -SLPWVKEPIREI---------
I3TCE8_THEC1      -RLSWVEDPLPEI---------
NADE_PYRAE        -DITPARRNV------------
NADE_SACS2        -RLSGRAINSDWRFPRRWA---
A1RZ14_THEPD      -KVGV-----------------