CLUSTAL format seed alignment for MF_00194

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RDGC_NEIG1      -MWFKQISFYPLNKEKLPEADVLADKLAEAEFTHCQGLDWFSEGFTAPVSF--SPELVFP
RDGC_NEIMB      -MWFKQISFYPLNKEKLPEADVLADKLAEAEFTHCQGLDWFSEGFTAPVSF--SPELVFP
RDGC_NEIMA      -MWFKQISFYPLNKEKLPEADVLADKLAEAEFTHCQGLDWFSEGFTAPVSF--SPELVFP
RDGC_ECOLI      MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGWVPPMGSH-SDALTHV
RDGC_ECO57      MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGWVPPMGSH-SDALTHV
RDGC_SALTY      MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMGWVPPMGSH-SDALTHT
RDGC_YERPE      MLWFKNLMVYRLSREVSLSADEMEKQLSAFSFTPCGSQDMAKTGWVSPMGSH-SDALTHT
RDGC_VIBCH      -MWFKNCMVYRVNREVNFNADQLEKQLAEFRFTPCGSQDKQKFGWVSALGKH-GDMMTHV
RDGC_HAEIN      -MWFKNLMTYRLTKPLDWDLAQLQTQLEDCQFHPCGTQDQSKFGWSAPLRG--SDLLYFS
RDGC_PASMU      MVWFKNLMIYRLTKALDWTADSLQTALQQCEYHPCQQSDMSKFGWTNPLRG--TEMLHFS
RDGC_PSEAE      -MWFRNLLVYRLTQDLQLDADSLEKALGEKSARPCASQELTTYGFTAPFGKGPDAPLVHV
RDGC_XYLFA      -MFFRNLTLFRFPTSLDFS--QIDSILPNARLRPVGPLEMTSRGFISPFGREEQEVLNQR
RDGC_RALSO      -MWFKNLQLHRLPAPWAVAPDQIEKWLAPHAFQPGNSVEKQCSGWASPRDD--G-ALVYS
                 ::*::   . .          :   *           :    *:  .        :   

RDGC_NEIG1      ADFTLRVALKKEEKVLPAGVIRDILEEKVAEIQNNEARNVGRKEKQELKEQITDDLLPRA
RDGC_NEIMB      ADFTLRVALKKEEKVLPAGVIRDILEEKVAEIQNNEARNVGRKEKQELKEQITDDLLPRA
RDGC_NEIMA      ADFTLRVALKKEEKVLPAGVIRDILEEKVAEIQNNEARNVGRKEKQELKEQITDDLLPRA
RDGC_ECOLI      ANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRA
RDGC_ECO57      ANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRA
RDGC_SALTY      ANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKTEKDSLKDEVLHSLLPRA
RDGC_YERPE      VNGQIVICARKEEKILPSPVIKQELQDKIERLEGEQHRKLKKTEKDSLKDEVLHSLLPRA
RDGC_VIBCH      SENRILVCAKREEKMLPASVIKDSLNAKVEEMEAEEGRPLKKKEKDALKEDIVIDLLPRA
RDGC_HAEIN      VGKQILLIAKKEEKILPANVVKRELDDRIESLEQKENRKLKKVEKQTLKDDVVMNLLPRA
RDGC_PASMU      VGKQILLLAHKEEKILPAHVVKAELEQRIELLEQKENRKLKKVEKQALKDDVVSMLLPRA
RDGC_PSEAE      SQDFFLISARKEERILPGSVVRDALKEKVDEIEAQQMRKVYKKERDQLKDEIVQTLLPRA
RDGC_XYLFA      QGDFLWLTVGSEDKILPASVVNDLLTRKCSEIEEKKGHPPGGRERKRIKDDLIHELLPRA
RDGC_RALSO      INRQMLLVFRAEKKLLPASVVNQVTKARALEVEEQQGFKLGRKQLRELKEQVTDELLPRA
                    : :    *.::**. *:.     :   :: .:       :   :*:::   *****

RDGC_NEIG1      FTRSSRTEAVFNTRHGYLLVNNAASAKAENILTKLREALGGLEASLPNTKQSPSSLMTGW
RDGC_NEIMB      FTRSSRTEAVFNTRHGYLLVNNAASAKAENILTKLREALGGLEASLPNTKQSPSSLMTGW
RDGC_NEIMA      FTRSSRTEAVFNTRHGYLLVNNAASAKAENILTKLREALGGLEASLPNTKQSPSSLMTGW
RDGC_ECOLI      FSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPVVPLSMENPIELTLTEW
RDGC_ECO57      FSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPVVPLSMANPIELTLTEW
RDGC_SALTY      FSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPVVPLALENPIELTLTEW
RDGC_YERPE      FSRFNQTFLWIDTVNDLIMVDAASAKRAEDTLALLRKSLGSLPVVPLTLENPIELTLTEW
RDGC_VIBCH      FSKSQLTFVLIMPTEGLILVDAGSYKKAEDVLSLLRKTMGSLPVVPAIPEIAVETTLTQW
RDGC_HAEIN      FSKNQHTALWIDTENNLIHIDAASSKRAEDALALLRKSLGSLPVVPLAFANEPSTILTNW
RDGC_PASMU      FSKNQQTALWIDTENQLIYVDAASSKRAEDALALLRKSLGSLPVVPLSFANEPSVIMTDW
RDGC_PSEAE      FIRRSSTFAAIAPSLGLILVDSASAKKAEDLLSTLREALGSLPVRPLSVKVAPTATLTDW
RDGC_XYLFA      FVKKSRIDAMLDLRYGYVAVDTASRKAAETVISEIRDLLGSFPALPLNAEISIRSMLTSW
RDGC_RALSO      FTIRRDTRVWIDTANGWLVIDAAAQALGDDVRGLLVKSIDQLPLASVRVALSPVAAMTDW
                *         :      : :: .:   .:     : . :. :              :* *

RDGC_NEIG1      LLQGHCEGGFELDSDCELKGTGDIVPVVKVSKQDLTADEVVQHVKNGK-TVTRLGLVWRE
RDGC_NEIMB      LLQGHCEGGFELDSDCELKGTGDIVPVVKVSKQDLTADEVVQHVKNGK-TVTQLGLVWRE
RDGC_NEIMA      LLQGHCEGGFELDSDCELKGTGDIVPVVKVSKQDLTADEVVQHVKNGK-TVTQLGLVWRE
RDGC_ECOLI      VRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNHIEAGK-VVTKLALDWQQ
RDGC_ECO57      VRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNHIEAGK-VVTKLALDWQQ
RDGC_SALTY      VRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVHIEAGK-VVTKLALDWQQ
RDGC_YERPE      VRSKTLPAGFALMDEAELKAILEDGGVIRCKKQDLFSDEIAVHIEAGK-LVTKLALDWQE
RDGC_VIBCH      VKDGNLPQGFSLMEEAELKSLLDDGATIRCKKQELSSDEILSHIQANK-VVTKLAINWQD
RDGC_HAEIN      ILQDNLPHWLLALEEAELRGSQEDS-VIRCKKQPLENEEILALLQDGKKVVSKLALEWED
RDGC_PASMU      INKDQTPAWLMPLEEAELTGSQDSG-IIRCKQQNLESDEIQTLLNAGK-FITKLSLAWEE
RDGC_PSEAE      VKTQEAAGDFHVLDECELRDTHEDGGVVRCKRQDLTSEEIQLHLTAGK-LVTQLSLAWSD
RDGC_XYLFA      IAGEPLPEHLNLGDECEMKDATEGGAIIKCQHQALRCEEIDKHLEVGK-QVSKLALILDD
RDGC_RALSO      LLSGEAPGGFTVDQDAELRSSGEGGATVRYVGHALEADDMRRHIEAGK-QCVRLAMTWDN
                :        :   .:.*:    :    ::   : *  :::   :  .*    :*.:   :

RDGC_NEIG1      QIAFILTQDFTLKRIQYLDVLQEEAES-NGDDAAGLAFASQILMAESVSTMLEELVSYLG
RDGC_NEIMB      QIAFILTQDFTLKRIQYLDVLQEEAES-NGDDAAGLAFASQILMAESVSTMLEELVSYLG
RDGC_NEIMA      QIAFILTQDFTLKRIQYLDVLQEEAES-NGDDAAGLAFASQILMAESVSIMLEELVSYLG
RDGC_ECOLI      RIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLG
RDGC_ECO57      RIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLG
RDGC_SALTY      RIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFDADFILMTGELAALIQSLVEGLG
RDGC_YERPE      RIQLVLSDDGSLKRLKFADTLRDQNEDIDREDFAQRFDADFILMTSELAALIKNLIEALG
RDGC_VIBCH      RIRFVLAEDCSIKRLAYSDELKEQNDDIPHEDRAARLDADFSLLCGEMSVFLPDLFNALG
RDGC_HAEIN      TLTFVFNEDCTIKRLKFADTVREKNDDILKEDFAQRFDADFVLMTGILAKLTENLLDEFG
RDGC_PASMU      RLSFILNEDCTLKRLKFADQLREKNDDILKEDYAQRFDADFVLMTGVLTQLTANLLEEFG
RDGC_PSEAE      KLSFVLDDKLAVKRLRFEDLLQEQAEKDGGEDALGQLDASFTLMMLTFAEFLPALFEALG
RDGC_XYLFA      HVSFVLGDDLVIRKLKFLDGMLDQLEHSDTDGIRAELDARFALMSAEIRRLFLLLEVPLK
RDGC_RALSO      RISFVLTPSLTIKRVTPLDVIKEAADP-TAQNDDERFESDVALMTGELGRMLTDLVDILG
                 : :::  .  ::::   * : :  :    :.      :   *:   .  :   *   : 

RDGC_NEIG1      GWQD---------
RDGC_NEIMB      GWQD---------
RDGC_NEIMA      GWQD---------
RDGC_ECOLI      GEAQR--------
RDGC_ECO57      GEAQR--------
RDGC_SALTY      GEAQR--------
RDGC_YERPE      GEAQH--------
RDGC_VIBCH      GLPHPEA------
RDGC_HAEIN      GEKARL-------
RDGC_PASMU      GEKARL-------
RDGC_PSEAE      GEEIPQGV-----
RDGC_XYLFA      LSKANN-------
RDGC_RALSO      GDQHDSMHQAAAA