CLUSTAL format seed alignment for MF_00196

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MTLD_CLOAB      ---MKALHFGAGNIGRGFIGYLLYKSNYETTFVDIFDKVVDDINKYKRYTVITLSTSKN-
MTLD_CALS4      --MLKALHFGAGNIGRGFIGYLLNKSGYEVTFVDISKEIVDNINKYKKYNVIILKEPVE-
MTLD_BACSU      ---MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNEKKEYTVELAEEGRS-
MTLD_GEOSE      ---MLAVHFGAGNIGRGFIGSLLSQSGYEVVFVDINDELVRLLKEKQEYRVIIADENRQ-
MTLD_ALKHC      ---MKAIHFGAGNIGRGFIGALLSKANYEVVFVDVNAQVIDRLNEQRSYTVLTADEDNE-
MTLD_STRMU      --MKKAVHFGAGNIGRGFIGQILFENGFAIDFVDVNDKIINALNERHSYDIEIAEDGKR-
MTLD_STRPN      --MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEKGKYEIEIAQKGQS-
MTLD_LACLA      --MKKAVHFGAGNIGRGFIGEILSKNGFDIHFVDTNKSIIAELNNRHSYEIGIASSEHE-
MTLD_STAAM      ---MKAVHFGAGNIGRGFIGYILADNNVKVTFADVNEEIINALAHDHQYDVILADESKT-
MTLD_ECOLI      ---MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQ-
MTLD_ECO57      ---MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQ-
MTLD_SALTI      ---MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQ-
MTLD_SALTY      ---MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQ-
MTLD_KLEPN      ---MKALHFGAGNIGRGFIGKLLADAGIELTFADVNQTVLDALNARHSYQVHVVGENEQ-
MTLD_YERPE      ---MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDELNKRKRYQVNVVGEQAR-
MTLD_PASMU      ---MKALHFGAGNIGRGFIGKLLADSGIQVIFADVNDHVIEQLKTQRAYPVKIVGDRLNV
MTLD_VIBCH      -MKKNAVHFGAGNIGRGFIGKLLADADIAVTFADVNEPLVDQLSHQQEYKVKVVGSECK-
MTLD_BUCAI      ---MKALQFGAGNIGRGFIGKTLSESGFSVIFSDVNQNIVDAINYNREYFVKIIGSNQNK
MTLD_MYCPN      MKRINVLHFGAGNIGRGVILPIYQQNDFSIDLVELNQNTVNELQKQKQYQVHYLDCDQS-
MTLD_MYCPU      MKKYKALHFGAGNIGRGLISDIYMKNNMDFALVDIDKDLIEKLNKQKSYSIIDFQTNKV-
                      ::*********.*     . .    : :     :  :     * :         

MTLD_CLOAB      KEKVENVRAVNLKDSVA-LEKEVLEADLITTSLGLNNLKSTGELLRGFLKKRSEI-NDKP
MTLD_CALS4      KEEVKEVKALHLEEEDK-VLDAFLEADMVTTSVGVSNLSSIGGRLKKYLKARKEK-NEKP
MTLD_BACSU      SEIIGPVSAINSGSQTEELYRLMNEAALITTAVGPNVLKLIAPSIAEGLRRRNTA-NT--
MTLD_GEOSE      ELLIRNVSAVNSQTEREKVIDYITKAHLITTAVGPHILPAIATILAEGLQKRITI-NKTP
MTLD_ALKHC      ENVIHNVRGLNSRTQMEQVLAEIATADLVTTAVGPSVLPHLAHPIGQGLLQR----NGAP
MTLD_STRMU      HITVSNVAGINNKENPQAVIDAVAETELITTAIGPNILPFIAQLIAKGIEKRRESQNQTP
MTLD_STRPN      RIEVTNVAGINSKEHPEQVIEAIQKTDIITTAIGPNILPFIAELLAKGIEARRVAGNTQA
MTLD_LACLA      KISVKAVSGINNSENPEAVIEAIAKADILTTAIGPNVLPYIAELIAKGLQKRKEEKVQSP
MTLD_STAAM      TTRVNNVDAINSMQPSEALKQAILEADIITTAVGVNILPIIAKSFAPFLKEK-----TNH
MTLD_ECOLI      VDTVSGVNAVSSIGDD--VVDLIAQVDLVTTAVGPVVLERIAPAIAKGQVKRKEQGNESP
MTLD_ECO57      VDTVSGVDAVSSIGDD--VVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESP
MTLD_SALTI      VDTVSGVNAVSSIGDD--VVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGVDAP
MTLD_SALTY      VDTVSGVNAVSSIGDD--VVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGVDAP
MTLD_KLEPN      VDTVSGVNAVSSIGDE--VVDLIAEVDVVTTAVGPVALERIAPAIAKGLAQRKAQGTERP
MTLD_YERPE      VEEVKNVSAVNSGSPE--VVALIAEADIVTTAVGPQILARIAATVAQGLITRHQQGNTRP
MTLD_PASMU      IETVSNVTGVNSKNEAD-IIACFTEVDLVTTAVGPNVLKIISSTIAKGLSARFRAGNTRP
MTLD_VIBCH      METVSHVTAVNSASEA--LIERIIKTDLVTTAVGPTVLDIIAKTIAKGLSARFAAGNTQP
MTLD_BUCAI      TVNIKRVSAINSNDSN--IKKIISSVDLITTAVGPTALEKIALIITQGIIFKIKNQFTKP
MTLD_MYCPN      -QLVNDFNTWNLKDEAK-IIELMERADVISTSIGAKNLASLKTLFDKAKFHKRAI-----
MTLD_MYCPU      -FQISNFKAFSIDQEDE-IKKWIEQADFISTSIGWSNLASLKKFFENVKLKEKAQ-----
                   :  .           :   .  . .::*::*   *      .      .        

MTLD_CLOAB      LDIIACENALFASDVLKKAILDGADEELKKYLEKSVGFPNCTVDRIVPNVDIEKELPIDV
MTLD_CALS4      LDIMACENALFATDVLRERVVKEEDDDFITYLNLKVGFPNTAVDRIVPAVKIDKKLPVDV
MTLD_BACSU      LNIIACENMIGGSSFLKKEIYSHLTEAEQKSVSETVGFPNSAVDRIVP--IQHHEDPLKV
MTLD_GEOSE      LHIIACENMIGGSDVLKSHVFEKISEADKPLFEKYYGFLNCAVDRIVP--NQKHDDPLSV
MTLD_ALKHC      IQVIACENAIGASSMLQEYTKASLSEEEWSKVDRVTGFPNATVDRIVP--AQDHADPLTV
MTLD_STRMU      LDIIACENMIGGSAFLWQEVQKYLSADGLAFAKDYIGFPNAAVDRIVP--AQVHEDPLFV
MTLD_STRPN      LDVMACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAVDRIVP--AQSHEDSLFV
MTLD_LACLA      LDIIACENMIGGSEFLEEKVSDYLSESDKLYLSKFIGFPNAAVDRIVP--AQKHKDVLYV
MTLD_STAAM      VNIVACENAIMATDTLKKAVLDITGP-----LGNNIHFANSAVDRIVP--LQKNENILDV
MTLD_ECOLI      LNIIACENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEV
MTLD_ECO57      LNIIACENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEV
MTLD_SALTI      LNIIACENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATNDPLEV
MTLD_SALTY      LNIIACENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATNDPLEV
MTLD_KLEPN      LNIIACENMVRGTTQLKGHVFNALAEEDKAWVEAHIGFVDSAVDRIVPPSASATHDPLEV
MTLD_YERPE      LNIIACENMVRGTSQLKQHVFAALSEDEQIWVEQHVGFVDSAVDRIVPPSEAGSTDILAV
MTLD_PASMU      LNIIACENMVRGTSFLKDNVFSYLTPEEQQQAEAQIGFVDSAVDRIVPPVQFDPANPLLV
MTLD_VIBCH      LNIIACENMVRGTTHLKQQVYQFLTTEEQQQADALVGFVDSAVDRIVPPLQAANDDPLEV
MTLD_BUCAI      LNIIACENKIKSSSFLKQVVLKNLPIKYHDYLNKYIGFIDCSIDTIIPAINNK--DDLFL
MTLD_MYCPN      --VLCFENGFRISSNFKNILQ---------LNNTQVNFVDVVIDTIAPN-FEKKANFLDI
MTLD_MYCPU      --IICFENGYKISSFFQSILN---------IDSNH--FVNASVDKIIPN-FKSDS--LDV
                  ::. **    :  :                     * :  :* * *         : :

MTLD_CLOAB      AVEDFYEWDIEKNKVKINN-KIIGAEYVEKLDPYLERKLFLLNGAHATIAYLGYLKGYKY
MTLD_CALS4      AVEEFFEWDIEKNKIKGNL-QIEGVELVDDLKPYIERKLFLLNGAHATTAYLGYLRGYTY
MTLD_BACSU      SVEPFFEWVIDESGFKGKTPVINGALFVDDLTPYIERKLFTVNTGHAVTAYVGYQRGLKT
MTLD_GEOSE      VVEPFFEWVIEKRNIIGAIPPIQGAHFVDDLKPYIERKLFTVNTGHAIASYLGYYKKLQT
MTLD_ALKHC      SVEPFYEWVIETKSMKGEPPTIDGVTYVEDLTPYIERKLFTVNTGHAMVAYLGFQKGLMT
MTLD_STRMU      VVEPFSEWVVETAAMKNPDLKLSSVHYEENLEPFIERKLFSVNSGHATTAYTGAYFGAKT
MTLD_STRPN      VVEPFNEWVVETKRLKNPDLRLKDVHYEEDLEPFIERKLFSVNSGHATSAYIGAHYGAKT
MTLD_LACLA      EVEPFSEWVIDASHLKNKEIKLEGVHYTTDLEPFIERKLFSVNSGHAAVAYSSAYKGYKT
MTLD_STAAM      MVEPFYEWVVEKDAWYGPE--LNHIKYVDDLTPYIERKLLTVNTGHAYLAYAGKFAGKAT
MTLD_ECOLI      TVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQT
MTLD_ECO57      TVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQT
MTLD_SALTI      TVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQT
MTLD_SALTY      TVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQT
MTLD_KLEPN      TVETFSEWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQT
MTLD_YERPE      TVETFSEWIVDGTQFKGQPPEIVGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGHQT
MTLD_PASMU      TVEEFSEWIVDKTQFKGTIPAITGMEQTDNLMAFVERKLFTLNTGHATTAYLGKLKGHQF
MTLD_VIBCH      TVESFSEWIVDEQQFKGEIPQIEGMEKTDNLMAFVERKLFTLNTGHCVTAYLGCLKGHRT
MTLD_BUCAI      TVEEFKEWIVNINQFKGAVPKIVDMKFSNNLDAFIERKLFTLNTGHAIAAYLGLIKNYKT
MTLD_MYCPN      YCEKYSEIYAET-----FPLEIKGVNQKNSLDRFIIKKLLLVNALHSVIGLLGFQQKLKY
MTLD_MYCPU      YVESYYEIILEQK--NESQKKLNFVNYSTDLEAYINKKLFLVNAIHSTIGYLGYLKKYTY
                  * : *   :          :       .*  :: :**: :*  *.  .  .       

MTLD_CLOAB      IHEAIKDKEINKIIVGFHSEAVQALSEKHK--IDIQILKEYSNKLLKRFENEYLKDDVSR
MTLD_CALS4      IHQAIKDDNIRAIVKGMQEEISTALSKKYD--VDKESLMAYAEKVIKRFENPYLQDEVTR
MTLD_BACSU      VKEAIDHPEIRRVVHSALLETGDYLVKSYG--FKQTEHEQYIKKIIGRFENPFISDDVTR
MTLD_GEOSE      IQEAMCDQEIRSDVEKALHESGAVLVKKYG--WNENEHQSYIQKIIQRFINPSISDEVVR
MTLD_ALKHC      IKEAISDQTIAEKTRQALAETKGLLVHKYN--FSPEAHDEYIEKIFKRYNNPYLSDRVER
MTLD_STRMU      VLEALKDQQVKEQVKAVLGEIRQLLMAKWQ--FKENDLKVYHDIIISRFENPYIVDDVTR
MTLD_STRPN      ILEALQNPNIKSRIESVLAEIRSLLIAKWN--FDKKELENYHKVIIERLENPFIVDEVSR
MTLD_LACLA      ILEGLQDEEILNILKAVQKETRALLLAKWAQYFKQDELIKYHELIISRFSNPEIIDEVSR
MTLD_STAAM      VLDAVKDSSIEAGLRRVLAETSQYITNEFD--FTEAEQAGYVEKIIDRFNNSYLSDEVTR
MTLD_ECOLI      IRDAILDEKIRAVVKGAMEESGAVLIKRYG--FDADKHAAYIQKILGRFENPYLKDDVER
MTLD_ECO57      IRDAILDEKIRAVVKGAMEESGAVLIKRYG--FDADKHAAYIQKILGRFENPYLKDDVER
MTLD_SALTI      IRDAILDEGIRAVVKGAMEESGAVLIKRYG--FDADKHAAYIQKILGRFENPYLKDDVER
MTLD_SALTY      IRDAILDESIRAVVKGAMEESGAVLIKRYG--FDADKHAAYIQKILGRFENPYLKDDVER
MTLD_KLEPN      IRDAILDKKIRAVVQGAMEESGAVLIKRYA--FDPQKHAAYIQKILGRFENPYLKDDVER
MTLD_YERPE      IRDAILDPAVRQTVKGAMEESGAVLIKRYA--FDPQKHAAYINKILSRFENPYLHDDVER
MTLD_PASMU      VKDSIDDPDIREAVKATMQESGAVLIKRYG--FDPHAHAAYIEKILKRFANPYLQDDVDR
MTLD_VIBCH      IREAIEDPCIHAQVKQAMQESGEVLIRRYG--FDRALHSAYIEKILSRFANPYLVDEVDR
MTLD_BUCAI      IQDAISDKKIRVIVRSAMEESGSVLIKRYN--FNKNDHLDYIEKIFLRFENPFLSDKLER
MTLD_MYCPN      VHETLQVKSNLTFVEKLAQQIIDALCAEYPE-FNKNNLLSYGKNNLVRFANPKIQDLNTR
MTLD_MYCPU      INEALNDQQILFKIKRLAKIINEILSKEYLL-FKVDYLNDYLEKNLKRFSIKENQDLISR
                : : :                   :               * .  : *       *   *

MTLD_CLOAB      VGRDPMRKLSSNDRLITPLKLCCDL-KIDFTNILFGVASGYLFNYKEDEKAQGIQNIITK
MTLD_CALS4      VGREPLRKLSSEDRLIAPLKLCSEV-GITPNFILYGIAAGLLFDYKEDAQAVKMREYVEQ
MTLD_BACSU      VARSPLRKLGENDRLVGPAKKIKE-----PNALAEGIAAALRFDFTGDPEAVELQALIEE
MTLD_GEOSE      VARSPIRKLGANDRLIGPATQYYDLFGQVPHGLVKGIAALLLFDYENDEEAVALQKTIQE
MTLD_ALKHC      VGRNPIRKLGYNERLVKPARQLLDL-GHQPTALLAGIQAAFAFFVEDDQESMELQEKRQV
MTLD_STRMU      VARTPIRKLGYDERFIRPIRELKDR-GLSYEYLLQTVAYVFHYKDSNDEQSVQLKLLLQE
MTLD_STRPN      VARTPIRKLGYNERFIRPIRELKEL-SLSYKNLLKTVGYVFDYRDVNDEESIRLGELLAK
MTLD_LACLA      VARTPIRKLGYDERFIRPIRELNDR-KLSYQNHLDIVGKIFAYHDENDAQAIQLQEKLKI
MTLD_STAAM      VGRGTLRKIGPKDRIIKPLTYLYNK-DLERTGLLNTAALLLKYDDTADQETVEKNNYIKE
MTLD_ECOLI      VGRQPLRKLSAGDRLIKPLLGTLEY-GLPHKNLIEGIAAAMHFRSEDDPQAQELAALIAD
MTLD_ECO57      VGRQPLRKLSAGDRLIKPLLGTLEY-SLPHKNLIQGIAGAMHFRSEDDPQAQELAALIAD
MTLD_SALTI      VGRQPLRKLSAGDRLIKPLLGTLEY-GLPHVNLVKGIAAAMHFRSDEDPQAQELAALITE
MTLD_SALTY      VGRQPLRKLSAGDRLIKPLLGTLEY-GLPHVNLVKGIAAAMHFRSDEDPQAQELAALITE
MTLD_KLEPN      VGRQPLRKLSAGDRLIKPLLGTLEY-GLPHRNLVKGIAAAMHFRSEDDPQAQELAALIAD
MTLD_YERPE      VGRQPLRKLSAGDRLIKPLLGTLEY-QLPHDSLVTGIAAAMSYRSEQDPQAQELVTLLAQ
MTLD_PASMU      VGREPLRKLSYNDRLIKPLRGTLEY-GLPNQHLIQTIASALAYRNESDPQAVELAQLLQQ
MTLD_VIBCH      VGRQPLRKLSANDRLIKPLLGTIEY-GLPNGMLLKGIAAALKYRNSSDPQAVELQQSIEK
MTLD_BUCAI      IGRNPLQKLRREDRLIKPFLGAFEY-NLPYSNLAKGIAAAFYYHNKNDLESIELSSSIKK
MTLD_MYCPN      LIREPLRKLNQNERFYAIYKLFKKN-KIALNNILQVYLMVLKTNITDDTESQQIAKLINE
MTLD_MYCPU      VARNPIQKLSKNERYFLIYNLVKKH-NLEIDILLEIYKSIFYYDNKMDKESSKIQSTIEN
                : * .::*:   :*         .                       * ::         

MTLD_CLOAB      EGIKKAISNVSQIKEGDYLNNMIAYKYEELKKQN--
MTLD_CALS4      FGIKKAVNVITGLEEESDLVEEIEKRYFELKGKLI-
MTLD_BACSU      KGYSGVLQEVCGIQSHEPLHAIILKKLNQ-------
MTLD_GEOSE      TGVEGALYQYSQLEKDHPLVIAIKDQWQHLK-----
MTLD_ALKHC      QGLEQTVVEVTGLPAVHPLVQMIVGNN---------
MTLD_STRMU      KSLKAVVKEVTGLTDAALIEEIVTSVESLD------
MTLD_STRPN      QSVKDVVIQVTGLDDQELIEQIVEYI----------
MTLD_LACLA      TELPMLIEEVTGLSNQKLILEIEKVINHYKK-----
MTLD_STAAM      HGLKAFLSEYAKVDD-GLADEIIEAYNSLS------
MTLD_ECOLI      KGPQAALAQISGLDANSEVVSEAVTAYKAMQ-----
MTLD_ECO57      KGPQAALAQISDLDANSEVVSEAVTAYKAMQ-----
MTLD_SALTI      KGPQAALAQISGLDANSDVVAEAVNAYNATK-----
MTLD_SALTY      KGPQAALAQISGLDANSDVVAEAVNAYNATK-----
MTLD_KLEPN      KGPQAALAQISGLDAASDVVAEAVNDYNAEK-----
MTLD_YERPE      LGPKAALAQISGLPADSEVVEQAVSVYNAMQQKLAH
MTLD_PASMU      DTLESAVKKITEL-TESNIVQQIVTAYNALQKN---
MTLD_VIBCH      EGVRSTLARYTGL-AAESVEAQQIEALYQQMD----
MTLD_BUCAI      QGLESTIIKICDLPVNSKEVYSIILEYNLIKKIIR-
MTLD_MYCPN      KAWT-ELAKLSSLEESEWNLIKQELSREITKK----
MTLD_MYCPU      KSLAYALKKFSNLDQEDQEKILKSLAKK--------
                      :     :