CLUSTAL format seed alignment for MF_00197

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DAPF_LISIN       ----------MATIHFTKVHGSQNDFFLVDEEENQIMDWSD---AKRADFAIKLCDREH-
DAPF_LISMO       ----------MATIHFTKVHGSQNDFFLVDEEGNQIMDWSD---AKRADFAIKLCDREH-
DAPF_CLOAB       MEINIREDAFIVEINILKCHGTGNDFILIDEY-NNNYNLDD---ETRRDIAIQACNRAK-
DAPF_AGRFC       ---------MADTVEFAKMNGLANKILVVDMR-GRKDM-------VTPAAAIALNSNP--
DAPF_RHIME       ---------MGDQVQFARMNGLGNKILVVDMR-GRKDR-------VTPQAAIALNADP--
DAPF_BRUME       ---------MATKAAFARMNGLGNQIIVADMR-GRADS-------ITSAAAIRLASDS--
DAPF_RHILO       ---------MASTAPFAKMNGIGNEIIVADMR-GRADQ-------VTAAAALALNGDA--
DAPF_CAUVC       -----------MSRTFLKMNGLGNDFVVIQTL-TEAFD-------PTPEQIRAIAKRPGV
DAPF1_NOSS1      -----------MAIEFTKYHGLGNDFILIDNRASKTPA-------ITPEKAVEMCDRHF-
DAPF_SYNY3       -----------MALSFSKYHGLGNDFILVDNRQSTEPC-------LTPDQAQQLCDRHF-
DAPF_ECOLI       -------------MQFSKMHGLGNDFMVVDAVTQNVF--------FSPELIRRLADRH--
DAPF_SALTY       -------------MQFSKMHGLGNDFMVVDAVTQNVF--------FSPELIRRLSDRH--
DAPF_YERPE       -------------MQFSKMHGLGNDFMVVDAVTQNVY--------FSPELIRRLADRH--
DAPF_VIBCH       -----------MHFHFSKMHGLGNDFMVVDCITQNVF--------FSPELIRRLADRH--
DAPF_HAEIN       -------------MQFSKMHGLGNDFVVVDGVTQNVF--------FTPETIRRLANRH--
DAPF_PASMU       -------------MQFSKMHGLGNDFVVVDAITQNLY--------FSPETIKRLADRH--
DAPF_BUCAI       ---MDSYYKNKKKINFSKMHGLKNDFMVINCIKKNVF--------LTSHIIKKLSNRY--
DAPF_NEIMA       ----------MNTLKFTKMHGLGNDFMVIDAVSQDFT--------PEDAPIAAWADRF--
DAPF_NEIMB       ----------MNTLKFTKMHGLGNDFMVIDAVSQDFT--------PEDAPIAEWADRF--
DAPF_PSEAE       -----------MLLRFTKMHGLGNDFMVLDLVSQHAH--------VQPKHVKLWGDRN--
DAPF_PSEFL       -----------MLLRFTKMHGLGNDFMVLDLVSQHAH--------ILPKHAKQWGDRH--
DAPF_RALSO       -----------MKLHFTKMHGAGNDFVVLDGIATPID--------FTPEQWRAIADRH--
DAPF_XYLFA       ----MGVESVRCPLHFTKMQGAGNDFVVLDLRDGTPP--------PDVALVAWLADRH--
DAPF_BACHD       -------------MKFTKMHGLGNSYIYVDCFKELLKE-------EELPALAVAVADKN-
DAPF_BACSU       ----------MNSFRFTKMHGLGNSYIYVNQFEEQLPE-------EKLSEIAIQVSSVY-
DAPF_RICCN       ---------MISKINFVKMHGLGNDFVIVNKRDLSSSY-------DLSQLAKNMAERH--
DAPF_RICPR       ---------MINKINFVKMHGLGNDFVIVNKRDLATSY-------NLSHLAKNMADRH--
DAPF_METJA       -------------MEFTKMHALGNDYIVINEFDGEKVKE-----EEKAEFSRKICRRGF-
DAPF_METTH       ------------MILFSKMHGLGNDYVVIDESAQECIPE-----DKKPEFVREVCTRGF-
DAPF_CLOPE       -------------MKFSKMHGNGNDFIVIEDLNNEYLGK-----E--GEIAQKMCHRRF-
DAPF_CALS4       -------------MRFTKMHGLGNDFIVIEAVEGV----------DYSELAVKLCDRHF-
DAPF_ARCFU       -----------MRIAFTKMHGNGNDFVLIDEFEGVIVGE-----EEKPRFVRAVCHRNF-
DAPF2_NOSS1      -------------MKFYKYHALGNDYLVINPQDLKF--------PLTPEKIKIICHRNF-
DAPF_MYCLE       -------------MIFAKGHGTQNDFVVLPDVEADVTF--------TAAQVAALCNRRQ-
DAPF_MYCTU       -------------MIFAKGHGTQNDFVLLPDVDAELVL--------TAARVAALCDRRK-
DAPF_STRCO       ---------MSTRIAFLKGHGTENDFVIVPDPENALDL--------PPAAVAALCDRRA-
DAPF_HELPY       -------------MVFYKYSGSGNDFLIVQSFKKKDFS----------NLAKQVCHRHE-
DAPF_HELPJ       -------------MVFYKYSGSGNDFLITQSFKKKDFS----------NLAQQVCHRHE-
DAPF_CAMJE       -------------MKFYKYCASGNDFVITNADRKEDRS----------ALAKELCNRYE-
DAPF_CHLMU       ----MGSFSPLMTYRYHLYSGTGNSFILGEFIPP----------------LQHIVFLCQ-
DAPF_CHLTR       ----MGFSSLLTTCRYLLYSGAGNSFILGESMPS----------------LEDVLFLCQ-
DAPF_CHLPN       ----MAFYSPSTISKYFIYSGAGNRFLLGETLPE----------------VEDVRFLCQ-
DAPF_AQUAE       -------------MEFWKLQGSGNDFVVIDDRDEKLESFLKERGVSKEDFVRKVCAFHT-
DAPF_THEMA       ----------------MCYSANGNTFLIVDNTQKRIPE----------EKKPDFVRENV-
                                     .  *  .                                 

DAPF_LISIN       ---SLGGADGILYVTKSNEA--------------GPIGQMRVVNSDGSIASMCGNGLRTV
DAPF_LISMO       ---SLGGADGILYVTKSSEA--------------GPIGQMRVVNSDGSIASMCGNGLRTV
DAPF_CLOAB       ---FIGG-DGILFVQKSD----------------ICDAKMRIFNADGSEAEMCGNGLRCV
DAPF_AGRFC       ----ATQFDQIMAIHDPRVG--------------GTDAFIDILNCDGTKAQACGNGTRCV
DAPF_RHIME       ----ATEFDQIMAIHDPKSA--------------GTDAWIDIVNSDGSMAQACGNGTRCV
DAPF_BRUME       ----ETAFDQIMAIHDPRTP--------------GTDYYIAIINCDGTQAQACGNGTRCV
DAPF_RHILO       ----ATRFDQIMAIHDARTP--------------GTAYYVDILNSDGTSAQACGNGMRCV
DAPF_CAUVC       DGKGGIGCDQVIAIDPPRAE--------------GASAYVRFWNSDGEVAGACGNGTRCV
DAPF1_NOSS1      ----GIGADGVIFALPGE-N--------------GTDYTMRIFNSDGSEPEMCGNGIRCL
DAPF_SYNY3       ----GIGADGVIFALPGQ-G--------------GTDYTMRIFNSDGSEPEMCGNGIRCL
DAPF_ECOLI       ---LGVGFDQLLVVEPPYDP--------------ELDFHYRIFNADGSEVAQCGNGARCF
DAPF_SALTY       ---LGVGFDQLLVVEPPYDP--------------ELDFHYRIFNADGSEVSQCGNGARCF
DAPF_YERPE       ---TGVGFDQMLVVEPPYDP--------------ELDFHYRIFNADGSEVSQCGNGARCF
DAPF_VIBCH       ---TGVGFDQLLVVEAPYDP--------------ESDFHYRIFNADGSEVEQCGNGARCF
DAPF_HAEIN       ---CGIGFDQLLIVEAPYDP--------------ELDFHYRIFNADGSEVSQCGNGARCF
DAPF_PASMU       ---RGIGFDQMLIVEPPYDP--------------DLDFHYRIFNADGSEVSQCGNGARCF
DAPF_BUCAI       ---TGIGFDQLLLVEKSNSL--------------LTDFHYRIFNANGNEVEQCGNGARCF
DAPF_NEIMA       ---RGVGFDQLLVVGRSETE--------------GVDFRYRIFNADGSEVGQCGNGARCF
DAPF_NEIMB       ---RGVGFDQLLVVGRSETE--------------GVDFRYRIFNADGSEVGQCGNGARCF
DAPF_PSEAE       ---TGIGFDQLLIVEAPSSP--------------DVDFRYRIFNADGSEVEQCGNGARCF
DAPF_PSEFL       ---TGIGFDQLLIVEAPNNP--------------DVDFRYRIFNADGSEVEQCGNGARCF
DAPF_RALSO       ---FGVGADQLLLVERSTRP--------------DVDFRYRIFNHDGGEVEQCGNGARCF
DAPF_XYLFA       ---FGIGCDQVIAIEPPRGV--------------GVFAAYRIWNADGSAAQQCGNGARCV
DAPF_BACHD       ---KGIGSDGMILICPSD----------------RAPVKMRVFNNDGSEAKNCGNGLRCV
DAPF_BACSU       ---TGIGSDGMILICPSD----------------QAPVKMRIFNNDGSEGKNCGNGLRCV
DAPF_RICCN       ---TGIGCDQFIIYEEHN-----------------DFYEMIIYNIDGSSAKLCGNATRCL
DAPF_RICPR       ---TGIGCDQCIIYEENN-----------------DFYTMIIYNIDGSSAKLCGNAIRCL
DAPF_METJA       ----SVGADGVIFIQKPTSD--------------EYDVRFRIFNSDGSEAEMCGNGIRCF
DAPF_METTH       ----SVGADGVIFVQ-PASG--------------EGDIRFRIFNADGSEAEMCGNGIRCF
DAPF_CLOPE       ----GIGADGILIVR--KNE--------------NCDIEMVIINSDGSYAAMCGNGIRCF
DAPF_CALS4       ----GIGADGLLVVE--PSH--------------IADIKMRIFNADGSEAEMCGNGSRCF
DAPF_ARCFU       ----GVGADGALFVQ--PSQ--------------KADVRFRYFNSDGSEAAMCGNGIRCF
DAPF2_NOSS1      ----GIGSDGILLGP-LAST--------------KAQFALRIFNPDGSEAEKSGNGLRIF
DAPF_MYCLE       ----GLGADGVLRVTTAGAAVTAGVLEHLPDGVSCSDWYMDYRNADGSVAQMCGNGVRVF
DAPF_MYCTU       ----GLGADGVLRVTTAGAAQAVGVLDSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVF
DAPF_STRCO       ----GLGGDGLLHVVRSAAHPEARGM------AAEAEWFMDYRNGDGSVAEMCGNGVRVF
DAPF_HELPY       ----GFGADGLVVVLPSK----------------DYDYEWDFYNSDGSKAGMCGNASRCV
DAPF_HELPJ       ----GFGADGLVVVLPSK----------------DYDYEWDFYNSDGSKAGMCGNASRCV
DAPF_CAMJE       ----GIGADGFIVILPHE----------------KYDFEWEFYNNDGSRAAMCGNGSRAA
DAPF_CHLMU       ----KEKVDGFLCVEPSE----------------IADAKLTIFNSDGSEASMCGNGLRCV
DAPF_CHLTR       ----EEMVDGFLCVESSE----------------IADAKLTVFNSDGSIASMCGNGLRCA
DAPF_CHLPN       ----ETRVDGFLYLKPSS----------------CADAQLIIFNSDGSRPTMCGNGLRCA
DAPF_AQUAE       ----GVGADGLILIKNPDNP--------------ENDFKWEFFNSDGSVAEMCGNGSRCA
DAPF_THEMA       -----GDLDGVIFVELVDGK-----------------YFMDYYNRDGSMAAFCGNGARAF
                         *  :                               * :*     .**. *  

DAPF_LISIN       ARYLLEKHALT----EAKVETMKAILDVKKATSLGFDIPTYQVEISPV-------KFNAE
DAPF_LISMO       ARYLLEKHALT----EAKVETMKAILDVKKATSLGFDIPTYQVEISPV-------KFNAE
DAPF_CLOAB       GRYVIEMLNKE----SVEIETLKSKYWVKLQEDIYEGVKTVKIDIKSV-------SLDVK
DAPF_AGRFC       VQALSSETGK----TSFTFQTVAGILNAVEHED-----GMISVDMGLP-------RFRWS
DAPF_RHIME       VQALAAETGR----KAFLFHTVAGLLEAKEHDN-----GTISVDMGKP-------RFGWD
DAPF_BRUME       VQALAAETGR----HAFTFETRAGILTATEHDD-----GLISVDMGTP-------RFDWQ
DAPF_RHILO       VQALAAETGQ----KTFTFETRAGILNAREHAD-----GTISVDMGMP-------HFGWQ
DAPF_CAUVC       AWLLMQSAGK----DAVAFDTVAGRLSGVAAGD-----KLVTVDMGPP-------GLDWT
DAPF1_NOSS1      AAFLADLEGLSRNKDTYRIHTLAGVITPQLTPD-----GQIKVDMGLP-------RLLAG
DAPF_SYNY3       AKFLADLEGV--EEKTYRIHTLAGVITPQLLAD-----GQVKVDMGEP-------QLLAE
DAPF_ECOLI       ARFVRLKGLTN--KRDIRVSTANGRMVLTVTDD-----DLVRVNMGEP-------NFEPS
DAPF_SALTY       ARFVRLKGLTN--KRDIRVSTANGRMVLSVTED-----ELVRVNMGEP-------NFEPA
DAPF_YERPE       ARFVRLKGLTN--KREISVSTQTGRMILSVTED-----EQVCVNMGEP-------DFEPQ
DAPF_VIBCH       ARFVRMKGLTN--KYTIHVSTKKGKMVLNVEEE-----DLITVNMGVP-------EFEPN
DAPF_HAEIN       ARFVTLKGLTN--KKDISVSTQKGNMVLTVKDD-----NQIRVNMGEP-------IWEPA
DAPF_PASMU       ARFVTLKGLTD--KKDIAVSTQTGKMILSIKDD-----GMIRINMGEP-------IWEPA
DAPF_BUCAI       GLFLLLKGLTN--KKKILISTKKKPLTIEFLTE-----NMIKVNMNEP-------DFKFY
DAPF_NEIMA       ARFVADKGLTD--KKEICVETANGVIFPKLSDN-----GMVTVNMGKP-------RFMPS
DAPF_NEIMB       ARFVADKGLTD--KKEICVETANGVIFPKLSDN-----GMVTVNMGKP-------KFMPS
DAPF_PSEAE       ARFVQDKRLTV--KKSIRVETKGGIIELNIRPD-----GQVTVDMGPP-------RLAPA
DAPF_PSEFL       ARFVLDKRLTA--KRQIRVETKSGIIELDVRSD-----GQIGVNMGAP-------RLVPA
DAPF_RALSO       VKFVTDRGLTD--KRTIRVEVMNGISTLTMQPD-----GQVTVDMGAPVFEAARLPFVPD
DAPF_XYLFA       AAWLVRDGSVA--DEHFLIDSPVQAHLVRCIGK-----DEYAVEMGLP-------VFEPE
DAPF_BACHD       AKFAFEHGYVK--ETSFDVETLGGLVKATVHPNDNGLVDTVTVNMGEP-------RLGRA
DAPF_BACSU       AKYAYEHKLVE--ETSFLIETLSGLVKAEVQVE-NGKVNVVTVDMGEP-------RLTKS
DAPF_RICCN       AKLIYLDTGKQ----DITVMVGNKKLLCNVNDE-----NNISVNVGSV-------SFNEA
DAPF_RICPR       AKLIYLDTGKQ----NITVMVGKKKLLCNVKAA-----NKISVNVGNV-------SFNET
DAPF_METJA       SKYVYER-IMK--KNPLKVETKGGLRVSEMEIE-GDEVKKIKVYMGVP-------KFKLK
DAPF_METTH       SKFVYDNAIVR--KRRLEVETLAGIKTVELEVE-DGAVVSSRVDMGTA-------TFKTD
DAPF_CLOPE       AKYVYEKGIVK--KDVLDVLTGDGVKRIFLEIE-NDKVKTINVNMGFG-------DFKPK
DAPF_CALS4       AKYVYEKGIVS--KQKMTVETLAGVIMPELFVE-NGKIKSVKVYMGSP-------IFESS
DAPF_ARCFU       SRYVVEEGYAG--ER-LRVETLAGILELEVKRE-NG--WWVKVDMGKP-------KFGRE
DAPF2_NOSS1      SRYLWDMGLVD--EKPFSIETAGGIVESAIK----DAGKTVQVEMGKV-------SFWSR
DAPF_MYCLE       AHYLRASGLES--CDEFVVGSLAGPRLVNVHHV-DELNADVTVDMGKA------------
DAPF_MYCTU       AHYLRASGLEV--RDEFVVGSLAGPRPVTCHHV-EAAYADVSVDMGKA------------
DAPF_STRCO       ARYLQHAGHVT--EGDLAVATRGGVKTVHIAK-----NGDVTVGMGRA------------
DAPF_HELPY       -GLFAYQHAIA----SKNHVFLAGKREISICIE-----EPNIIESNLG---------NYK
DAPF_HELPJ       -GLFAYQHAIA----PKEHVFLAGKREISIRIE-----EPNIVESNLG---------NYQ
DAPF_CAMJE       -AHFAHHINKI----NPNMSFLTGAGIIKAKVN-----Q-DKVEVSLG---------KIK
DAPF_CHLMU       MAHVAQSLGLE----DVSIETVRGVYQGKFFSM-----DRVLVDMTLL---------DWK
DAPF_CHLTR       MAHVAQCFGLE----DVSIETERGVYQGKFFSM-----NRVLVDMTLP---------DWK
DAPF_CHLPN       IAHLASQKGKS----DISVSTDSGLYSGYFYSW-----DRVLVDMTLA---------DWR
DAPF_AQUAE       VRFAYERGIVG---NKVRFETLAGVIKAEVYEN----GRKVKVQLTPP------------
DAPF_THEMA       SQYLIDRGWIK--EKEFTFLSRAGEIKVIVDDS-------IWVRMPGVS-----------
                                                           :                 

DAPF_LISIN       SLPMNVGV--EKLFNQVVPELDSEL--------AFSAVSVPNPHLITFVDQTV----LDS
DAPF_LISMO       SLPMNVGV--EKLFNQVVPELDAEL--------AFSAVSVPNPHLITFVDQTV----LDS
DAPF_CLOAB       TLPLNYKK--EKLIFDKIPELSDEF--------DFTAVSITNPHLIAIVNN------IDS
DAPF_AGRFC       DIPLSEEFHDTSRIELQIGPIDAPIL------HSPAVMSMGNPHAIFWVDRD-----PMT
DAPF_RHIME       QIPLAEEFHDTRRIELQIGPIDAPVL------HSPSVASMGNPHAIFWVEND-----VWS
DAPF_BRUME       DIPLAQAVADTRKIELQVDPADAPVL------HSPSIASMGNPHAVFWVDKD-----VWS
DAPF_RHILO       EIPLAEEFRDTRMIELQIGPIDAPVL------HSPSAVSMGNPHAIFWVDRD-----VWS
DAPF_CAUVC       QIPLAEEM-NTERVELQVGPIDAPLV------HTPVCVSMGNPHVVFFVDAP-----VTD
DAPF1_NOSS1      EIPTTLGAADGKVINQPLEVEGQT--------WEVTCVSMGNPHCITFVE-D-----VAA
DAPF_SYNY3       LIPTTLAPAGEKVVDLPLAVAGQT--------WAVTCVSMGNPHCLTFVD-D-----VDS
DAPF_ECOLI       AVPFRANK----AEKTYIMRAAEQT-------ILCGVVSMGNPHCVIQVD-D-----VDT
DAPF_SALTY       QVPFRANK----AEKTYIMRAAEQT-------ILCGVVSMGNPHCVIQVD-N-----VDT
DAPF_YERPE       TVPFRAAK----AEKTYILRAAEHT-------VLCGVVSMGNPHCVMQVD-D-----VSV
DAPF_VIBCH       KIPFRAKQ----SEKTYILRVGEHT-------LFCGAVSMGNPHVVTVVD-D-----IRT
DAPF_HAEIN       KIPFTANK----FEKNYILRTDIQT-------VLCGAVSMGNPHCVVQVD-D-----IQT
DAPF_PASMU       KIPFTANK----FEKNYILRTSIQT-------VLCGAVSMGNPHCVVQVD-D-----IQT
DAPF_BUCAI       NLSSLQNV----LDNNFSIKLMNEN-------LICNLVSIGNPHCIIKVQ-S-----VKN
DAPF_NEIMA       EIPFVPESGEGDDACIYGVHLESGI-------QPVSCVNMGNPHAVIVVD-D-----VEC
DAPF_NEIMB       EIPFVPESGEGDDACIYGVHLESGI-------QPVSCVNMGNPHAVIVVD-D-----VEC
DAPF_PSEAE       EIPFQAER----EALSYEIEVNGQR-------VELAAVSMGNPHGVLRVE-N-----VDS
DAPF_PSEFL       DIPFQAPA----QALSYQVDVDGAT-------VELAAVSMGNPHAVLRVA-D-----INS
DAPF_RALSO       ALPTRVEG----RDTQHALQINGRT-------AWLSTVSMGNPHAVQVVD-D-----AEA
DAPF_XYLFA       RIPLSGFP---NACGEYVLSLQGEV-------LRCGAVSMGNPHAVVEVD-L-----IDV
DAPF_BACHD       QIPMLGEE---AAEVVAEPFTIGEKE------YRLTAVSMGNPHAIMFID-T-----IED
DAPF_BACSU       ELPMLDGG---EEHTINETMAFGEVE------LTGTAVSMGNPHIVFPIA-D-----IEQ
DAPF_RICCN       WMPSRDKV--WEFAERYMIDLKETI-----------CVDIGNPHVVIFSK-------LEP
DAPF_RICPR       WMPSRDKI--WKFAERYMLDLKEML-----------CVDIGNPHLIIFSK-------LEP
DAPF_METJA       DIPMVVDG---YKEDDEFLNGELKLKNPYLPKVKLSVVNVGNPHAVIFVEDNNIDLDFVR
DAPF_METTH       QIPMDVEE---YEFIDRFLPVEGE-------DIKLTALSVGNPHAIIFVDDA------EG
DAPF_CLOPE       NIPALCDE---EIIEKKVSVGNGN--------FEITSLLMGVPHTIIFEEEK--------
DAPF_CALS4       KIPVKSEK---QKFIDEPVKIDGK-------TYRLSSVRVGVPHTILFVSSF------EE
DAPF_ARCFU       EIPAKTDV---WGYE---VEHDGR-------KFRIYAANTGVPHVAVFVDSL-------D
DAPF2_NOSS1      DIPVIGDD---REVIQEKIFLDEG-------IFTFCAATIGNPHCVILLDDI------NS
DAPF_MYCLE       NLLGSGGP-------AFAVTVGGRR-------FSGVAVDVGNPHLACMDPQLSL---EEL
DAPF_MYCTU       NRLGAG-----------EAVVGGRR-------FHGLAVDVGNPHLACVDSQLTV---DGL
DAPF_STRCO       LLPAGD----------VEVSVGERE-------WPARNVNMGNPHAVAFVADL------DH
DAPF_HELPY       ILDVIPALRCEKFFSSGSVLEHIPT---------FYLIDTGVPHLVGFVENK------EG
DAPF_HELPJ       ILDTIPNLRCKKFFTNNSVLENIPM---------FYLINTGVPHLVGFVKNK------GL
DAPF_CAMJE       SVQ-------------NTFEELGKT---------WQLCNTGVPHLVHFCQN---------
DAPF_CHLMU       KTKKTLT---------HVLPGMPEE---------VFFIDTGVPHVVVFVPDV------NK
DAPF_CHLTR       KAERKLT---------HVLPGMPEQ---------VFFIDTGVPHVVVFVSDL------SK
DAPF_CHLPN       ASVHRLE---------SRPDPLPKE---------VVCIHTGVPHAVVILPEI------ST
DAPF_AQUAE       ---SKPEE--------KTLTVDGEE-------VIGVFINTGVPHFVVPVEDV------EK
DAPF_THEMA       --------------EKKEMKVDGYE---------GYFVVVGVPHFVMEVKGI------DE
                                                           **                

DAPF_LISIN       DKQETLASYLNSENPYFPDGVNVSFVKRLSDDAIYVRTFERGV-GFTNACGTAMSACSLI
DAPF_LISMO       DRQETLASYLNSENPYFPDGVNVSFVKRLSDDAIYVRTFERGV-GFTNACGTAMSACSLI
DAPF_CLOAB       DKLVEIGKKGNSTKSVLPQGVNVSFVKVIDSSNIYVKTYERGV-GLTKSCGTAMTASSIV
DAPF_AGRFC       FDLERFGPLLEN-HPMFPEKANITLAQVISDSALRTRTWERGA-GLTLACGSAACASAVS
DAPF_RHIME       YELDRFGPLLEN-HPIFPERANISIARIRSRQEMDLRTWERGA-GLTLACGSAACAAAVN
DAPF_BRUME       YELDKFGPLLEN-HPIFPERANISIAHVTSSDTIDLRTWERGA-GLTRACGSAACAAAVS
DAPF_RHILO       YELERFGPLLEN-HPIFPERANITIAQVTSPESMIIRTWERGA-GLTKACGSAACASVVA
DAPF_CAUVC       DFARGTGSLVEH-HPLFPEGVNVGFAHIASRDHIRLKVWERGA-GLTQACGTGACAAQVA
DAPF1_NOSS1      IPLEIIGPKFEH-HPAFPQRTNTEFIQVVSRDYLKMRVWERGA-GITLACGTGACASLVA
DAPF_SYNY3       LNLTEIGPLFEH-HPQFSQRTNTEFIQVLGSDRLKMRVWERGA-GITLACGTGACATVVA
DAPF_ECOLI       AAVETLGPVLES-HERFPERANIGFMQVVKREHIRLRVYERGA-GETQACGSGACAAVAV
DAPF_SALTY       AAVETLGPVLES-HERFPERANIGFMQVVRREHIRLRVYERGA-GETRACGSGACAAVAV
DAPF_YERPE       ANVALLGPVLEN-HERFPERANIGFMQVVSRDHIRLRVYERGA-GETQACGSGACAAVAV
DAPF_VIBCH       AAVETLGPLLES-HERFPERVNAGFMQVVSRDEINLRVYERGA-GETQACGSGACAAVAV
DAPF_HAEIN       ANVEQLGPLLES-HERFPERVNAGFMQIINKEHIKLRVYERGA-GETQACGSGACAAVAV
DAPF_PASMU       ANVEQLGPLLEN-HERFPERVNAGFMQVIHRGHIKLRVYERGA-GETQACGSGACAAVAV
DAPF_BUCAI       APVNIIGDSIEK-NPIFPEGVNVSFMEILNKKHIKLRVYERNV-GETKACGSAACAAVAV
DAPF_NEIMA       AQVRETGSLIEP-HRQFPERVNVGFMQIVSRTAIRLRVFERGV-GETQACGTGACAAVVA
DAPF_NEIMB       APVRETGSLIEP-HRQFPERVNVGFMQVVGRTAIRLRVFERGV-GETQACGTGACAAVVA
DAPF_PSEAE       APVHSLGPQLEV-HPRFPKKANIGFLQVLDPHHARLRVWERGV-GETQACGTGACAAAVA
DAPF_PSEFL       APVHELGPKIEH-HPRFPARVNVGFLQVIDRHRAQLRVWERGA-GETQACGTGACAAAVA
DAPF_RALSO       FPVREDGPLIES-HAVFPRRVNAGFMEIADRHAIRLRVYERGA-GETLACGTGACAAAVA
DAPF_XYLFA       APVERIGSLLQQ-HVAFPESVNVGFVQVIDPGLVRLRVYERGA-GETLACGSGACAAAVV
DAPF_BACHD       APVEQVGPLLEK-HEAFPDWVNVEFVQVVSPTEIHFRVWERGS-GITQACGTGACAAVVA
DAPF_BACSU       APLTTLGPVIEK-DPRFPEGINVEFVETVNEQELHFRVWERGS-GITQACGTGACAAAVA
DAPF_RICCN       QDQKIVGERLQA-KELFADGVNVNFAEVKD-NKIYLSVWERGA-GLTLACGSGACGSFAA
DAPF_RICPR       QDKTIIGQKLQA-KELFADGVNVNFAEVKD-NKIYLSVWERGA-GLTLACGSGACASFAA
DAPF_METJA       EHLDVIGKEIEH-HEAFPERINVHFVKVLNPNEIRIVTWERGA-GYTTACGTGTTASVIM
DAPF_METTH       VDLDRLGPAIEN-HPLFPERINVHFVEVVSPSEIIMVTWERGA-GPTMACGTGATASVIA
DAPF_CLOPE       -YPIECGRDIEK-YELFPQGTNVNFCKVIDRNTMEVRTWERGA-GPTLACGTGNCASVIA
DAPF_CALS4       SFMKELGPKIEK-SSLFPEGTNVDFVKVEDEENISVRTWERGV-GLTLACGSGASASAVV
DAPF_ARCFU       FDIVPLARKIRY-SEIFPEGTNVNFAKV-DGDTITVRTYERGVEGETLSCGTGSVAVAAI
DAPF2_NOSS1      EVARNFGPIFEG-YPLFPNRTNVQFMKVLDRSTIQIEIWERGA-GYTLASGSSSSAAAAT
DAPF_MYCLE       AALDLGAPVHLD-RVQFPDGVNIEVLTAPVDGMVQMRVHERGV-GETRSCGTGTVAAAVA
DAPF_MYCTU       AALDVGAPVSFD-GAQFPDGVNVEVLTAPVDGAVWMRVHERGV-GETRSCGTGTVAAAVA
DAPF_STRCO       AGDLYAPPSHAP-AGAYPDGVNVEFVVDRGPRHVAMRVHERGS-GETRSCGTGACAVAVA
DAPF_HELPY       LNSLNTLELRALRHEFN---ANINIAFIENKETIFLQTYERGVEDFTLACGTGMAAVFIA
DAPF_HELPJ       LNSLNTLELRALRHEFN---ANINIAFIENKETIFLQTYERGVEDFTLACGTGMAAVFIA
DAPF_CAMJE       LDEFDTMLCQKMRQKYN---ANVNFVKILDENHLKVRTYERGVEDETLACGTGMGACFYL
DAPF_CHLMU       VPVQEWGAFLRYHEDFRPNGVNVDFVQTKKEDTLLVYTYERGCERETLSCGTGMLASALV
DAPF_CHLTR       VPVQEWGSFLRYHEDFAPEGVNVDFVQRKKDDLLLVYTYERGCERETLSCGTGMLASALV
DAPF_CHLPN       LDLSILGPFLRYHQTFSPDGVNVNFVQILGHCQLRVRTYERGVEGETAACGTGALASALV
DAPF_AQUAE       VNVIKLGRAIRFHEEFQPKGTNVNFVQPVSEDTIKVRTYERGVESETLACGTGATACAIV
DAPF_THEMA       LDVEKLGRDLRY-----KTGANVDFYEVLP-DRLKVRTYERGVERETKACGTGVTSVFVV
                                      *  .              **.    * :.*:.  .    

DAPF_LISIN       KKM-----LDKDTFETPLNVYNDGGR---VQVTAKKDEAGEISLQLIGNATFVSTGSVSY
DAPF_LISMO       KKM-----LDKDTFETPLNVYNDGGR---VQVTAKKDEAGDISLQLIGNATFVSTGSVSY
DAPF_CLOAB       SCI-----GEKVQFDNAINVYNDGGA---IKTIVHKDSNGNYSVDFIGNATFIFEGTMEL
DAPF_AGRFC       AAR-----TGRTGR--KVTIDVASSPVRVPLTIDWRE-DNH--VVMTGPAEWEWSGSVDP
DAPF_RHIME       GAR-----TGRTER--MVTVNVPGG----PLKIEWRERDDH--VIMTGPAEWEWSGTVDP
DAPF_BRUME       AAR-----TGRTGR--KVTVNVPGG----PLLIEWRD-DDH--VMMTGPAEWEFSGTFDP
DAPF_RHILO       AAR-----TRRTGR--SVNLLTPGGG---TLHVEWLD-NDH--VILTGAAEWEFSGSFDP
DAPF_CAUVC       AVR-----RGLTDR--KARVEFDTG----SLTIEWRESDGH--VIMTGPITMEYAGKLPE
DAPF1_NOSS1      AVL-----TGRSDR--LATVELPGG----PLEIEWSEVDQR--IYMTGPADRVFTGKL--
DAPF_SYNY3       AVL-----TGRGDR--RCTVELPGG----NLEIEWSAQDNR--LYMTGPAQRVFSGQAEI
DAPF_ECOLI       GIQ-----QGLLAE--EVRVELPGG----RLDIAWKGPGHP--LYMTGPAVHVYDGFIHL
DAPF_SALTY       GIQ-----QGLLAE--EVRVELPGG----RLDIAWKGPGHP--LYMTGPAAHIYDGFIHL
DAPF_YERPE       GVV-----QDLLNE--NVHVELPGG----SLHIRWQGPGHP--LYMTGPATHVYDGFIHL
DAPF_VIBCH       GIL-----QGLLDE--QVRVHLPGG----ELEIHWQGPGKP--LYMTGPATHIYDGQISC
DAPF_HAEIN       GIM-----QGLLNN--NVQVDLPGG----SLMIEWNGVGHP--LYMTGEATHIYDGFITL
DAPF_PASMU       GVM-----QGLLDS--KVQVDLPGG----SLIIEWEGVGKP--LFMTGDATHVYDGVIRL
DAPF_BUCAI       GIA-----QKLLSD--TVHVELLGG----KLIIIWKGFGTP--LYMVGPAKHVYDGYIYI
DAPF_NEIMA       GIR-----LGLLDEGKTVEVILPGG----TLYIEWACGGD---VMMTGPAETVFEGELAY
DAPF_NEIMB       GIR-----LGLLDEGKTVEVVLPGG----TLYIEWACGGD---VMMTGPAEAVFEGELAY
DAPF_PSEAE       GIR-----QGWLQS--PVQIDLPGG----RLHIEWAGPGQP--VMMTGPAVRVYEGQVRL
DAPF_PSEFL       AIS-----QGWMDS--PLLIDLPGG----RLSIEWAGPGQP--VMMTGPAVRVYEGQVRL
DAPF_RALSO       GIR-----RGLLDS--PVKVTTHGG----DLTIAWAGEGEP--VMMTGPATTVFEGTLDL
DAPF_XYLFA       LMQ-----RGRVGR--DVRVVLPGG----TLRVQWPVSGGP--VTLSGPAKCVFDGVWYG
DAPF_BACHD       SVL-----NGFTQKGQEVTVHLLGG----DLTISWLENGD---VLMTGAAETICEGTYVK
DAPF_BACSU       SVL-----NGVSKRNQDITVHLAGG----DLVINWKDNGH---VMMTGPAETVCEGVYFL
DAPF_RICCN       GLK-----RGFIHS--PSTIVFKHG------NLTMKEENGN--IIMQGAATLVARGEYYC
DAPF_RICPR       GLK-----LGFVHS--PSTVVFEYG------NLIMREEDGN--IIMQGAATFVMRGEYYY
DAPF_METJA       AHK-----LGKTNN--RVLAHLDGG----DLEIEIKDDG----VYMIGDAVMVYDAKLIN
DAPF_METTH       GVK-----LEKLDD--SVLVHLPGG----ELKIDVYQDGTELGAYMEGDAVMVFDGILLR
DAPF_CLOPE       ANK-----LGLVDK--EVKVIVPGG----ELKVNIEDDG----VKMIGNASFICDGTYLF
DAPF_CALS4       SSL-----LGRTRR--SVNVHFKAG----VLLVEWKEDNS---IYLSGEVEEVFRGEIEI
DAPF_ARCFU       ANR-----LGLTGS--KVDVVTKGG----LLKIELTEDT----AYMTGGASRVFDGILRL
DAPF2_NOSS1      AHK-----LGLCDS--KIIVKMPGG----DILIQIKDDFH---ISMTDSVTKLAQGELST
DAPF_MYCLE       AL------ASAGADTGTLTVRVPGG----DVVITI-TDVTS---YLRGPSVLVAHGELAD
DAPF_MYCTU       AL------AAVGSPTGTLTVHVPGG----EVVVTV-TDATS---FLRGPSVLVARGDLAD
DAPF_STRCO       TARRDGLDPAATGTPATYTVDVPGG----TLVITERPDGEI---EMTGPAVIVAEGEFDS
DAPF_HELPY       ARI-------FYNTPKKAALIPKS-----NESLELSLKNDG--IFYKGAVRYIGMSVLGM
DAPF_HELPJ       ARL-------FHNTPKKATLIPKS-----NEFLELSLKNDG--IFYKGVARYIGMSVLGM
DAPF_CAMJE       AFL-------NKKVQNKVKITPKS-----GEEVGFAYKNEE--LFFEGKVKYCFEANYNF
DAPF_CHLMU       AAD-------VFSLEQDFSLLVCSRS---GNIVKIFSENGK--VFLEGPVTLLNCSENIG
DAPF_CHLTR       AAD-------IFSLGQDFSIAVCSRS---RNLIKIFSEKGK--VFLEGPVSLLNRSENFG
DAPF_CHLPN       VSN-------SYGWKE--SIQIHTWG---GELMTVSQNRGR--VYLQGSVTRDL------
DAPF_AQUAE       SYL-----KGLVKK-KPVNVLTRSGE---VLTIDFSEDLKE--VFLTGSVYKVFEGRLSE
DAPF_THEMA       YRD--------KTGAKEVKIQVPGG------TLFLKEENGE--IFLRGDVKRCSEE----
                                                                .            

DAPF_LISIN       ERGTVTELTNEATPEQAQYQELVKEVKQFLKTTE
DAPF_LISMO       ESDTVTELTNEATPEQAQYQELVKEVKEFLKTTE
DAPF_CLOAB       DKRKIEQFTIDESKFEKETNSYNEFFEYTRKNCK
DAPF_AGRFC       VTGVWARDAVERGAV-------------------
DAPF_RHIME       VTGIFARNEPESGDNGARAL--------------
DAPF_BRUME       ATGEWSRDTQGLQGSGNADRGAA-----------
DAPF_RHILO       STGTWARDTESAA---------------------
DAPF_CAUVC       LVAA------------------------------
DAPF1_NOSS1      ----------------------------------
DAPF_SYNY3       ----------------------------------
DAPF_ECOLI       ----------------------------------
DAPF_SALTY       ----------------------------------
DAPF_YERPE       ----------------------------------
DAPF_VIBCH       ----------------------------------
DAPF_HAEIN       ----------------------------------
DAPF_PASMU       ----------------------------------
DAPF_BUCAI       ----------------------------------
DAPF_NEIMA       S---------------------------------
DAPF_NEIMB       S---------------------------------
DAPF_PSEAE       ----------------------------------
DAPF_PSEFL       ----------------------------------
DAPF_RALSO       DALKQTAAH-------------------------
DAPF_XYLFA       ----------------------------------
DAPF_BACHD       GLSY------------------------------
DAPF_BACSU       ----------------------------------
DAPF_RICCN       EQ--------------------------------
DAPF_RICPR       EK--------------------------------
DAPF_METJA       IGW-------------------------------
DAPF_METTH       DP--------------------------------
DAPF_CLOPE       ----------------------------------
DAPF_CALS4       ----------------------------------
DAPF_ARCFU       NELRYDI---------------------------
DAPF2_NOSS1      EIFAIETVINI-----------------------
DAPF_MYCLE       AWWYSLARSC------------------------
DAPF_MYCTU       DWWNAMG---------------------------
DAPF_STRCO       AWLEGVLA--------------------------
DAPF_HELPY       RVFENGCF--------------------------
DAPF_HELPJ       GVFKNGCF--------------------------
DAPF_CAMJE       F---------------------------------
DAPF_CHLMU       EFAP------------------------------
DAPF_CHLTR       WLEPKSRRFG------------------------
DAPF_CHLPN       ----------------------------------
DAPF_AQUAE       EVLEY-----------------------------
DAPF_THEMA       ----------------------------------