CLUSTAL format seed alignment for MF_00200

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RTCA_PYRAB        ----------------------------------MITIDGSYGEGGGQILRTSIALSAIT
RTCA_PYRHO        ----------------------------------MITIDGSYGEGGGQILRTSVALSTIT
RTCA_METJA        --------------------------------MDFIVIDGSYLEGGGQIIRTAVSLSALT
RTCA_ARCFU        ----------------------------------MIEIDGSFGEGGGQILRTAVALSCVT
RTCA_METMA        ----------------------------------MIEIDGSYGEGGGQLVRTAVALSAVT
RTCA_PYRAE        ---------------------------------MAVRIDGSYGEGGGQILRTSIALSALL
RTCA_SACS2        ----------------------------------MIEIDGSFGEGGGQILRTSLTLSVIT
RTCA_SULIY        ----------------------------------MIEIDGSFGEGGGQILRTSLTLSVIT
RTCA_SULTO        ----------------------------------MIEIDGSFGEGGGQILRTSLTLSALT
RTCA_AQUAE        -------------------------------MGEFLELDGSYGEGGGQIVRTALFLSTLL
A9A2V2_NITMS      --------------------------------MDFLKINGAHGEGGGQIIRSAITLSCIT
B5ICB5_ACIB4      -----------------------------------MLIDGSYGEGGGQILRTSIALSAIL
RTCA_ECOLI        -------------------------------MKRMIALDGAQGEGGGQILRSALSLSMIT
RTCA_ECO57        -------------------------------MKRMIALDGAQGEGGGQIMRSALSLSMIT
RTCA_ECOUT        -------------------------------MKRMIALDGAQGEGGGQILRSALSLSMIT
RTCA_ECO27        -------------------------------MKRMIALDGAQGEGGGQILRSALSLSMIT
RTCA_SALEP        -------------------------------MARIIALDGAQGEGGGQILRSALSLSMIT
RTCA_SALTY        -------------------------------MARIIALDGAQGEGGGQILRSALSLSMIT
RTCA_RALSO        -------------------------MNNRLQPAPCIELDGAQGEGGGQILRTALTLSMLT
RTCA_PSEAE        ------------------------------MRKDLIELDGS--EGGGQILRSALSLSMTS
D2R2E0_PIRSD      --------------------------------MRTILIDGSQGEGGGQMLRTSLALSMVT
Q2SQI9_HAHCH      --------------------------------MDKVVIDGRMGEGGGQILRSSLTLAMLY
RTCA_NOSS1        ----------------------------------MINIDGSYGEGGGQVLRTSLSLAAIT
F8C4I6_THEGP      ----------------------------------MILIDGSYGEGGGQILRTCLSLSVVL
RTCA_BOVIN        ------------------------------MAGPRVEVDGGIMEGGGQILRVSTALSCLL
RTCA_PONAB        ------------------------------MAGPRVEVDGSIMEGGGQILRVSTALSCLL
RTCA_DICDI        MGKNKNYNKNQFKKSKTNNDTTVAQQQQTIEEKPDFKIDGSILEGGGQILRNSVALASLF
RTCA_DROME        -----------------------------MDAEKMLEIDGSYLEGGGQALRNALSLSCIL
RTCA_METTH        ----------------------------------MIVIDGSEGEGGGAVVRVSTALAAVT
L0AK92_NATGS      -------------------------------MTPTYELDGS--EAGGQFVRTALALSVLE
L0I8K0_HALRX      ----------------------------------MRELDGS--DAGGQFLRSALSLAAIR
C7NPI0_HALUD      ----------------------------------MLELDGS--DGGGQLFRSALTLSALT
RTCA_HALSA        ----------------------------------MHVLDGS--SGGGQLVRTALTCAAVS
A3CS58_METMJ      ----------------------------------MLTVDGSHLEGGGQILRLAVALSAIS
                                                       ::*   ..**  .* .   :   

RTCA_PYRAB        GEPVRIINIRANRPNPGLRPQHLHGILALKHLANADVKGAH-----VGSRELVFIPKRL-
RTCA_PYRHO        GEPVRIVNIRANRPNPGLRPQHLHAILALKHLANAEVKGAH-----VGSRELVFIPKKL-
RTCA_METJA        QKPVKIINIRKKRKNKGLAPQHVSAVKAVKKLCNAEVFGLN-----VGSEELTFIPSKL-
RTCA_ARCFU        GKAVRIRNIRANRPKPGLAAQHLKGIEAAKIISNAEVEGLR-----IGSTEIVFNPGSV-
RTCA_METMA        GEEIKVTNIRENRPNPGLKQQHLKALETAAKICGARVSGLS-----QGSSELFFAPVEI-
RTCA_PYRAE        GRPVEIVNIRAKRANPGLQPQHLTGVKVAALLTDAEVKGAE-----KGSTRLYFEPKTL-
RTCA_SACS2        GKPFRIFNIRANRPNPGLQRQHLWAVRAMKMISNAETKGDE-----VGSKELTFIPHEI-
RTCA_SULIY        GKPFRIFNIRANRPNPGLQRQHLWAVKAMKMISNAETKGDE-----VGSKELIFVPHEI-
RTCA_SULTO        KKPFRIYKIRANRPKPGLQRQHLTAVEAVKKLTNAKVKGDF-----VGSTELVFEPEDI-
RTCA_AQUAE        QVPVRIYNIRAKREKPGLKRQHLNIVKLLKRFAKAKVKGDE-----LGSIELEYKPQKL-
A9A2V2_NITMS      KQPIHIENIRKNRKVSGLKPQHLTAIKILKKISDCKVIGDE-----IGSTELKFIPGEI-
B5ICB5_ACIB4      GEDVEIINIRAKRRNPGLAAQHLWGIKLAGMMSNAKVSGLK-----VGSQRVFFSPGRI-
RTCA_ECOLI        GQPFTITSIRAGRAKPGLLRQHLTAVKAATEICGATVEGAE-----LGSQRLLFRPGT--
RTCA_ECO57        GQPFTITGIRAGRAKPGLLRQHLTAVKAATEICGATVEGAE-----LGSQRLVFRPGT--
RTCA_ECOUT        GQPFTITGIRAGRAKPGLLRQHLTAVKAAAEICRATVEGAE-----LGSQRLVFRPGT--
RTCA_ECO27        GQPFTITGIRAGRAKPGLLRQHLTAVKAATEICRATVEGAE-----LGSQRLVFRPGT--
RTCA_SALEP        GQPFEMSDIRAGRAKPGLLRQHLTAVRAATEICGAQVNGDE-----LGSQQLRFTPGP--
RTCA_SALTY        GQPFEMSGIRAGRAKPGLLRQHLTAVRAATEICGAQVNGDE-----LGSQQLRFTPGP--
RTCA_RALSO        GTPFRIERIRAGRSKPGLMRQHLTAVQAAAEVSGATVEGAE-----AGSQALAFAPGP--
RTCA_PSEAE        GQPLRIRNIRGRRSRPGLLRQHLTAVRAAAEICAAEVEGAE-----LGSRELAFRPGA--
D2R2E0_PIRSD      GQPMVIENIRARREKSGLLRQHLTALEAAAKICNADVEGAT-----IGSKSLVFTPHA--
Q2SQI9_HAHCH      GKEIEINHIRGKRPKPGLMRQHLTCVKAAQTICNAKVDGAE-----LGSSRLTFKPGP--
RTCA_NOSS1        GEPIRIAGIRAGRRKPGLAAQHLTAVRAAARICHGELQGDA-----LGSTMLEFIPGGG-
F8C4I6_THEGP      GKPFKIFKIRAGRPKPGLQPQHLACVKACAEISKAELEGAE-----LNSKELIFIPKEK-
RTCA_BOVIN        GLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAE-----IGSTEITFTPEKI-
RTCA_PONAB        GLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAE-----IGSTEITFTPEKI-
RTCA_DICDI        NKAISIEKIRYNRDQPGLKNQHKAGIDLMSRLFKAHLTGCS-----VGSCKLYYQPTQK-
RTCA_DROME        GKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNY-----LLSSTVEFTPRTI-
RTCA_METTH        SRSVRVYNIRARRSRSGLSHQHLTAVRAVARISNGTLRGDE-----LGSMELEFSPGR--
L0AK92_NATGS      NEPIRIENVRGDRPDPGLAHQHLAVLETMVELCDADATGVE-----LGAETIEFDPGL--
L0I8K0_HALRX      GDPVRIENVRGDRSTPGLRPQHLAVVETLADICDADIAGADGSSPDVGSETVTFEPGLGA
C7NPI0_HALUD      TTAFEMENVRGSRPEPGLKPQHLTALQTVAAITNASVEGAE-----VGESIITFEPAE--
RTCA_HALSA        GESFRMRYVRRARSNPGLQAQHCAAVNAVADICDAATDGVE-----VGSEAFSFEPEVAA
A3CS58_METMJ      ATPVTVTRIRENRPNPGLAPQHIAAVRAVAGACDAECTGLTP-----GSREISFAPGR--
                     . :  :*  *   **  **   :            *            . : *    

RTCA_PYRAB        -------------------------E-AKKVEVNI------GTAGSITLVLQALLPAMAF
RTCA_PYRHO        -------------------------E-AKEISIDI------GTAGSITLVLQALLPAMVF
RTCA_METJA        -------------------------S-PKDFTIDI------GTAGSISLVIQTLLPLSLG
RTCA_ARCFU        -------------------------R-GGNFRVDI------GTAGSVTLIFQTVLLPLLF
RTCA_METMA        -------------------------K-GGKYNIDI------GTAGSITLLLQCIMPALPF
RTCA_PYRAE        -------------------------K-CGNFSIDI------GTAGSISLIVQTLAPILLY
RTCA_SACS2        -------------------------KGNSIIDIDI------GTAGSVTLIMQTMIPA--I
RTCA_SULIY        -------------------------KGNTNIDIDV------GTAGSVTLIIQTVLPA--I
RTCA_SULTO        -------------------------VEKGDFEFDV------GTAGSVTLILQTILPL--L
RTCA_AQUAE        -------------------------K-PGYYEVNF------DTAGSIPLFLQTILPLSLF
A9A2V2_NITMS      -------------------------K-SSKLSEDV------GTAGSISLILQVLIPIVAI
B5ICB5_ACIB4      -------------------------K-GGEYRIDI------GTAGSITLLLQTAIPIAIF
RTCA_ECOLI        -------------------------VRGGDYRFAI------GSAGSCTLVLQTVLPALWF
RTCA_ECO57        -------------------------VRGGDYRFAI------GSAGSCTLVLQTVLPALWF
RTCA_ECOUT        -------------------------VRGGDYRFAI------GSAGSCTLVLQTVLPALWF
RTCA_ECO27        -------------------------VRGGDYRFAI------GSAGSSTLVLQTVLPALWF
RTCA_SALEP        -------------------------IRGGEYRFAI------GSAGSCMLVLQTVLPALWF
RTCA_SALTY        -------------------------IRGGEYRFAI------GSAGSCMLVLQTVLPALWF
RTCA_RALSO        -------------------------IHGGDYRFAI------GTAGSCTLVLQTVLPALWF
RTCA_PSEAE        -------------------------IRAGDYAFAI------GSAGSCSLVLQTLLPALLA
D2R2E0_PIRSD      -------------------------VNAGEYHFSV------GTAGSATLVLQTILPALLT
Q2SQI9_HAHCH      -------------------------IKGGNYKFDV------GSAGSTTLVFQTILLPLLQ
RTCA_NOSS1        -------------------------VKAGNYIFDVSEVQQGGSAGAITLVLQTILLPLAL
F8C4I6_THEGP      -------------------------PTNKTYFFDI------KTAGSTSLLFQTLLYPLAL
RTCA_BOVIN        -------------------------K---GGVHTADT----KTAGSVCLLMQVSMPCVLF
RTCA_PONAB        -------------------------K---GGIHTADT----KTAGSVCLLMQVSMPCVLF
RTCA_DICDI        -------------------------TIQDDGVIEADT----KTAGSICLMIQVSLPCLIF
RTCA_DROME        -------------------------L---DNTYRVET----HTAASITLIYQMALPVLLF
RTCA_METTH        -------------------------VTGGTFNFDV------KTAGSTGLVLQAIMVAAAA
L0AK92_NATGS      ----------------------DNGLEGGQYAVDI------GTAGSVTLLFDAVLPLATV
L0I8K0_HALRX      VERSGSSRSSDDSTEREASTTTEAAIPGGAYDVDL------GTAGSLTLLFDAVLPLATR
C7NPI0_HALUD      -------------------------PTGGHYEASI------GTAGSVTLLFDAVIPIASA
RTCA_HALSA        EEADDD----------------EEPTLGGTTSVEV------GTAGSIPLVFDSLLPLAGA
A3CS58_METMJ      -------------------------IRRKDLAIDP------GTAGSIPLIVQAWLPVA--
                                                            :*.:  *. :        

RTCA_PYRAB        AKNRVEFKITGGTDVPWSPPVDYLANVTLFALEKLGIMAGIKIVRRGHYPKGGGIIEGYV
RTCA_PYRHO        AREKVKFRITGGTDVSWSPPVDYLSNVTLFALEKIGIHGEIRVIRRGHYPKGGGIVEGYV
RTCA_METJA        INKKFTVKIKGGTDVKRAPPIDYVKNVTLKILRNFGVLTELKVLKRGFYPEGGGEVIFEV
RTCA_ARCFU        ADRDSTLTVTGGTDVAWAPPVDYFKNVTLRALREMGAECELEVLKRGYYPKGGGMVRLTV
RTCA_METMA        VEEKVELTIRGGTDVAWSPTIDYLKHVTLRALEQFGYAGSVTLKERGYYPRGGGSVSAVF
RTCA_PYRAE        APCPTQITVTGGTDVAWAPPIDYMRFVFTKVLERFGAKLSIELIRRGHYPRGGGRAVVRA
RTCA_SACS2        INKNMRIKIKGGTDVPKSPTIDYIRLVYLEILRKIGIESKVNLIKRGHYPEGGGEVIIEN
RTCA_SULIY        INKNVRIRIKGGTDVPKSPTIDYIRLVYLEILRKIGIEAKLNLIKRGHYPEGGGEVIIEN
RTCA_SULTO        INRNIKVTIKGGTDVPKSPSIDYIRLTFLSLLEKIGIRVNLILIRRGHYPEGGGEIKITE
RTCA_AQUAE        VPGEVVIKVIGGTDVPKSPTIDWVRFVFLHYIYKVPEFIRLEVLKRGFYPAGGGIVQLSV
A9A2V2_NITMS      SQKNLEISIKGGTDVQWSPTMFYTQHILREVYSRMGINFSFELKKRGYYPKGNGEVNLEI
B5ICB5_ACIB4      ADGRVILKITGGTDVSWCPPIDYYRYVLSYFLRRMGAKIDIEVIERGYYPEGGGKVKVEI
RTCA_ECOLI        ADGPSRVEVSGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVVATEV
RTCA_ECO57        ADGPSRVEVSGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVVATEV
RTCA_ECOUT        ADGPSRVEVSGGTDNPSAPPADFIRRVLEPLLAKIGVHQQTTLLRHGFYPAGGGVVATEV
RTCA_ECO27        ADGPSRVEVSGGTDNPSAPPADFIRRVLEPLLAKMGIHQQTTLLRHGFYPAGGGVVATEV
RTCA_SALEP        ADGSSRVEVHGGTHNQAAPSADFICRVWEPLLARMGISQRTTLIKHGFYPAGGGAAATVV
RTCA_SALTY        ADGSSRVEVHGGTHNQAAPSADFICRVWEPLLARMGISQRTTLIKHGFYPAGGGAAATVV
RTCA_RALSO        ADAPSTVAVSGGTHNRAAPPVDFLIRAWQPLLARMGVTQTLALKRHGFYPAGGGEVLATV
RTCA_PSEAE        ANGESRVRISGGTHNPLAPPADFLRDSWLPLLQRMGAEVDLELLRHGFVPAGGGELLARV
D2R2E0_PIRSD      ASAPSRLVLEGGTHNPWAPPYPFLERVYLPLVQRMGPLVKATLERPGFYPAGGGKMLVEV
Q2SQI9_HAHCH      AEGVSTVEFGGGTHNPFAPPLTEIERSFLPLLRDMGARIEIEAERWGFMPAGGGKWRIRI
RTCA_NOSS1        ADGDSHITLRGGTHVIFSPTVTYIERVYLPMLCRMGIKAQVKLGAWGWYPRGGGEVNLQV
F8C4I6_THEGP      SEG-GELILKGGTHVPFSPSFHYLKYVFLPIVNFLGLKAEIYLEKAGFYPKGGGKIRAKI
RTCA_BOVIN        AACPSELRLKGGTNAEMAPQIDYTAMVFKPIVEKFGFTFNCDIKMRGYYPKGGGEVIVRM
RTCA_PONAB        AASPSKLHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFVFNCDIKTRGYYPKGGGEVIVRM
RTCA_DICDI        APHSTKMVLGGGTNCDFAPAADYIQNVFLPIATTMGFKCEMSIDKRGFYPKGGGAVTLTT
RTCA_DROME        AGRPSRLIVSGGTNVDFAPPVEYMQEVLLPNLKHFGVSFDLKVQRYGFYPRGQGRCQLDV
RTCA_METTH        SEGEIDVTVSGGTDVLWAPTCDYLREVTIPVLEMMGYSARIEIIRRGYYPEGGGRVHAII
L0AK92_NATGS      LESPLELTVTGGTDVKWSPPLDYFRHVKLPLLRGFGLDATCEPERRGFYPDGGGEVTLHL
L0I8K0_HALRX      LEAPLTLTATGGTDVKWSPTLDYYRRVKLPLLRRFGLQAALSVDRRGFYPAGGGDVTLYL
C7NPI0_HALUD      LDRPLSLTATGGTSVAWSPSMPWYRRGKLPLLREVGLQAAIDVEQPGFYPPGGGKATLSL
RTCA_HALSA        LDEPITATLTGGTDAKWAPPMDYFQHVKLPLLREHGIDATVSVDRRGFYPRGGGEATLTV
A3CS58_METMJ      LQAGGSITVSGGTEVPWSPTIDYLDRVFAPVLRRAGASIEITVRERGYYPRGGGRVHVRV
                            ***    .*                           *  * * *      

RTCA_PYRAB        EPWKERR---------------ELVATKYSS------------------IAKVEGISHAT
RTCA_PYRHO        EPWNEKR---------------ELVAKEYSR------------------IIKIEGISHAT
RTCA_METJA        KPSK-IK---------------KFDLIEHSK------------------SNLVEGISYVQ
RTCA_ARCFU        RPAEMKG---------------VVYERID---------------------EIVRGVSHCQ
RTCA_METMA        EPCKLHG---------------FHFRKTEGNKKTESNPVGEGLKGEKSMMEEIIGVSHAS
RTCA_PYRAE        EPVKRLK---------------AVESEEFGN------------------VVKISGISHAV
RTCA_SACS2        VNGNPS----------------DFSLLELG------------------KLIMIKGISHVS
RTCA_SULIY        VNGNPS----------------AFSLLELG------------------KLTIIKGISHVS
RTCA_SULTO        VKGNPS----------------SFSLMERG------------------ELLMIKGISHVS
RTCA_AQUAE        RNKLEKQPENLQEVKEYLKDKVNLYRTERGEI----------------RKIHVFSVAHEE
A9A2V2_NITMS      NPSNVKA----------------ISLSKRKT-----------------------NRVKIL
B5ICB5_ACIB4      EPSELEG----------------LSILKR---------------------------GEML
RTCA_ECOLI        SPVAS-FNTLQLG------ERGNIVQMRGEV--------------------------LLA
RTCA_ECO57        SPVAS-FNTLQLG------ERGNIVQMRGEV--------------------------LLA
RTCA_ECOUT        SPVAS-FNSLQLG------ERGNIVQMRGEV--------------------------LLA
RTCA_ECO27        SPVAS-FNTLQLG------ERGNIVQMRGEV--------------------------LLA
RTCA_SALEP        EPATS-LRGLTLI------SRGETLRTTAEA--------------------------LLA
RTCA_SALTY        EPAAS-LRGLTLI------SRGETLRTTAEA--------------------------LLA
RTCA_RALSO        TPCAGRLGALHLT------ERGALRELSGQG--------------------------IVA
RTCA_PSEAE        RPARW--RPLQLE------HPGAALRRQARA--------------------------LLA
D2R2E0_PIRSD      TPAKS-LVGFDLL------ERGAVMRQCAVA--------------------------MVS
Q2SQI9_HAHCH      QPAAL--RPIERV------KRGELNHSRLTA--------------------------YCY
RTCA_NOSS1        KGGCQ-LCGLNLL------ERGELKRVQGLA--------------------------VAT
F8C4I6_THEGP      FPWKEFKLPNISK------KFDPDEIFIISL--------------------------ISE
RTCA_BOVIN        SPVKQ-LSPINLT------DRGCVTKIYGRA---------------------FVAGVLPF
RTCA_PONAB        SPVKQ-LDPVNLT------DRGCVTKIYGRA---------------------FVTGVLPF
RTCA_DICDI        QPLTQPLSPITIV------NKGEVNRIVIKSY--------------------FTSPRISP
RTCA_DROME        QPVTK-LNSGKLV------AFGRIKSVSGVA---------------------YCAGRLPV
RTCA_METTH        EPSELRPITLEES---------EIHAVRGIS--------------------------HSR
L0AK92_NATGS      EPSAIDPIELEARG------DLETVRLYSTE--------------------------SES
L0I8K0_HALRX      APSSLDPIRLDERG------TLHGVRLYSTE--------------------------SAS
C7NPI0_HALUD      APSTPSPLHLRDRG------QPERARIHSTA--------------------------TTD
RTCA_HALSA        EPSTPTPITLTERG------DREALTAYSVA--------------------------ESS
A3CS58_METMJ      EPSRPDPIAIPEG---------EEGGCGIVS--------------------------CSA
                                                                              

RTCA_PYRAB        NLPAHVAERQAKAAKE-ELSKLE------VPVKIKTEV-SKSLGPGSGIVVWAETDCL--
RTCA_PYRHO        NLPSHVAERQARAAKD-ELLQLK------VPIEIRTEI-SRSIGPGSGIVVWAETDCL--
RTCA_METJA        NLDESIARRMRKKAVD-LLNKEK------LLPNIKIEC-SKGISTGAGIVLWNDT-----
RTCA_ARCFU        NLPGHVAERQASSARN-FLEERG------IRAEIRTEV-LKGLSTGSGIVLWSGYK----
RTCA_METMA        NLPAHVPARQAESARS-LFLEAG------YDARIDVSS-SEFFSTGSGITLWKGYC----
RTCA_PYRAE        NLPPHVAERQAKAARE-ELSKMG------LDADIAIEVRNDGLGPGSGVVIWAVSDAG--
RTCA_SACS2        SLPSHIAERQKDSAKA-ILSKLG------VQIEIETDVRQGEVSKGSGIALAAIGEK---
RTCA_SULIY        SLPAHIAERQMNSARE-ILSKLG------VPIEIETDVRQGEVSKGSGIALAAIGEK---
RTCA_SULTO        SLPSHIAERQAKSAKEFLLSKIK------IPVEIEIDVRENERSKGSGIALTAIFEK---
RTCA_AQUAE        LRERKVAERQAKGAIE-ALKNLG------YPEPEVYRQYANANSIGTSITIWLEDTKG--
A9A2V2_NITMS      CTFSKIPNEKIESEIKKIKEKLN------ESFVVDVEIKEEALDSGASLLVYSIDEN---
B5ICB5_ACIB4      GKMAYINMRSLPMHIVKRMSKVL------REYEIFEDVGNEGRSKGCGLVIWEEYSN---
RTCA_ECOLI        GVPRHVAEREIATLAG-SFSLH--------EQNIHNLP--RDQGPGNTVSLEVESEN---
RTCA_ECO57        GVPRHVAEREIATLAA-SFSLH--------EQNIHNLP--RDQGPGNTVSLEVESEN---
RTCA_ECOUT        GVPRHVAEREIATLAG-SFSLH--------EQNIHNLP--RDQGPGNTVSLEVESEN---
RTCA_ECO27        GVPRHVAEREIATLVG-SFSLH--------EQNIHNLP--RDQGSGNTVSLEVESEN---
RTCA_SALEP        AVPYHVGEREVATLEA-HFPLA--------EKNVVALE--GGCGPGNALLLMIQSEQ---
RTCA_SALTY        AVPYHVGEREVATLEA-HFPQA--------EKNVVALE--GGCGPGNALSLMIQSEQ---
RTCA_RALSO        NVRPGVARRELEALAA-RVPGV--------VGSVRELS--PAEGPGNALVLDAVHEH---
RTCA_PSEAE        GIPGHVGERELERVRQ-RLGWSD------EERQLEFLA--EDQGPGNALLLRIDCEH---
D2R2E0_PIRSD      NLAKSIALRELAELQE-SLGWPR------DVCHAEEV---RAQGPGNVIYATIESEH---
Q2SQI9_HAHCH      NIPGKVGEREVQAYLS-LREHP-------VHESRQRKP--EAGCAGNLLAVDLQFDD---
RTCA_NOSS1        ELPAHIPQRMANRAEN-LLRTAG------LRVSMQALRE-KGVAPGAGIFLTAEYCN---
F8C4I6_THEGP      DLPSHILERQAISAKK-KLLTAQ------LKSPKEIFEKVKSDSPGTMLFIYSIDKDKI-
RTCA_BOVIN        KVAKDMAAAAVRCIRK-EIRDLY------VNIQPVQEPKDQAFGNGNGIIIIAETSTG--
RTCA_PONAB        KVAKDMAAAAARCIRK-EIRDSY------VNIQPVQEPKDQAFGNGNGIIIIAETSTG--
RTCA_DICDI        LVAERMNNTAKKLIKK-DFKKVD------VETELIDVSK-FSFGDGTFIEIRAYTDQG--
RTCA_DROME        NIAIDMQQTAQREIHR-LWPSQQ------CSIEPIKHSRQKAFHNGAGILMTVNTTSD--
RTCA_METTH        NLPVHVAERQAESAMK-ILRGAG------LDVDIMVEDASGPVGRGSGITLWAEGNTR--
L0AK92_NATGS      LADRDVAHRQAEGGVERLE-------WDGDL--ERRETTADSPSSGSVLVIRVEHALEGS
L0I8K0_HALRX      LADQNVAERQLRAAMERLEGVVVNSEQDDDLVTERVVTTARSDSPGSAIVCRLDFE----
C7NPI0_HALUD      LEDSDVAERQAKQARQRLE-----ASSTDVEVTDRTTRYVTADSTGTVALVGLEYE----
RTCA_HALSA        LADDEVAEQQATAAAPDAA---------------HEIAYTDADSAGSAVVLAAEYE----
A3CS58_METMJ      GLPAHVAERQAAAAQSLLD----------RELGLPCTAALDPREGGTSVGSSVTVW----
                       :                                       *              

RTCA_PYRAB        ---R-LGGDALGKRGKPAEVVGKEAAQELLEQLKPGYCVDKFLGDQLIPFLAFS------
RTCA_PYRHO        ---R-LGGDALGKKGKPAEIVGKEAAQELLDQLKPGHCVDKFLGDQLIPFLAFS------
RTCA_METJA        -----LGGSCLGEKGLRAEIVAERAVNELLKERESGMALDKYMGDQIIPFLAFG------
RTCA_ARCFU        ------GGSALGERGKRAEVVGQEAAESLYRELMSDAAFDAHLADQVMPFAAMARG----
RTCA_METMA        ------GGSALGKKGLPAEKVGRQAAEEVIKELRAGAAVDIHLADQLIPYMALA-G----
RTCA_PYRAE        ---NVIGGDSLGERGKPAETVGKEAAQKLIAVLKTRASVDPHMADMAVLYMALAEG----
RTCA_SACS2        ---SIIGADSLGERGKRAEIVGEEAARKLIDNLNTKAAVDVHMSDMLMIFTSLF------
RTCA_SULIY        ---SIIGADSLGERGKRAEIVGEEAARILINNLNTKASVDIHMSDMLMIFASLY------
RTCA_SULTO        ---TFLGSDSLGEKGKRAEIVGEEAAKSIYEEIISNATVDRHMSDMLMLYASLY------
RTCA_AQUAE        ---NVLGADNLGKKGKLAEVVGAEAVKKLHEDWSSGATVDRHLADHLIPLMALV------
A9A2V2_NITMS      ---SIIGIDSLFDKKIESFDVDLDGFLED-------IAVDENLADMIVVPASVAKG----
B5ICB5_ACIB4      ---TILAGDSLCKRGVPAEKIARIAVEKMEKERNSNSTVDVNMGDHLITFGSLAKG----
RTCA_ECOLI        ---ITERFFVVGEKRVSAEVVAAQLVKEVKRYLASTAAVGEYLADQLVLPMALAGA----
RTCA_ECO57        ---ITERFFVVGEKRVSAEVVAAQLVKEVKRYLASPAAVGEYLADQLVLPMALAGA----
RTCA_ECOUT        ---ITERFFVVGEKRVSAEVVAAQLVKEVKRYLASPAAVGEYLADQLVLPMALAGT----
RTCA_ECO27        ---ITERFFIVGEKRVSAEVVAAQLVKEVKRYLASPAAVGEYLADQLVLPMALAGA----
RTCA_SALEP        ---LTELFAAFGVKGTSAEAVANQVAHEARRYLASPAAVGEHLADQLILPLALAGE----
RTCA_SALTY        ---LTELFAAFGVKGTSAEAVANQVAHEARRYLASPAAVGEHLADQLILPLALAGE----
RTCA_RALSO        ---VTEVFTGFGERGVPAEQVAHGVASAALRYLHSTAAVDEYLADQLVLPMALAGA----
RTCA_PSEAE        ---ICATFCAFGQAGVSAERVAEQVATQAIGWMESGCAADEHLADQLLLPMALAGA----
D2R2E0_PIRSD      ---VTELFIGFGRLGASARKVAEEVVSQVQHYLRAAVPVGPHLADQLLLLLALSAASEPS
Q2SQI9_HAHCH      ---HRICISELGQVRRRAELVSKLLSQKVKSYLDSKAVLDEHLTDQMMLPMLIAGG----
RTCA_NOSS1        ---SLTGFGGFGRLRLSSEKVAEIACGQLLQFHETGAPVDEHLADQLLLPAVLASES---
F8C4I6_THEGP      ---KRVGFFELGKKGYPAEKVGENSAIQFLEFLKTEAQFEEHLGDQILLPLTFAIIK---
RTCA_BOVIN        ---CLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGAVDEYLQDQLIIFMALASGI---
RTCA_PONAB        ---CLFAGSSLGKRGVNADKVGIGAAEMLLANLRHGGTVDEYLQDQLIVFMALANGV---
RTCA_DICDI        ---CIFGATGNGAIGVPAEKVAEDAANSLLKDLQDGGCMDEYLQDQLIIFMALAKGK---
RTCA_DROME        ---VVLGASALGKKRIDGHVLGSEASCQLGDYMRKQVCVDDYMQDQLIIYMALAVGR---
RTCA_METTH        -----LGAVSLGKPGKRAEKVGSEAARELLGFIESGSPLDRYMGDQIIPYMALTGD----
L0AK92_NATGS      KRTGIAGFSSLGERGKPAERVGEDAADAANRFREGTAPVDRHMADQLLVYLAIAGG----
L0I8K0_HALRX      --TGIAGTDVLGERGKPAERVGEEAATAAVRLVAGTAPVDRHLADQLLVPLALAGG----
C7NPI0_HALUD      --NGVIGADALGEPGKPAEDVADEAVDALLADHETGAAVDEHLADQLIPWLAIAGG----
RTCA_HALSA        --HSRAGFAALGERGVSADAVGENAADALAAFESGPGAVDSHLADQLVPVVAVAGG----
A3CS58_METMJ      --SGAKGAVALGKRGLPAEKVGQAAARALADEYRSPGTVDIHLADQLLVHLACHGG----
                                   .  :                     : *  :            

RTCA_PYRAB        ----GGEIWVSEVTNHLKTNIWVVENFLGKVFDLDGEVGKPGKVKVVRRVE---------
RTCA_PYRHO        ----GGVIWVSEITNHLKTNIWVVESFLGRIFDVDGNVGEPGKIRVIRRV----------
RTCA_METJA        ----KGIVGVSEITNHTKTNMWVVKHFLDVDFEIKEYKENNCNGFTIEVV----------
RTCA_ARCFU        ----RTEYTTSEVTMHQKSNAYVINTFLGKVVKFEGNKI------IIK------------
RTCA_METMA        ----NSSFTVRELTLHAATNIWVTEQFLDVKFKIKEKEG------LFEVSVG--------
RTCA_PYRAE        ----RSRISTSEETMHLKTNMYIIEQFLRVKFSTMEKAGR----YTIEVEGVGYNR----
RTCA_SACS2        ----GGEYIGAELTSHAYTNMEIIRKFLDVKIEISGKRP-----FRFKAKIF--------
RTCA_SULIY        ----GGEYIGAELTSHAYTNMEIIKKFLDIKIDVSGKRP-----FRFKAKIF--------
RTCA_SULTO        ----YGEYIGSELTSHARTNSEIIKKFLNVNIQISGEKP-----FIFRAKKEL-------
RTCA_AQUAE        ----GGEIRVPQFTGHLLTNIWVCEQFLGKIFEVDEKEK-----IVRTQGIS--------
A9A2V2_NITMS      ----KTIFQVKKITKHLETNLFVTSKISGCKYGIGKLPNG----FEVIIEGTSYSSIK--
B5ICB5_ACIB4      ----TTVYYVREVTEHIKTNAWVVQK-----FGKRVKVEK----NKIEIQA---------
RTCA_ECOLI        -----GEFTVAHPSCHLLTNIAVVERFLPVRFSLIETDGVTRVSIE--------------
RTCA_ECO57        -----GQFTVAHPSCHLLTNIAVVERFLPVRFTLAETDGVTRVMITKLTD----------
RTCA_ECOUT        -----GEFTVAHPSCHLLTNIAVVERFLPVRFGLIETDGVTRVSIE--------------
RTCA_ECO27        -----GEFTVAHPSCHLLTNIAVVERFLSVRFSLVEADGVTRVSIE--------------
RTCA_SALEP        -----GAFTVARASAHLLTNIAVVERFLPVRFSCEATESGYLVRVSD-------------
RTCA_SALTY        -----GAFTVARASAHLLTNIAVVERFLPVRFSCEATESGYLVRVSD-------------
RTCA_RALSO        -----GCFTAVTASPHLTTNIAVIEKFLPVHITVQAERDASVVRVQVN------------
RTCA_PSEAE        -----GSFTTPRLSAHLQSNRRVIERFLPVRIGDQALDGGGHRIVITSA-----------
D2R2E0_PIRSD      DAQRGGCFRTTTLTPHSESQIAIFQQFLQISVDVHYDPSGQTCTVNVQPK----------
Q2SQI9_HAHCH      -----GRFSIAEWSLHAETNAEVIELFTSRKIECDGAIMWME------------------
RTCA_NOSS1        -----SQYKVAEVSTHLTTNAAVIEKFGLGKITVNQAERVVAIASSKV------------
F8C4I6_THEGP      NREKIFIYKTSKITKHLLTQAWVIPQFMKEINIEVLGKEGNPGEVKISLLN---------
RTCA_BOVIN        -----SRIKTGPVTLHTQTAIHFAEQLAKAKFTVKKSEDEEDASKDTYIIECQGIGMTNP
RTCA_PONAB        -----SRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKGTYIIECQGIGMTNP
RTCA_DICDI        -----SQIKTGPISLHTQTSIHITSLMTGAIFTITPLTNNTQSGEETNLITCEGISYFPS
RTCA_DROME        -----STMRTGKLTNHTRTAINVAEQMTGVKFDVAMEPG------GQMLVSCKGLGHVNK
RTCA_METTH        -----SRVRTCELTLHAETNIILSEKITGRRFRVEGERGGPATIEVL-------------
L0AK92_NATGS      ------RVRIPAVTDHVESSLELLGEMGVEATLERDVSNAETAVVAVELESTIR------
L0I8K0_HALRX      ------RVRVPAVTDHVEASLSLLDAFGHNLVCE-PVPATDDGSEPVDSDSTDHLVTAT-
C7NPI0_HALUD      ------EVRIPRTTDHVETHAALFDAFGFDVRIE------QTEDEPVLVGET--------
RTCA_HALSA        ------EVRAPEVTTHIETCVDLLAEFDYDIDIE------HTDDGAVVLSA---------
A3CS58_METMJ      ------EYSTHTLTMHAKTAGSLLAEFGYPIVCQ--------KNDIVRFSA---------
                               : *  :   .                                     

RTCA_PYRAB        -----------------------------------
RTCA_PYRHO        -----------------------------------
RTCA_METJA        -----------------------------------
RTCA_ARCFU        -----------------------------------
RTCA_METMA        -----------------------------------
RTCA_PYRAE        -----------------------------------
RTCA_SACS2        -----------------------------------
RTCA_SULIY        -----------------------------------
RTCA_SULTO        -----------------------------------
RTCA_AQUAE        -----------------------------------
A9A2V2_NITMS      -----------------------------------
B5ICB5_ACIB4      -----------------------------------
RTCA_ECOLI        -----------------------------------
RTCA_ECO57        -----------------------------------
RTCA_ECOUT        -----------------------------------
RTCA_ECO27        -----------------------------------
RTCA_SALEP        -----------------------------------
RTCA_SALTY        -----------------------------------
RTCA_RALSO        -----------------------------------
RTCA_PSEAE        -----------------------------------
D2R2E0_PIRSD      -----------------------------------
Q2SQI9_HAHCH      -----------------------------------
RTCA_NOSS1        -----------------------------------
F8C4I6_THEGP      -----------------------------------
RTCA_BOVIN        NL---------------------------------
RTCA_PONAB        NL---------------------------------
RTCA_DICDI        DLNNNNNNSNSNTTTTTTTTTISTTTIDNQNSEEK
RTCA_DROME        LI---------------------------------
RTCA_METTH        -----------------------------------
L0AK92_NATGS      -----------------------------------
L0I8K0_HALRX      -----------------------------------
C7NPI0_HALUD      -----------------------------------
RTCA_HALSA        -----------------------------------
A3CS58_METMJ      -----------------------------------