CLUSTAL format seed alignment for MF_00201

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECO_ECOL6      ------------------------------------------------------------
RECO_SHIDS      ------------------------------------------------------------
RECO_ECOUT      ------------------------------------------------------------
RECO_ECOLI      ------------------------------------------------------------
RECO_ECOLC      ------------------------------------------------------------
RECO_ECO5E      ------------------------------------------------------------
RECO_ECO45      ------------------------------------------------------------
RECO_ECOK1      ------------------------------------------------------------
RECO_ECODH      ------------------------------------------------------------
RECO_ECO57      ------------------------------------------------------------
RECO_ECOL5      ------------------------------------------------------------
RECO_SHIFL      ------------------------------------------------------------
RECO_SHIF8      ------------------------------------------------------------
RECO_ECO24      ------------------------------------------------------------
RECO_ECOSM      ------------------------------------------------------------
RECO_ECO7I      ------------------------------------------------------------
RECO_ECO8A      ------------------------------------------------------------
RECO_ECOHS      ------------------------------------------------------------
RECO_ECOSE      ------------------------------------------------------------
RECO_ESCF3      ------------------------------------------------------------
RECO_SHISS      ------------------------------------------------------------
RECO_ECOLU      ------------------------------------------------------------
RECO_SHIBS      ------------------------------------------------------------
RECO_SHIB3      ------------------------------------------------------------
RECO_SALEP      ------------------------------------------------------------
RECO_SALG2      ------------------------------------------------------------
RECO_SALDC      ------------------------------------------------------------
RECO_SALA4      ------------------------------------------------------------
RECO_SALPB      ------------------------------------------------------------
RECO_SALTI      ------------------------------------------------------------
RECO_SALNS      ------------------------------------------------------------
RECO_SALCH      ------------------------------------------------------------
RECO_SALTY      ------------------------------------------------------------
RECO_SALHS      ------------------------------------------------------------
RECO_SALPK      ------------------------------------------------------------
RECO_SALPA      ------------------------------------------------------------
RECO_SALSV      ------------------------------------------------------------
RECO_KLEP7      ------------------------------------------------------------
RECO_KLEP3      ------------------------------------------------------------
RECO_ENT38      ------------------------------------------------------------
RECO_CROS8      ------------------------------------------------------------
RECO_ERWT9      ------------------------------------------------------------
RECO_YERPB      ------------------------------------------------------------
RECO_YERPN      ------------------------------------------------------------
RECO_YERPS      ------------------------------------------------------------
RECO_YERPA      ------------------------------------------------------------
RECO_YERPE      ------------------------------------------------------------
RECO_YERP3      ------------------------------------------------------------
RECO_YERPG      ------------------------------------------------------------
RECO_YERPY      ------------------------------------------------------------
RECO_YERPP      ------------------------------------------------------------
RECO_YERE8      ------------------------------------------------------------
RECO_PROMH      ------------------------------------------------------------
RECO_PHOLL      ------------------------------------------------------------
RECO_PECAS      ------------------------------------------------------------
RECO_SERP5      ------------------------------------------------------------
RECO_SODGM      ------------------------------------------------------------
RECO_VIBCH      ------------------------------------------------------------
RECO_VIBC3      ------------------------------------------------------------
RECO_VIBVY      ------------------------------------------------------------
RECO_VIBVU      ------------------------------------------------------------
RECO_VIBPA      ------------------------------------------------------------
RECO_ALIF1      ------------------------------------------------------------
RECO_ALIFM      ------------------------------------------------------------
RECO_ALISL      ------------------------------------------------------------
RECO_PHOPR      ------------------------------------------------------------
RECO_ACTP2      ------------------------------------------------------------
RECO_ACTPJ      ------------------------------------------------------------
RECO_ACTP7      ------------------------------------------------------------
RECO_HAEDU      ------------------------------------------------------------
RECO_HAEI8      ------------------------------------------------------------
RECO_HAEIE      ------------------------------------------------------------
RECO_HAEIG      ------------------------------------------------------------
RECO_HAEIN      ------------------------------------------------------------
RECO_MANSM      ------------------------------------------------------------
RECO_ACTSZ      ------------------------------------------------------------
RECO_PASMU      ------------------------------------------------------------
RECO_PSYIN      ------------------------------------------------------------
RECO_IDILO      ------------------------------------------------------------
RECO_PSEA6      ------------------------------------------------------------
RECO_HAHCH      ------------------------------------------------------------
RECO_MARHV      ------------------------------------------------------------
RECO_CELJU      ------------------------------------------------------------
RECO_PSEA8      ------------------------------------------------------------
RECO_PSEAE      ------------------------------------------------------------
RECO_PSEAB      ------------------------------------------------------------
RECO_PSEA7      ------------------------------------------------------------
RECO_PSEU5      ------------------------------------------------------------
RECO_PSE14      ------------------------------------------------------------
RECO_PSEU2      ------------------------------------------------------------
RECO_PSESM      ------------------------------------------------------------
RECO_PSEPF      ------------------------------------------------------------
RECO_PSEF5      ------------------------------------------------------------
RECO_PSEP1      ------------------------------------------------------------
RECO_PSEPK      ------------------------------------------------------------
RECO_PSEPG      ------------------------------------------------------------
RECO_PSEE4      ------------------------------------------------------------
RECO_PSEPW      ------------------------------------------------------------
RECO_CUPMC      MPDVRRAAAPRARSADPIAEEAAELLGSGAVPAMNAAVSPSV----AAGREMMDRAMRIV
RECO_CUPPJ      MPDFARGPA-KARRADPVVDEAAELLDSRALPGMADA----------AGRAMMDRAMRIV
RECO_BURPS      ----MTDEADADPQPFAAPPATGAP--AADKPARKPR--------------------RAA
RECO_BURP1      ----MTDEADADPQPFAAPPATGAP--AADKPARKPR--------------------RAA
RECO_BURMA      ----MTDEADADLQPFAAPPATGAP--AADKPARKPR--------------------RAA
RECO_BURTA      ----MTDEADADPQPFAVPPAPGAP--AANKPARKPR--------------------RTV
RECO_BURCA      ---MGTNDALTSTEDAVTAGANDAPLPAPPEPPRKAR--------------------RAT
RECO_BURL3      ---MGTNDALTSTEDAVTAGANDAPLPAPPEPPRKAR--------------------RAT
RECO_PARXL      ----MTLNSDADPDDPEPAAPARDLSKPASKPARSTRKSSSAKSAQGAEGEPRKTPGRRA
RECO_NITMU      ---------------------------------------------------------MNV
RECO_AZOSB      ----------------------------------------------------------MA
RECO_AROAE      ----------------------------------------------------------MS
RECO_DECAR      ----------------------------------------------------------MN
RECO_THIDA      --------------------------------------------------MPASRSLGMS
RECO_POLSJ      -----------------------------------------------------------M
RECO_POLNA      -----------------------------------------------------------M
RECO_RHOFT      -----------------------------------------------------------M
RECO_ACIAC      -----------------------------------------------------------M
RECO_ACISJ      -----------------------------------------------------------M
RECO_VEREI      ----------------------------------------------------------MA
RECO_DELAS      ----------------------------------------------------------MA
RECO_NEIMB      ----------------------------------------------------------MS
RECO_NEIMA      ----------------------------------------------------------MS
RECO_NEIG1      ----------------------------------------------------------MS
RECO_NEIG2      ----------------------------------------------------------MS
RECO_NEIMF      ----------------------------------------------------------MS
RECO_CHRVO      ----------------------------------------------------------MS
RECO_COXBN      ----------------------------------------------------------MT
RECO_COXBU      ----------------------------------------------------------MT
RECO_COXB1      ----------------------------------------------------------MT
RECO_COXB2      ----------------------------------------------------------MT
RECO_COXBR      ----------------------------------------------------------MT
RECO_NITOC      ------------------------------------------------------------
RECO_METCA      --------------------------------------------------------MPPE
RECO_XYLF2      ------------------------------------------------------------
RECO_XYLFT      ------------------------------------------------------------
RECO_XYLFM      ------------------------------------------------------------
RECO_XYLFA      ------------------------------------------------------------
RECO_XANCB      ------------------------------------------------------------
RECO_XANC8      ------------------------------------------------------------
RECO_XANCP      ------------------------------------------------------------
RECO_XANOP      ------------------------------------------------------------
RECO_XANOR      ------------------------------------------------------------
RECO_XANOM      ------------------------------------------------------------
RECO_XANC5      ------------------------------------------------------------
RECO_XANAC      ------------------------------------------------------------
RECO_STRMK      ------------------------------------------------------------
RECO_STRM5      ------------------------------------------------------------
RECO_HALHL      ------------------------------------------------------------
RECO_ALKEH      ------------------------------------------------------------
RECO_NITHX      ------------------------------------------------------------
RECO_NITWN      ------------------------------------------------------------
RECO_RHOP2      ------------------------------------------------------------
RECO_RHOPS      ------------------------------------------------------------
RECO_RHOPB      ------------------------------------------------------------
RECO_RHOPT      ------------------------------------------------------------
RECO_RHOPA      ------------------------------------------------------------
RECO_BRADU      ------------------------------------------------------------
RECO_RHOP5      ------------------------------------------------------------
RECO_BRASO      ------------------------------------------------------------
RECO_BRASB      ------------------------------------------------------------
RECO_OLICO      ------------------------------------------------------------
RECO_XANP2      ------------------------------------------------------------
RECO_CHESB      ------------------------------------------------------------
RECO_RHILO      ------------------------------------------------------------
RECO_BRUSU      ------------------------------------------------------------
RECO_BRUA2      ------------------------------------------------------------
RECO_BRUAB      ------------------------------------------------------------
RECO_BRUME      ------------------------------------------------------------
RECO_RHIME      ------------------------------------------------------------
RECO_SINMW      ------------------------------------------------------------
RECO_RHIL3      ------------------------------------------------------------
RECO_RHILW      ------------------------------------------------------------
RECO_RHIE6      ------------------------------------------------------------
RECO_RHIEC      ------------------------------------------------------------
RECO_AGRFC      ------------------------------------------------------------
RECO_METEP      ------------------------------------------------------------
RECO_METPB      ------------------------------------------------------------
RECO_BEII9      ------------------------------------------------------------
RECO_BARQU      ------------------------------------------------------------
RECO_BARHE      ------------------------------------------------------------
RECO_BART1      ------------------------------------------------------------
RECO_BARBK      ------------------------------------------------------------
RECO_RHORT      ------------------------------------------------------------
RECO_RHOCS      ------------------------------------------------------------
RECO_CAUVC      ------------------------------------------------------------
RECO_CAUSK      ------------------------------------------------------------
RECO_ROSDO      ------------------------------------------------------------
RECO_RUEPO      ------------------------------------------------------------
RECO_RUEST      ------------------------------------------------------------
RECO_RHOS1      ------------------------------------------------------------
RECO_RHOS4      ------------------------------------------------------------
RECO_RHOS5      ------------------------------------------------------------
RECO_JANSC      ------------------------------------------------------------
RECO_GLUDA      ------------------------------------------------------------
RECO_GRABC      ------------------------------------------------------------
RECO_CHLTB      ------------------------------------------------------------
RECO_CHLT2      ------------------------------------------------------------
RECO_CHLTR      ------------------------------------------------------------
RECO_CHLTA      ------------------------------------------------------------
RECO_CHLMU      ------------------------------------------------------------
RECO_CHLPN      ------------------------------------------------------------
RECO_BACSU      ------------------------------------------------------------
RECO_BACVZ      ------------------------------------------------------------
RECO_BACLD      ------------------------------------------------------------
RECO_BACP2      ------------------------------------------------------------
RECO_BACC7      ------------------------------------------------------------
RECO_BACCZ      ------------------------------------------------------------
RECO_BACAN      ------------------------------------------------------------
RECO_BACC0      ------------------------------------------------------------
RECO_BACHK      ------------------------------------------------------------
RECO_BACCR      ------------------------------------------------------------
RECO_BACC4      ------------------------------------------------------------
RECO_BACC2      ------------------------------------------------------------
RECO_BACC1      ------------------------------------------------------------
RECO_BACMK      ------------------------------------------------------------
RECO_BACCN      ------------------------------------------------------------
RECO_BACHD      ------------------------------------------------------------
RECO_GEOTN      ------------------------------------------------------------
RECO_GEOKA      ------------------------------------------------------------
RECO_LISIN      ------------------------------------------------------------
RECO_LISW6      ------------------------------------------------------------
RECO_LISMO      ------------------------------------------------------------
RECO_LISMF      ------------------------------------------------------------
RECO_BACSK      ------------------------------------------------------------
RECO_OCEIH      ------------------------------------------------------------
RECO_EXIS2      ------------------------------------------------------------
RECO_STAAM      ------------------------------------------------------------
RECO_STAA1      ------------------------------------------------------------
RECO_STAAN      ------------------------------------------------------------
RECO_STAAT      ------------------------------------------------------------
RECO_STAAE      ------------------------------------------------------------
RECO_STAAC      ------------------------------------------------------------
RECO_STAA3      ------------------------------------------------------------
RECO_STAAB      ------------------------------------------------------------
RECO_STAAW      ------------------------------------------------------------
RECO_STAAS      ------------------------------------------------------------
RECO_STAAR      ------------------------------------------------------------
RECO_STAEQ      ------------------------------------------------------------
RECO_STAES      ------------------------------------------------------------
RECO_STAHJ      ------------------------------------------------------------
RECO_STAS1      ------------------------------------------------------------
RECO_STRSV      ------------------------------------------------------------
RECO_STRGC      ------------------------------------------------------------
RECO_STRPI      ------------------------------------------------------------
RECO_STRPN      ------------------------------------------------------------
RECO_STRPS      ------------------------------------------------------------
RECO_STRP4      ------------------------------------------------------------
RECO_STRP2      ------------------------------------------------------------
RECO_STRR6      ------------------------------------------------------------
RECO_STRPD      ------------------------------------------------------------
RECO_STRPG      ------------------------------------------------------------
RECO_STRP6      ------------------------------------------------------------
RECO_STRPC      ------------------------------------------------------------
RECO_STRPB      ------------------------------------------------------------
RECO_STRP1      ------------------------------------------------------------
RECO_STRP3      ------------------------------------------------------------
RECO_STRPZ      ------------------------------------------------------------
RECO_STRPM      ------------------------------------------------------------
RECO_STRP8      ------------------------------------------------------------
RECO_STRPF      ------------------------------------------------------------
RECO_STREM      ------------------------------------------------------------
RECO_STRS2      ------------------------------------------------------------
RECO_STRSY      ------------------------------------------------------------
RECO_STRMU      ------------------------------------------------------------
RECO_STRA5      ------------------------------------------------------------
RECO_STRA3      ------------------------------------------------------------
RECO_STRA1      ------------------------------------------------------------
RECO_STRT2      ------------------------------------------------------------
RECO_STRT1      ------------------------------------------------------------
RECO_STRTD      ------------------------------------------------------------
RECO_LACLS      ------------------------------------------------------------
RECO_LACLM      ------------------------------------------------------------
RECO_LACLA      ------------------------------------------------------------
RECO_ENTFA      ------------------------------------------------------------
RECO_LACBA      ------------------------------------------------------------
RECO_LACPL      ------------------------------------------------------------
RECO_LACSS      ------------------------------------------------------------
RECO_LACRD      ------------------------------------------------------------
RECO_LACRJ      ------------------------------------------------------------
RECO_LACF3      ------------------------------------------------------------
RECO_LACS1      ------------------------------------------------------------
RECO_PEDPA      ------------------------------------------------------------
RECO_LEUMM      ------------------------------------------------------------
RECO_LEUCK      ------------------------------------------------------------
RECO_OENOB      ------------------------------------------------------------
RECO_LACAC      ------------------------------------------------------------
RECO_LACH4      ------------------------------------------------------------
RECO_LACJO      ------------------------------------------------------------
RECO_LACGA      ------------------------------------------------------------
RECO_LACDB      ------------------------------------------------------------
RECO_LACDA      ------------------------------------------------------------
RECO_CLOPS      ------------------------------------------------------------
RECO_CLOP1      ------------------------------------------------------------
RECO_CLOPE      ------------------------------------------------------------
RECO_CLONN      ------------------------------------------------------------
RECO_CLOK5      ------------------------------------------------------------
RECO_CLOAB      ------------------------------------------------------------
RECO_ALKMQ      ------------------------------------------------------------
RECO_ALKOO      ------------------------------------------------------------
RECO_CLOD6      ------------------------------------------------------------
RECO_HUNT2      ------------------------------------------------------------
RECO_CALS8      ------------------------------------------------------------
RECO_THEPX      ------------------------------------------------------------
RECO_THEP3      ------------------------------------------------------------
RECO_CALS4      ------------------------------------------------------------
RECO_NOSS1      ------------------------------------------------------------
RECO_TRIV2      ------------------------------------------------------------
RECO_NOSP7      ------------------------------------------------------------
RECO_TRIEI      ------------------------------------------------------------
RECO_GLOC7      ------------------------------------------------------------
RECO_RIPO1      ------------------------------------------------------------
RECO_SYNY3      ------------------------------------------------------------
RECO_ACAM1      ------------------------------------------------------------
RECO_SYNP6      ------------------------------------------------------------
RECO_SYNE7      ------------------------------------------------------------
RECO_THEEB      ------------------------------------------------------------
RECO_SYNJB      ------------------------------------------------------------
RECO_SYNJA      ------------------------------------------------------------
RECO_GLOVI      ------------------------------------------------------------
RECO_NOCFA      ------------------------------------------------------------
RECO_RHOJR      ------------------------------------------------------------
RECO_MYCSK      ------------------------------------------------------------
RECO_MYCSS      ------------------------------------------------------------
RECO_MYCSJ      ------------------------------------------------------------
RECO_MYCS2      ------------------------------------------------------------
RECO_MYCGI      ------------------------------------------------------------
RECO_MYCA9      ------------------------------------------------------------
RECO_MYCMM      ------------------------------------------------------------
RECO_MYCUA      ------------------------------------------------------------
RECO_MYCTA      ------------------------------------------------------------
RECO_MYCTU      ------------------------------------------------------------
RECO_MYCBP      ------------------------------------------------------------
RECO_MYCBO      ------------------------------------------------------------
RECO_MYCPA      ------------------------------------------------------------
RECO_MYCLE      ------------------------------------------------------------
RECO_SACEN      ------------------------------------------------------------
RECO_STRCO      ------------------------------------------------------------
RECO_STRAW      ------------------------------------------------------------
RECO_STRGG      ------------------------------------------------------------
RECO_THEFY      ------------------------------------------------------------
RECO_NOCSJ      ------------------------------------------------------------
RECO_FRACC      ------------------------------------------------------------
RECO_LEIXX      ------------------------------------------------------------
RECO_CUTAK      ------------------------------------------------------------
RECO_BIFLO      ------------------------------------------------------------
RECO_BIFLD      ------------------------------------------------------------
RECO_BIFAA      ------------------------------------------------------------
RECO_RUBXD      ------------------------------------------------------------
RECO_PELTS      ------------------------------------------------------------
RECO_DESAP      ------------------------------------------------------------
RECO_DESRM      ------------------------------------------------------------
RECO_MOOTA      ------------------------------------------------------------
RECO_SYMTH      ------------------------------------------------------------
RECO_DESHY      ------------------------------------------------------------
RECO_HELMI      ------------------------------------------------------------
RECO_HERA2      ------------------------------------------------------------
RECO_ROSS1      ------------------------------------------------------------
RECO_DEHMC      ------------------------------------------------------------
RECO_DEHMB      ------------------------------------------------------------
RECO_DEHM1      ------------------------------------------------------------
RECO_ANASK      ------------------------------------------------------------
RECO_ANADE      ------------------------------------------------------------
RECO_ANADF      ------------------------------------------------------------
RECO_MYXXD      ------------------------------------------------------------
RECO_GEOMG      ------------------------------------------------------------
RECO_GEOSL      ------------------------------------------------------------
RECO_GEOUR      ------------------------------------------------------------
RECO_PELPD      ------------------------------------------------------------
RECO_DESAL      ------------------------------------------------------------
RECO_DESOH      ------------------------------------------------------------
RECO_PROA2      ------------------------------------------------------------
RECO_CHLPB      ------------------------------------------------------------
RECO_CHLL2      ------------------------------------------------------------
RECO_CHLPD      ------------------------------------------------------------
RECO_PELPB      ------------------------------------------------------------
RECO_CHLP8      ------------------------------------------------------------
RECO_PELCD      ------------------------------------------------------------
RECO_SYNWW      ------------------------------------------------------------
RECO_SYNAS      ------------------------------------------------------------
RECO_SYNFM      ------------------------------------------------------------
RECO_CARHZ      ------------------------------------------------------------
RECO_KORVE      ------------------------------------------------------------
RECO_RHOBA      ------------------------------------------------------------
RECO_SALRD      ------------------------------------------------------------
RECO_SYNSC      ------------------------------------------------------------
                                                                            

RECO_ECOL6      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_SHIDS      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOUT      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOLI      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOLC      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECO5E      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECO45      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOK1      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECODH      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECO57      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOL5      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_SHIFL      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_SHIF8      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECO24      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOSM      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECO7I      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECO8A      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOHS      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOSE      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ESCF3      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_SHISS      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_ECOLU      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_SHIBS      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_SHIB3      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-STLKGALQ
RECO_SALEP      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALG2      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALDC      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGVLQ
RECO_SALA4      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALPB      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALTI      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALNS      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALCH      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALTY      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALHS      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALPK      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALPA      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_SALSV      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_KLEP7      --------MDGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_KLEP3      --------MDGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_ENT38      --------MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKR-SNLKGALQ
RECO_CROS8      --------MEGWQRAFVLHARPWSETSLIIDLFSEESGRVRVVAKGARRKR-SNLKGALQ
RECO_ERWT9      --------MEGWQRAFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARAKR-SSLKGALQ
RECO_YERPB      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERPN      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERPS      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERPA      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERPE      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERP3      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERPG      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERPY      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERPP      --------MDGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_YERE8      --------MEGWQRAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRR-SNLKGCLQ
RECO_PROMH      --------MEGWQRAFVIHARPYSETSLLLDFFTENEGRVRILSKGARGRR-SPLKGALQ
RECO_PHOLL      --------MDGWQRVFVLHGRPYSETSLLLDLFTENEGRISVLAKGARGRR-SNLKGCLQ
RECO_PECAS      --------MEGWQRAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARR-SSLKGCLQ
RECO_SERP5      --------MDGWERAFVLHGRPYSETSLMLDMFTEGHGRVRLLAKGARSRR-SNLKGCLQ
RECO_SODGM      --------MDGWQRAFVLHARPYSETSLLLDFFTEQQGRVRVLAKGARSRR-SALKGVLQ
RECO_VIBCH      -------MSDGLQRCFVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKR-SNLKGALQ
RECO_VIBC3      -------MSDGLQRCFVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKR-SNLKGALQ
RECO_VIBVY      -----MNAPDGLQRCFVLHRRPYSESSLILDVFSEEFGRITLMSKGARSKR-SNLKGALQ
RECO_VIBVU      -----MNAPDGLQRCFVLHRRPYSESSLILDIFSEEFGRITLMSKGARSKR-SNLKGALQ
RECO_VIBPA      ---MSNLSAEGFQRCFVLHRRPYSESSLILDVFSEEYGRITLMAKGARSKR-SNLKGALQ
RECO_ALIF1      -------MEEGLQRCFVLHRRPYSESSLILDVFSEEYGRLSIISKGARSKR-SNLKGVLQ
RECO_ALIFM      -------MEEGLQRCFVLHRRPYSESSLILDVFSEEYGRLSIISKGARSKR-SNLKGVLQ
RECO_ALISL      -------MEEGLQRCFVLHRRPYSESSLILDVFSEEYGRLSIISKGARSKR-SNLKGVLQ
RECO_PHOPR      --------MEGLQRCFVLHYRPYSETSLILDVFSEDYGRLTILSKGARRKR-SNLKGTLQ
RECO_ACTP2      -------MIENWHRGFVLHRREYSETSLLVDFFTEEHGRVTLLAKGARRPR-SPLKAVLQ
RECO_ACTPJ      -------MIENWHRGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPH-SPLKAVLQ
RECO_ACTP7      -------MIENWHRGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPR-SPLKAVLQ
RECO_HAEDU      -------MIEQWQRGFVLHRREYRETSLLVDFFTEQHGRITLLAKGAKRVR-SPLKAVLQ
RECO_HAEI8      -------MQSELQRGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKR-SSWKSVLQ
RECO_HAEIE      -------MQSELQRGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKR-SSWKSVLQ
RECO_HAEIG      -------MQSELQRGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKR-SSWKSVLQ
RECO_HAEIN      -------MQSELQRGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKR-SSWKSVLQ
RECO_MANSM      ----------------MLHRKPYSETSLLVDLFTEESGRLTVLAKGARAKR-SALKSVLQ
RECO_ACTSZ      ------MAIETFQRGFVLHRKPYSETSLLVDLFTEETGRLTVLAKGARAKR-SAWKGVLQ
RECO_PASMU      ----MRQVIENWQRGFVLHRKAYSETSLLVELFTEETGRLTVLAKGARAKR-SALKGILQ
RECO_PSYIN      -------MSIECHNAFILHRRPYRETSQLIDLFCQDVGKVSLVYKGGRSST-RMRRGTAQ
RECO_IDILO      ----------MAQRALVLHRWDYQETSLILDLFTEDKGRVRVVAKGAKRPK-SPWRGLAQ
RECO_PSEA6      -------MAAEQLNGYVLHRRAYRETSFLVNIFTLENGKVSAVVKGVRGSK-SDKKSLLQ
RECO_HAHCH      ------MHRVSLQAAYVLHSRPYRESSYIVDLITEADGKASAVLKGG-GRR-KGVPGTLQ
RECO_MARHV      -----MKGAVQQEPAYVVHRRPWRETALLVDLFTLNHGRMSVVARGANSTK-SPLKAQLQ
RECO_CELJU      -------MRVDLQPAYILHARPYRDTSLLLDLLTPVYGRITAVARGVRQSK-GHKRQLLN
RECO_PSEA8      -----MSFAAA-QATYVLHSRPYKETSALVDFFTPL-GRLRAVLRGARGKA-GA---LAR
RECO_PSEAE      -----MSFAAA-QATYVLHSRPYKETSALVDFFTPL-GRLRAVLRGARGKA-GA---LAR
RECO_PSEAB      -----MSFAAA-QATYVLHSRPYKETSALVDFFTPL-GRLRAVLRGARGKA-GA---LAR
RECO_PSEA7      -----MTFAAA-QATYVLHSRPYKETSALVDFFTAQ-GRLRAVLRGARGKA-GA---LAR
RECO_PSEU5      ---MRTPWAAMHQPAFVLHSRPYKESSALVDLFTPQ-GRLRAVMRAARGKA-GS---LIR
RECO_PSE14      ------MSAPTGQPAYVLHSRAYRENSALVDFLTPQ-GRLRAVLRSAKGKA-GS---LAR
RECO_PSEU2      ------MSTPTGQPAYVLHSRAYRENSALVDFLTPQ-GRLRAVLRSAKGKA-GS---LAR
RECO_PSESM      ------MSTPTGQPAYVLHSRAYRENSALVDFLTPQ-GRLRAVLRSAKGKA-GS---LAR
RECO_PSEPF      ----MSQSPPPAQPAYVLHSRAYRETSALVDFLTPQ-GRLRAVLRSARGKA-GT---LAR
RECO_PSEF5      ----MSSNAPVGQLAYVLHSRAYRESSALVDFLTPQ-GRLRAVLRNARGKA-GT---LAR
RECO_PSEP1      ------MEQPVGQPAYVLHSRAYKETSALVDFFTPQ-GRMRAVLRRARGKG-GS---LVR
RECO_PSEPK      ------MEQPVGQPAYVLHSRAYKETSALVDFFTPQ-GRMRAVLRRARSKG-GS---LVR
RECO_PSEPG      ------MDQPTPQPAYVLHSRAYKETSALVDFFTPQ-GRVRAVLRRARSKG-GS---LVR
RECO_PSEE4      ------MEQPAPQPAYVLHSRAYKETSALVDFLTPQ-GRVRAVLRRARGKG-GS---LVR
RECO_PSEPW      ------MEQPVGQPAYVLHSRAYKETSALVDFFTPQ-GRVRAVLRRARGKG-GS---LVR
RECO_CUPMC      PAR--SELRVTNEAGFVLHAHPYRETSLVLDVFTRDHGRVAMVAKGAKRPH-SALRAVLQ
RECO_CUPPJ      PAR--SETRVSEQPGFVLHAWPYRETSLILDVFTRDHGRLSMVAKGAKRPH-SALRPVLQ
RECO_BURPS      PRT--SEFRIAEQPAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPH-SALRGVLQ
RECO_BURP1      PRT--SEFRIAEQPAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPH-SALRGVLQ
RECO_BURMA      PRT--SEFRIAEQPAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPH-SALRGVLQ
RECO_BURTA      PRT--SEFRIAEQPGFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPH-SALRGVLQ
RECO_BURCA      SRT--SDFRVAEQPAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPH-SALRGVLQ
RECO_BURL3      SRT--SDFRVAEQPAYVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPH-SALRGVLQ
RECO_PARXL      PRTPASDYRIAEQPAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPH-SALRGVLQ
RECO_NITMU      DKQ-----RQEAQPAFVLHSYPYLETSLIVEVFTQNSGRIAVVAKGAKRPT-SPLRGLLR
RECO_AZOSB      VKQ-----RIDQQSAWVLHTLPWRETSLIVEVFSRDHGRLALVAKGARRPH-SAFRGVLM
RECO_AROAE      QKQ-----RIDQQPAFVLHTYPWRETSLVVEIFSRDHGRVALVAKGARRPM-SALRGVIM
RECO_DECAR      LRS-----KVDSQPAYVLHSYPFRETSLIVEVFSRDFGRMALLARGARRPR-SAIRGLLM
RECO_THIDA      SDA-----RVNNESGFILHTYPFKETSVVAEVFTRAHGRVALIARGARRPA-SALRGLMQ
RECO_POLSJ      ATK-----RIGDEPAYVLHRYDWSESSLILEIFTRQYGRVALVARGAKKPS-SSFRPILL
RECO_POLNA      ASQ-----RISNEPAYVLHRYDWSESSLILDVFTRHHGRVALVARGAKKPS-SSFRPILL
RECO_RHOFT      ATQ-----RISDEPAYVLHRHDWSESSLILEVFTRHHGRIALVAKGVKRPS-SSFRPILL
RECO_ACIAC      AAR-----RISDEPAYVLHRYDWSESSLILDVFTRHHGRVALVARGAKKPT-SNFRPVLL
RECO_ACISJ      AAR-----RIADEPAYVLHSYDWSESSLILETFTRHYGRVALVAKGAKKPT-SNFRPVLL
RECO_VEREI      AAK-----RIADEPAFVLHSYDWSESSLILEVFCRHQGRVALVAKGAKKPS-SNFRPVLL
RECO_DELAS      SAK-----RVSDEPAYVLHSYDWSESSLILEVFTRHRGRVALAAKGVKRPT-SNFRPVLL
RECO_NEIMB      EY------RVNHEPVFMLASSPWRESSLWVEAFSRRYGRVALLARSARKRQ-SELRGVLV
RECO_NEIMA      EH------RVNHEPVFLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQ-SELRGVLV
RECO_NEIG1      EY------RVNHEPVFMLASSPWRESSLRVEAFSRRYGRVALLARSARKRQ-SELRGVLV
RECO_NEIG2      EY------RVNHEPVFMLASSPWRESSLRVEAFSRRYGRVALLARSARKRQ-SELRGVLV
RECO_NEIMF      EH------RVNHEPVFLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQ-SELRGVLV
RECO_CHRVO      QPG-----RVDKQPGYILHTQPYRETSLLLEVLSRDHGRFSLVARSARRPR-SDLRGVLL
RECO_COXBN      K-------RVALEPAFILHRRPYSNTSLILELLTPNHGRVCALARSARGLK-SRYKGKLE
RECO_COXBU      K-------RVALEPAFILHRRPYSNTSLILELLTPNHGRVCALARSARGLK-SRYKGKLE
RECO_COXB1      K-------RVALEPAFILHRRPYSNTSLILELLTPNHGRVCALARSARGLK-SRYKGKLE
RECO_COXB2      K-------RVALEPAFILHRRPYSNTSLILELLTPNHGRVCALARSARGLK-SRYKGKLE
RECO_COXBR      K-------RVALEPAFILHRRPYSNTSLILELLTPNHGRVCALARSARGLK-SRYKGKLE
RECO_NITOC      -------MRVVLQPAYVLHSRPYRETSALVEVFTPEYGRVGLVAKGVKRQR-THRFSLLQ
RECO_METCA      APRRGDPSRVLLDHAYLLHRRDYRETSLLLELFTLRHGRIGVIAKGARRGR-QGFAAVLQ
RECO_XYLF2      -------MLIEHEVAFVLHVRPWRETSLLVEVLTQAYGRLGLIARGVQGLKKQTLRAALQ
RECO_XYLFT      -------MLIEHEVAFVLHVRPWRETSLLVEVLTQAYGRLGLIARGVQGLKKQTLRAALQ
RECO_XYLFM      -------MLIEHEVAFVLHVRPWRETSLLVEVLTQAYGRLGLIARGVQGLKKQTLRAALQ
RECO_XYLFA      -------MLIEHEVAFVLHVRPWRETSLLVEVLTQAYGRLGLIARGVQGLKKQTLRAALQ
RECO_XANCB      -------MLIEHERGFVLHARAWRETSLLVEVLTEQHGRVGLLARGVHGPRKQALRAALQ
RECO_XANC8      -------MLIEHERGFVLHARAWRETSLLVEVLTEQHGRVGLLARGVHGPRKQALRAALQ
RECO_XANCP      -------MLIEHERGFVLHARAWRETSLLVEVLTEQHGRVGLLARGVHGPRKQALRAALQ
RECO_XANOP      -------MLIEHERGFVLHVRAWRETSLLVEVLTEQHGRVGLLARGVHGPRKQALRAALQ
RECO_XANOR      -------MLIEHERGFVLHVRAWRETSLLVEVLTEQHGRVGLLARGVHGPRKQALRAALQ
RECO_XANOM      -------MLIEHERGFVLHVRAWRETSLLVEVLTEQHGRVGLLARGVHGPRKQALRAALQ
RECO_XANC5      -------MLIEHERGFVLHVRAWRETSLLVEVLTEQHGRVGLLARGVQGPRKQALRAALQ
RECO_XANAC      -------MLIEHERGFVLHVRAWRETSLLVEVLTEQHGRVGLLARGVQGPRKQALRAALQ
RECO_STRMK      -------MMIEDDTGFVLHARAYRETSLLVEVLSAQHGRVGLLARGVSTAKGQVLRAALQ
RECO_STRM5      -------MLIEDDTGFVLHARAYRETSLLVEVLSAQHGRIGVLARGVSTAKGQVLRAALQ
RECO_HALHL      ----MNGAQG--QPAWVLHRRAFRESSTLVELFSQEYGRIGAVANGVRR---RGWSGQLE
RECO_ALKEH      ----MSGDRVLVQPAWVLHRRPWSESSLIVELFSRDFGRIGAVARGGRNS--RRWRGLLE
RECO_NITHX      --------MEWTDDGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSR---MRPLLQ
RECO_NITWN      --------MEWTDDGIVLGVRRHGESSAIVELLTRTHGRHLGLVRGGAGSR---MRPLLQ
RECO_RHOP2      --------MEWSDEGIILGVRRHGEAGAIVELLTRGHGRHLGLVRGGASSR---LRPLLQ
RECO_RHOPS      --------MEWSDEGIILGVRRHGEAGAIVELLTRSHGRHLGLVRGGASSR---MRPLLQ
RECO_RHOPB      --------MEWTDEGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSK---LRPLLQ
RECO_RHOPT      --------MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASAR---MRPLLQ
RECO_RHOPA      --------MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASAR---MRPLLQ
RECO_BRADU      --------MEWTDEGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSR---MRPLLQ
RECO_RHOP5      --------MEWTDDGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSK---LRPVLQ
RECO_BRASO      --------MEWTDDGIVLGLRRHGESSAVVELLTREHGRHLGLVRGAAGKR---MRPVLQ
RECO_BRASB      --------MEWTDDGIVLGLRRHGESSAVLELLTREHGRHLGLVRGASGAR---MRPMLQ
RECO_OLICO      --------MEWTDDGIILGTRRHGEANAIVELLTRSHGRHLGLVRGGAGTR---MRPLLQ
RECO_XANP2      --------MEWTDEGIVLGVRRHGEGNAIVELLTRLRGRHLGMVRGGASRR---QAPLLQ
RECO_CHESB      --------MEWHDEGIVLGTRRHGESSVILEAITAAHGRHLGLVRGGRSKR---MQPVLQ
RECO_RHILO      --------MEWRDEGIILGTRKHGETSAILEVMTRAHGRHLGLVRGGRSRK---QQPVLQ
RECO_BRUSU      --------MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRR---MQPLLQ
RECO_BRUA2      --------MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRR---MQPLLQ
RECO_BRUAB      --------MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRR---MQPLLQ
RECO_BRUME      --------MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRR---MQPLLQ
RECO_RHIME      --------MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRT---MQPVLQ
RECO_SINMW      --------MQWSDQAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRA---MQPVLQ
RECO_RHIL3      --------MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRA---MQPVLQ
RECO_RHILW      --------MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRA---MQPVLQ
RECO_RHIE6      --------MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRA---MQPVLQ
RECO_RHIEC      --------MQWQDQAIILGVKRHGETSVIAEVMTRGRGRHLGLVRSGRSRA---MRPVLQ
RECO_AGRFC      --------MQWQDEAIILGVKRHGETSVIAEVMTPSRGRHLGMVRSGRSRT---MQPVLQ
RECO_METEP      --------MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRR---MQPMLQ
RECO_METPB      --------MQWIDEGLVIGLRKHGETGVVLELMTLEHGRHLGLVHGGRSRR---MQPMLQ
RECO_BEII9      --------MEWHDEGLIIGLRRYGETGAILEVFTPAHGRHFGLVRGGFGRR---LRALLQ
RECO_BARQU      --------MKWKEQAVILGTRQYGETSIILEVMTRQHGRYMGIVKGGHSRR---MAGLLQ
RECO_BARHE      --------MKWKEQAIILGTRQYGETSVILEVMTRQHGRYMGVVKGGRSRR---MAVLLQ
RECO_BART1      --------MKWKEQAVILGVRQYGETSVILEIITRERGRYMGVVKGGRSRR---MAALLQ
RECO_BARBK      --------MKWKEQAIILGARQYGETSVILEVVTRQHGRYMGVVKGGRSRR---MAALLQ
RECO_RHORT      -------MIEWSDRGIVLAARPHGEDGVIVSLLSAGHGRHSGIVRGGRGKR---LRAALQ
RECO_RHOCS      --------MEWTDDAIVLSARPHGETAALAVLLTRGHGRHAGLVHGGQSGR---MRPVLE
RECO_CAUVC      -MGNPRLSLEWEDEAYVLSARSHGETGAIVELLTEARGKVAAHVAGAASRR---MKPFLQ
RECO_CAUSK      --------MEWEDEAFVLSARVHGETGAIVELLTQERGKFVAHVSGAASRR---MKPFLQ
RECO_ROSDO      --------MEWREEGILLSTRRHGESAAIIEVFTPSHGRHAGVVRGGTSRK---IAPILQ
RECO_RUEPO      --------MDWRDQGILLAVRRHGETSAIIDTFTASHGRHAGVVRGGTSRR---IAPILQ
RECO_RUEST      --------MDWRDQGILLTVRRHGESSALIEVFTEDHGLHAGLVRGGASRK---MAPHLQ
RECO_RHOS1      -------MMEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRK---IAPILQ
RECO_RHOS4      --------MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRK---IAPILQ
RECO_RHOS5      -------MLEWRDEGALLSVRRHGESAAIIEVFTASHGRHLGVVRGGASRR---HAPVLQ
RECO_JANSC      --------MDWRADGILLAVRRHGEASAIIELFTADQGCHLGVVRGGASRK---MAPLLQ
RECO_GLUDA      --------MEWEAPALVLSASPYGESSAIVHLLTEDLGLVHGLARGGTARA---NRALWQ
RECO_GRABC      --------MEWTAPCIVLSAQPYGEADCLAAVFSEDQGLYRGLVRGGTSRQ---RGGIWQ
RECO_CHLTB      --------MQITLPGVVLTNSPAEKQHVIVKIFSPAGLLSAFAKNGASLSC--DFRESLF
RECO_CHLT2      --------MQITLPGVVLTNSPAEKQHVIVKIFSPAGLLSAFAKNGASLSC--DFRESLF
RECO_CHLTR      --------MQITLPGVVLTNSPAEKQYVIVKIFSPAGLLSAFAKNGASLSC--DFRESLF
RECO_CHLTA      --------MQITLPGVVLTNSPAEKQYVIVKIFSPAGLLSAFAKNGASLSC--DFRESLF
RECO_CHLMU      --------MQIILPGIVLTHSPAEKQHVIAKIFSPAGLLSAFAKNGASLSC--DFRESLL
RECO_CHLPN      --------MQICVTGVVLRSRPLGKNHTLTTLFTPEGLFTFFAKQGQTLQC--DYRETLV
RECO_BACSU      --------MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPN-SRLSAVSQ
RECO_BACVZ      --------MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGARKSA-SRLSAVSQ
RECO_BACLD      --------MLTKCEGIVLRTNDYGETNKIITLLTREHGKIGVLARGAKKPN-SRLSAISQ
RECO_BACP2      --------MLIKSEGIVLRTTDYGETNKIVTLLTREHGKIGVMARGAKKSN-SRLSAISQ
RECO_BACC7      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPK-SRLASVSQ
RECO_BACCZ      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPK-SRLASVSQ
RECO_BACAN      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPK-SRLASVSQ
RECO_BACC0      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPK-SRLASVSQ
RECO_BACHK      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPK-SRLASVSQ
RECO_BACCR      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGSKKPK-SRLASVSQ
RECO_BACC4      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGSKKPK-SRLASVSQ
RECO_BACC2      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKISAMARGAKKPK-SRLASVSQ
RECO_BACC1      --------MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKXPK-SRLASVSQ
RECO_BACMK      --------MFQKVEGIVIRTTDYGETNKIVTIYSREFGKVSAMARGAKKPK-SRLAAISQ
RECO_BACCN      --------MFQKVEGIVIRTTDYGETNKIVTIFSREFGKISVMARGAKKPK-SRLASISQ
RECO_BACHD      --------MFHKAEGIVIRTVDYGESNKIVTVFTREYGKIALMARGAKRPK-SRLTAVTQ
RECO_GEOTN      --------MFQKCEAIVIRAIDYGETNKIVTLFTREWGKVAAMARGAKKPS-SRLSAVTQ
RECO_GEOKA      --------MFETCEAIVMRTVDYGETNKIVTLFTREWGKVAAMARGAKKPS-SRLSAVTQ
RECO_LISIN      ---------MEKCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTK-SRLAAVTQ
RECO_LISW6      ---------MEKCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTK-SRLAAVTQ
RECO_LISMO      ---------MEKCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTK-SRLAAVTQ
RECO_LISMF      ---------MEKCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTK-SRLAAVTQ
RECO_BACSK      --------MLKKQDAIVLKSIDYGETNKIVTLFTKEDGKLAVLAKGAKKPN-SRFAAVTQ
RECO_OCEIH      --------MLEKIDGIIIKTKDYGETHKLVTIFSNKIGKFNALAKGAKKPK-SRMAAVTQ
RECO_EXIS2      --------MIDKAEGLVLRTVVYGESNKIITLLTREYGKLAVMARGAKKPG-SRFNAASQ
RECO_STAAM      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAA1      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAN      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAT      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAE      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAC      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAA3      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAB      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAW      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAS      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAAR      --------MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVK-TGLQAQTQ
RECO_STAEQ      --------MLMKQKGIIIKSVDYGESDKIITILNEYGAKIPLMARRAKKVK-SGLQANTQ
RECO_STAES      --------MLMKQKGIIIKSVDYGESDKIITILNEYGAKIPLMARRAKKVK-SGLQANTQ
RECO_STAHJ      --------MLEKQKGIIIKSVDYGESDKIITILNEHGAKIPLMVRRAKKSK-TGLQAHTQ
RECO_STAS1      --------MLIKQKGIIIKTIDYGESDKIITILNEYGAKVPLMVRRAKKSK-SGLQANTQ
RECO_STRSV      ------MLKSLTSQGLVLYNRNFREDDKLVKIFTEQAGKRMFFVKHAGK---SKLAPVIQ
RECO_STRGC      ------MMQSITSKALVLYNRNFREDDKLVKIFTEQAGKRMFFVKHATN---SKLSPVIQ
RECO_STRPI      ------MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQ---SKLAPVIQ
RECO_STRPN      ------MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQ---SKLAPVIQ
RECO_STRPS      ------MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQ---SKLAPVIQ
RECO_STRP4      ------MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKCMFFVKHAGQ---SKLAPVIQ
RECO_STRP2      ------MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQ---SKLAPVIQ
RECO_STRR6      ------MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQ---SKLAPVIQ
RECO_STRPD      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRPG      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRP6      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRPC      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRPB      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRP1      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRP3      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRPZ      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRPM      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRP8      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STRPF      -------MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISR---SKMSSIIQ
RECO_STREM      -------MRIQRSLGIVLYNKNYREDDKLVKIFTEAAGKRMFFVKHIGR---SKLAPVVQ
RECO_STRS2      -------MERIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASK---SKLVASIQ
RECO_STRSY      -------MERIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASK---SKLVASIQ
RECO_STRMU      -------MQTKETRGLVLYNRPFREDDKLVKIFTETSGKHMFFVRHATN---SKLSSVIQ
RECO_STRA5      -------MRVSQTYGLVLYNRNYREDDKLVKIFTETEGKRMFFVKHASK---SKFNAVLQ
RECO_STRA3      -------MRVSQTYGLVLYNRNYREDDKLVKIFTETEGKRMFFVKHASK---SKFNAVLQ
RECO_STRA1      -------MRVSQTYGLVLYNRNYREDDKLVKIFTETEGKRMFFVKHASK---SKFNAVLQ
RECO_STRT2      -------MQKLESRGFILFNRNYRENDKLVKIFTKQAGKRMFFVRGGGS---GKLSAVIQ
RECO_STRT1      -------MQKLESRGFILFNRNYRENDKLVKIFTKQAGKRMFFVRGGGS---GKLSAVIQ
RECO_STRTD      -------MQKLESRGVILFNRNYRENDKLVKIFTKQAGKRMFFVRGGGS---GKLSAVIQ
RECO_LACLS      -------MRDAETQGLVLYSRNYKEKDKLVKIFTESFGKRMFFVKNFGK---SSYASSLQ
RECO_LACLM      -------MRDAETQGLVLYSRNYKEKDKLVKIFTESFGKRMFFVKNFGK---SPYASSLQ
RECO_LACLA      -------MRDAETQGLVLYSRNYKEKDKLVKIFTESFGKRMFFVKNFGK---SPYASSLQ
RECO_ENTFA      -------MALGETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKN-NPLLPAIL
RECO_LACBA      -----MARNVTDFHGILLFRRDYAERDFLIKFFTQEFGKKMFLVRGAKKRG-FKMVADIL
RECO_LACPL      --------MVTNFNGILLFRRDYRERDMLIKFLTAEYGKKMFFIRGARRRG-FKMAAELL
RECO_LACSS      ----MAEHRFEDFNGLVMYRKNYKEKDMLVKILTDRFGKKMFYLRGANKPK-FRLSAAIL
RECO_LACRD      -----MARVTTQFTGIIMYRQDYRERDLLVKMLTDKIGPAMFFVKNAKKRG-FRMTADIL
RECO_LACRJ      -----MARVTTQFTGIIMYRQDYRERDLLVKMLTDKIGPAMFFVKNAKKRG-FRMTADIL
RECO_LACF3      -----MARVNEPFEGVIMYRRDYRERDLLVKILTDRRGPLMFFVRGAKRKG-FKLASDIL
RECO_LACS1      -----MIYKNVEFSAIVTKRKNYRERDMLVTMFTDKYGFKTFFVRGVRKRG-FKLGAAIL
RECO_PEDPA      ----MNTVANADFNGIVMFERSHRENDLLVKFLTKEHGKRMFFIRNAKKVD-FKLRSAIL
RECO_LEUMM      ---------MAIIRGIVLYTRQYKDNDLLVRILTETYGMRTFLARGAKKAT-SKLSAGTQ
RECO_LEUCK      ---------MTVINGIILSTRQYKDNDLLVRILTETGGLRTFLARGAKKPK-SALGSALQ
RECO_OENOB      --------MVDKISGIVISVRDYSENDSLIKIISPTIGINTYLARGSKKTK-SSLKIATQ
RECO_LACAC      -----MARELKEVQGIIFKRQKYKEADLLAKIITKQSGIITLIVKGAMRPK-SKLSAATL
RECO_LACH4      -----MARELKEVQGIIFKRQKYKEADLLAKIMTKQDGIITLIVKGALRPK-SQLSAATL
RECO_LACJO      -----MARELCEVQGLIFKRKKYKEADVLTKIMTKDHGIFTIDVRGALRPK-SRLGAATL
RECO_LACGA      -----MVRELCEVQGLIFKRKKYKEADILTKIMTKDHGIFTIDVRGALRPK-SRLGAATL
RECO_LACDB      -----MAADLLDVHGLLFKRQQYKEADLLAKLWTKELGIVTVIAKGGMRPK-SQLAAAVL
RECO_LACDA      -----MAADLLDVHGLLFKRQQYKEADLLAKLWTKELGIVTVIAKGGMRPK-SQLAAAVL
RECO_CLOPS      ----------------------------MLWIFTEKMGKITAIAKGAKKSK-SKLFSLTH
RECO_CLOP1      ----------------------------MLWIFTEKMGKITAIAKGAKKSK-SKLFSLTH
RECO_CLOPE      -------MALIESGGVIIKAQDYKENDKLLWIFTEKMGKITAIAKGAKKSK-SKLFSLTH
RECO_CLONN      --MGDGFLSIFKTKALILKTQDYKENDKLVWLFTEKIGKVCAIAKGAKKSK-SKFIASTQ
RECO_CLOK5      --MGDDFLAIFKTRAIIIKTQDIKESDKLVWLFTEKLGKISTIAKGSKKSR-SPLFSTTL
RECO_CLOAB      -------MALFKSRGVVLKSQDINENDKIIWIFTEKMGKISVIARGAKKNR-SKYLPITI
RECO_ALKMQ      --------MLIKTEGFVLRNRKYGETDSMLVIFTKKVGKINAIAKGARRTK-SALLAGVQ
RECO_ALKOO      --------MLITTEGFILKNRKFGETDSILTIFTRKAGKITAIAKGARRPK-SNLLAGIQ
RECO_CLOD6      -------MIILNTQGIVLKAIRYKESDIILTLFTRKLGKVSAIAKGAKKNK-SSLLSSSQ
RECO_HUNT2      -------MNYLKTSGIVIKEVNTGEADRIITIFSKNKGKISALAKGARRPK-SHLVAGTQ
RECO_CALS8      -------MKFIKAKGIVLKDVNFEESSKILTIFTSELGKIQALSKNCRRTL-SPLGAVSQ
RECO_THEPX      -------MRLLKTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSK-SRFVNAIR
RECO_THEP3      -------MGLLKTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSK-SRFVNAIR
RECO_CALS4      -------MRFLKTEAIVLKSNLISEKDKIATLFTRDYGKLQAVAKGARRSK-SRFVNAVR
RECO_NOSS1      ------MNKTYKATGINLKAQAMGESDRIVTILTQEFGLIRAIAPGSRKHN-SSLGGRSA
RECO_TRIV2      ------MNKTYKATGINLKAQAMGESDRIVTILTQEFGLIRAIAPGSRKYN-SSLGGRSG
RECO_NOSP7      ------MSRTYKASGINLKTQVLGESDKIVTILTPEFGLIRAVAPGARKHN-SSLGGRSG
RECO_TRIEI      ------MAKLYKATGINLKAMALGESDRLLTILTPEYGLIRVVAPGVRKQK-SKLGGRGE
RECO_GLOC7      ------MSKTYQATGIILKGMPLGEADRLVTILTSEYGLIQAVVPGARKHK-SRLRGRSE
RECO_RIPO1      ------MSRTYKATGIILKGMPIGEADRLVTILSPEWGLIRAVVPGARKSK-SRLRGRSE
RECO_SYNY3      ------MSRTYQTLGIVVKGMAFGESDRLVTIFSPEYGLIRAIAPGARKPK-SSLRGRTE
RECO_ACAM1      ------MSRTYKATGINLKSMPFGEADRLLTILTREQGLVRAVAPGCRKPK-SKLGGRSA
RECO_SYNP6      ------MSRTYTTTAIVLKATPLGEADRLLTLLSPDQGLLRVVATGARKPR-SKLGGRTA
RECO_SYNE7      ------MSRTYTTTAIVLKATPLGEADRLLTLLSPDQGLLRVVATGARKPR-SKLGGRTA
RECO_THEEB      ------MGRTYRTIGINLKAMPLGESDRLLSVFSRDRGLLKLVAPHSRGSR-SRLGGRVD
RECO_SYNJB      -----MSGRTYRVTGINLKGIPLGEADRIVTILTREQGLIRAVAKGSRKQP-SKLGGRME
RECO_SYNJA      -----MSGVTYRVTGINLKAMPLGEADRIITILTREQGLIRAVAKGSRKQL-SKWGGRME
RECO_GLOVI      -----MSGKTYRATGINLRRMPLGESDLLMTILTRENGLVRAVARGARKAN-ARIGGRTE
RECO_NOCFA      -------MRLYRDEAVVVRQHKLGEADRIVTLLTRQHGLVRAVAKGVRRTR-SRFGARLE
RECO_RHOJR      -------MRLYRDNAVVLRQHKLGEADRIVTLLTRQHGLVRAVAKGVRRTK-SKFGARLE
RECO_MYCSK      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCSS      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCSJ      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCS2      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCGI      -------MRLYRDRAVVLRQHKLGEADRIVSLLTREHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCA9      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRQHGLVRAVAKGVRRTR-SKFGSRLE
RECO_MYCMM      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGSRLE
RECO_MYCUA      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGSRLE
RECO_MYCTA      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCTU      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCBP      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCBO      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCPA      -------MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_MYCLE      -------MRLYRDWALVLRQHNLGEADRIVTLLTRDHGLVRAVAKGVRRTR-SKFGARLE
RECO_SACEN      -------MSLYRDSAVVLRVQKLGEADRIITLLTRRYGKVRAVAKGVRRTT-SRFGARVE
RECO_STRCO      -------MSLFRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTK-SKFGARLE
RECO_STRAW      -------MSLFRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTK-SKFGARLE
RECO_STRGG      -------MSLFRDDGIVLRTQKLGEADRIITILTRGHGRVRAVARGVRRTK-SKFGARLE
RECO_THEFY      -------MSLYRDEGIVLRTQDLGEADRIVTLLTRRTGLVRAVGKGVRRTR-SRFGARLE
RECO_NOCSJ      --------MLYRDEAIVLRTHKLGEADRIVTLLTRQRGRVRAVAKGVRRTT-SRFGSRLE
RECO_FRACC      -------MPVYRDEGVVLRTAPLAEADRIITVLTRRTGRVRAVAKGVRKTS-SRFGSRLE
RECO_LEIXX      -------MPVYRDEAVVLRTHKLGEADRIVTMLSRQHGKIRAVAKGVRRTA-SRFGSRLE
RECO_CUTAK      -------MPTYRDQAVVLRTHKLGEADRIVSMLSREHGKIRAVARGIRRTS-SKFGARLD
RECO_BIFLO      -------MSLYRDEGVVLRTSKLGEADRIITILTRGHGKIRAVAKGVRRTK-SRFGARLE
RECO_BIFLD      -------MSLYRDEGVVLRTSKLGEADRIITILTRGHGKIRAVAKGVRRTK-SRFGARLE
RECO_BIFAA      -------MPLYQDEGVVLRTAKLGEADRILTLLTRDHGKVRAVAKGVRRTK-SRFGGRLE
RECO_RUBXD      -------MALYRSRGIVLRSIRYGEADRILDIYTRDAGLVSCIAKGIRRTR-SRFGARLE
RECO_PELTS      -------MKLYKADAIVLRARDCGEGDKILTLYSREHGRIKAMAHGVSKPT-SRKRGAVQ
RECO_DESAP      -------MKQYQTEAIVLRASAVREADRTLVLLTRDRGKLRVWAHGAARPT-SRKRGAVQ
RECO_DESRM      -------MKIYKLDAIVLKSRDMREADKILTVYSIQRGKQRIVAHGAAKPN-SRKRGAVQ
RECO_MOOTA      ------MPGLFQAEGIVLKSRDYQETDQLLTILTRTHGKLEAIVKGVRKPR-SSLRSGTQ
RECO_SYMTH      -------MALYNVDGIVIRVRNFQDADKIVVLLTREEGKVEAVARGARRPR-NRFAAATQ
RECO_DESHY      -------MGVYHADALVIRSREYGESDRLLTLFSREYGKIQAVAKGVRKPK-SRQRAGAQ
RECO_HELMI      -------MRLYRAQALVLRSRSYGEADRLLTLLTRERGKLSAIAKGVRKPT-SRLRAGTQ
RECO_HERA2      -----MRDRLYTTEALIIRRSDVGEADRILTIYTPHHGKLSVTARGVRKMT-SKLAGHLE
RECO_ROSS1      -----MRDRVYRTEAIIIRRSDAGEADRLVTILTPL-GRQRVVARGARKLH-SRLAGHIE
RECO_DEHMC      ----MTKPHDFKTKAIIVRKTKCGEADRILSLLTPDLGLIQGFAKSVRKTK-SKLSGHLE
RECO_DEHMB      ----MTKPHDFKTKAIIVRKTKCGEADRILSLLTPDLGLIQGFAKSVRKTT-SKLSGHLE
RECO_DEHM1      ----MTKPHDFKTRAIIVRKTKCGEADRILSLLTPDLGLIQGFAKSVRKTK-SKLSGHLE
RECO_ANASK      -------MDRVKLTGVVLRAVDYGESDRVVTLLTAERGKVSAFARGARASR-RRFGGALE
RECO_ANADE      -------MDRVKLTGVVLRAVDYGESDRVVTLLTAERGKVSAFARGARASR-RRFGGALE
RECO_ANADF      ------MTERLKLTGLVLRAVDYGESDRVVTLLTRERGKVSGFARGARASR-RRFGGALE
RECO_MYXXD      -------MERYDDDALVLSSVDYGESDRLVTLLTREHGKLTAFAAGARKSK-RRFAGALE
RECO_GEOMG      -------MESTRTEAIVLAAMDYRESDRIVTLFTLQYGKVRGVAKGAKRSA-RRFGPALE
RECO_GEOSL      -------MHPIRCEAVVLATMDYRESDRIVTLFTLCHGKVRGLARGARKSM-RRFGGALE
RECO_GEOUR      -------MQNIQCEAIVLGVMDYGEADKIVTLFTLEHGKLKGLARSAKKSR-KRFGGALE
RECO_PELPD      -------MHPEKLQAYVLSTLDYGDSDRIVALFTLEHGRIKAFARRARNSR-RRFGAALE
RECO_DESAL      -------MPPVTTSAVILRSIEYGDFDLIVTFFTQAQGKRAALAKNARKSF-KRFGGALE
RECO_DESOH      -------MPGFSSPAIILRRTAYAEYDTILDLLTLERGRITAMAKNARKSK-KRFAGILE
RECO_PROA2      --------MLVKTRGVILKEIKFRDQSKICPVFTEHFGKISVILKGVRNPK-NKLSGVFS
RECO_CHLPB      --------MLTKTRAVVLKEVKFREQSKICSLYTRDFGRISVILKGGRNLK-SRLSGLFC
RECO_CHLL2      --------MIVKTRAVVLREIKYRDQSKICTLFTSEFGKLTAILKGGRNPK-SRLSGKFS
RECO_CHLPD      --------MIVKTRAIVLREIRYRDQSKICSLFTREFGLLSVIIKGGRNPK-SKLAGRFI
RECO_PELPB      --------MIVKTRAVILREIKYRDQSKICSIYTREFGKMSIIIKGARNPK-NRLSGLFS
RECO_CHLP8      --------MIVKTRAVVLRDIKYRDQSKICLLLTREYGQVSVILKGGRSAK-SKTGMLFS
RECO_PELCD      -------MENCSSDAVVLHHFDYGEADRIVTLFSLEKGLIKGIARQARKSR-KRFGAALE
RECO_SYNWW      --------MYLRSRAIVIKNMDYRESDKLVTIFCEHEGKMKAVARGIKKPR-SSLRACVQ
RECO_SYNAS      ----MNTRATHKTEGFVLKTLSYSDSDLIVTFYTRNFGKLTAIARGARKSR-KRFVNVLE
RECO_SYNFM      -------MKTTRTEAIILNTRDHGESDRLVGLYTRSGGRLQGIAKGARRSR-KRFANTLE
RECO_CARHZ      -------MKFYLDEGIVLKGSDFGDGHRMLTIITKELGKIKAVAYGAKKVK-SKKRGALL
RECO_KORVE      --------MLKQSEAIVLRTYPMREADLLVTLFTRAEGKIKGVAKAAKKSR-RRFGGALE
RECO_RHOBA      -------------MAIVLRTVDFSETSLIVTLLTKDLGRISALAKGARRLK-GPFEGSLD
RECO_SALRD      ----MAQRSIVRTKAVVLRSIDYGETSQIVTLFTQEKGKLGVMAKGARRPK-SSFGATLQ
RECO_SYNSC      -------MAERRLTGLALKVGPLGEHDRLLSLLSNAEGVSRFAVPGARRPR--SSLAAAA
                                                                            

RECO_ECOL6      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SHIDS      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOUT      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOLI      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOLC      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECO5E      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECO45      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOK1      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECODH      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECO57      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOL5      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SHIFL      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SHIF8      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECO24      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOSM      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECO7I      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECO8A      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOHS      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOSE      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ESCF3      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SHISS      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_ECOLU      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SHIBS      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SHIB3      PFTPLLLRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALEP      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALG2      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALDC      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALA4      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALPB      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALTI      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALNS      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALCH      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALTY      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALHS      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALPK      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALPA      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_SALSV      PFTPLLLRYS----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYINELLSRV
RECO_KLEP7      PFTPLLVRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYVNELISRV
RECO_KLEP3      PFTPLLVRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYVNELISRV
RECO_ENT38      PFTPLLVRFG----------GRGEVKTLRSAEA--VSLALPLSGITLYSGLYVNELISRV
RECO_CROS8      PFTPLLVRWS----------GRGDVKNLTSAEA--VSLALPLSGITLYSGLYVNELVARV
RECO_ERWT9      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGTTLYCGLYVNELLSRV
RECO_YERPB      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERPN      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERPS      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERPA      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERPE      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERP3      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERPG      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERPY      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERPP      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLSGSMLYSGLYVNELLSRV
RECO_YERE8      PFTPLLVRWT----------GRGEVKTLRSAEP--VSLALPLTGSMLYSGLYVNELLSRV
RECO_PROMH      PFTPLLIRWS----------GRGEIKTLRDAEP--ISLALPLTGTVLYSGLYLNELLSRV
RECO_PHOLL      PFTPLLVRWS----------GRGAIKTLRDADP--ISLALPLTGSVLYSGLYINELLSRV
RECO_PECAS      PFTPLLVRWS----------GRGEVKTLRSAEP--VSLALPLTGSMLYSGLYVNELLARV
RECO_SERP5      PFTPLLVRWG----------GRGEVKTLRSAEA--VSLGLPLSGMMLYSGLYVNELLSRV
RECO_SODGM      PFTPLLARWS----------GRGEVKTLRSAEP--VSLGLPLSGLMLYSGLYINELLSRV
RECO_VIBCH      PFTPLLLKWS----------GNGSMKTLRQAEP--ISLGLPLSGVYLYSAMYINELVDRV
RECO_VIBC3      PFTPLLLKWS----------GNGSMKTLRQAEP--ISLGLPLSGVYLYSAMYINELVDRV
RECO_VIBVY      PFTPLLLKWS----------GKGAMKTLRQAEP--ISLGLPLTGINLYSALYVNELIGRV
RECO_VIBVU      PFTPLLLKWS----------GKGAMKTLRQAEP--ISLGLPLTGINLYSALYVNELIGRV
RECO_VIBPA      PFTPLLLKWS----------GKGSMKTLRQAEP--ISLGLPLFGINLYSAMYVNELVGRV
RECO_ALIF1      AFTPLLMKWS----------GKGSMRTLRQAET--ISLGIPLTGINLYSAMYINELLVRV
RECO_ALIFM      AFTPLLMKWS----------GKGSMRTLRQAET--ISLGIPLTGINLYSAMYINELLVRV
RECO_ALISL      AFTPLLMKWS----------GKGSMRTLRQAET--ISLAIPLTGINLYSALYINELVVRV
RECO_PHOPR      PFTPLFMKWT----------GRGSMKTLTHAEP--ISISLPMRGYILYSAFYLNEVLVRV
RECO_ACTP2      PFTPLLLRWS----------GKGDLKTLTKAEP--ASLTLPMQTLALYSGFYVNEVLARV
RECO_ACTPJ      PFTPLLLRWS----------GKGDLKTLTKAEP--ASLTLPMQTLALYSGFYVNEVLARV
RECO_ACTP7      PFTPLLLRWS----------GKGDLKTLTKAEP--ASLTLPMQTLALYSGFYVNEVLARV
RECO_HAEDU      PFTPLLLRWS----------GKGDLKVLTKAEP--AALTLPMHHTALYSGLYVNEILIRV
RECO_HAEI8      PFTPLLLRWT----------GKSTLKTLTKAEP--AAITLPLQQIALYSGFYVNELLTRV
RECO_HAEIE      PFTPLLLRWT----------GKSTLKTLTKAEP--AAITLPLQQITLYSGFYVNELLTRV
RECO_HAEIG      PFTPLLLRWT----------GKSTLKTLAKAEP--AAITLPLQQIALYSGFYVNELLTRV
RECO_HAEIN      PFTPLLLRWT----------GKSTLKTLTKAEP--AAITLPLQQIALYSGFYVNELLTRV
RECO_MANSM      PFTPLLLRWT----------GKSSLKILTKAEP--AAIALPLQQTALFSGFYVNELITRV
RECO_ACTSZ      PFTPLLLRWS----------GKGALKTLTKAEP--AAIALPLQQTALFSGFYVNELLCRV
RECO_PASMU      PFTPLLLRWS----------GRSELKTLTKVEP--AAIALPLQQTALYSGFYVNELLCRV
RECO_PSYIN      PFTLLQVSYF----------GRGSLKTVKSFEA--QTQVVPLVGQRLFLAMYINELLYRL
RECO_IDILO      PFMPLLAEFQ----------GRSDLKTLTLLEPQQTTQKLLLQGDKLYSGFYLNELIQRL
RECO_PSEA6      PFQPLLIGVS----------GRSELKNLQQVES--TGAMIRLAGQALYCALYLNEVLNRV
RECO_HAHCH      PFTELEVELG----------GRGELKSLIRYET--TNIRYPLAGAALYAGLYLNELLVKL
RECO_MARHV      PFQPLLVDWT----------GKSELKTLVQLEV--RSAPAVSQPRALYSGFYINELVQRV
RECO_CELJU      PFHRLLVNWQ----------GKSELKLITGVET--DHHYLQLQGNALYSGFYLNELLVRL
RECO_PSEA8      PFVPLEAEWR----------GRGELKTVARLES--AGVPNLLNGQALFSGLYLNELLIRL
RECO_PSEAE      PFVPLEAEWR----------GRGELKTVARLES--AGVPNLLNGQALFSGLYLNELLIRL
RECO_PSEAB      PFVPLEAEWR----------GRGELKTVARLES--AGIPNLLNGQALFSGLYLNELLIRL
RECO_PSEA7      PFVPLEAEWR----------GRGELKTVARLES--AGIPNLLSGQALFSGLYLNELLIRL
RECO_PSEU5      PFVSLEVELR----------GKSELKTVARLES--AGPAHWLDGQALFSGMYLNELLIRL
RECO_PSE14      PFVPLEVEFR----------GRGELKNVGRMES--AGVATWMTGEALFSGMYLNELLIRL
RECO_PSEU2      PFVPLEVEFR----------GRGELKNVGRMES--AGVATWMTGEALFSGMYLNELLIRL
RECO_PSESM      PFVPLEVEFR----------GRGELKNVGRMES--AGVATWMTGEALFSGMYLNELLIRL
RECO_PSEPF      PFVPLEVEFR----------GKGELKNVGRMES--VGNATWMVGEALFSGLYLNELLIRL
RECO_PSEF5      PFVPLEVEFR----------GRGELKNVGRMES--AGIAAWLNGEALFSGLYLNELLIRL
RECO_PSEP1      PFVLLELELR----------GRGELKNVGRMDS--SGIAAWLHGDALFSGLYLNELLMRL
RECO_PSEPK      PFVSLEVELR----------GRGELKNVSRMDS--TGIAAWLHGDALFSGLYLNELLMRL
RECO_PSEPG      PFVPLEVELR----------GRGELKNVGGMDS--AGTAAWLHGDALFSGLYLNELLMRL
RECO_PSEE4      PFVPLEVELR----------GRGELKNVGRLDS--TGIAAWLHGDALFSGLYLNELLMRL
RECO_PSEPW      PFVPLEVELR----------GRSELKNVGRLDS--MGIAAWLHGDALFSGLYLNELLMRL
RECO_CUPMC      HFHPIALSWT----------GRGEVKTLTKAEYV--GGMLPLSGDALLSGFYLNELLLRF
RECO_CUPPJ      HFHPISLSWS----------GRGEVKTLTRAEWV--GGMPPLAGDALLSAFYLNELLMRF
RECO_BURPS      TFQPLSLSWS----------GKSELRTLTGAEWV--GGMLPLAGDALLCGFYANELLVKF
RECO_BURP1      TFQPLSLSWS----------GKSELRTLTGAEWV--GGMLPLAGDALLCGFYANELLVKF
RECO_BURMA      TFQPLSLSWS----------GKSELRTLTGAEWV--GGMLPLAGDALLCGFYANELLVKF
RECO_BURTA      TFQPLSLSWS----------GKSELRTLTGAEWV--GGMLPLAGDALLCGFYANELLVKF
RECO_BURCA      TFQPLLLSWS----------GKSEVRTLTGAEWV--GGMLPLGGDGLLCGFYANELLVKF
RECO_BURL3      TFQPLLLSWS----------GKSEVRTLTGAEWV--GGMLPLGGDGLLCGFYANELLVKF
RECO_PARXL      TFQPLALSWS----------GKSEVRTLTGAEWV--GGMLPLTGGALLCGFYVNELLVKF
RECO_NITMU      AFQPLLLSWG----------GKSELRTLHKAEWQ--GGQLPLQGTALICGFYLNELLIRL
RECO_AZOSB      AFQPLLMDWS----------GGGEVRTLVRAEWQ--GGQPLLTGQALLCGYYLNELLVKL
RECO_AROAE      AFQPLLMDWS----------GGGEVKTLVRAEWR--GGQPLLTGRALMCGYYLNELLVRL
RECO_DECAR      AFQPLEIAWA----------GKGEVLTLMKAEWQ--GGLPLLAGEALFCGYYLNELLMHL
RECO_THIDA      PFSPLLLSWF----------GKADLKTLHAAEWQ--GGLVAPQGRALMCGFYLNELLLRL
RECO_POLSJ      PLQPLHIAFG----------GDAEIRTLKSAEWQ--GGHVMPTGDALLSGYYLNELLMRL
RECO_POLNA      PLQPLHVAFG----------GDAEIRNLKSAEWQ--GGHVMPSGDALLSGYYLNELLMRL
RECO_RHOFT      PLQLLHVAFG----------GDAEIRILKAAEWQ--GGHVMPTGDALMSGLYLNELLLTL
RECO_ACIAC      PLQPLRITYTLNG------EGREEVHGLKGAEWV--GGHVMPTGDALLSGLYLNELLMRL
RECO_ACISJ      PLQPLRVTYTLGG------EGHGEIHALKGAEWA--GGHVMPTGDALLSGLYLNELLLRL
RECO_VEREI      PLQPLWLSYALAA------DGNADIHTLKGAEWV--GGHVMPTGDALLSGLYLNELLLRL
RECO_DELAS      PLQPLSLSYSLGG------EGNAEIHTLKGAEWV--GGHVMPQGDALMSGLYLNELLMRL
RECO_NEIMB      PFVPVSVSWY----------GSQELKTLHRAEWV--GGWRQPQGRALFGGLYVNELVLKL
RECO_NEIMA      PFVLVSASWY----------GSQELKTLHRAEWI--GGWPQPQGRALFSGLYVNELMLKL
RECO_NEIG1      PFVPASVSWY----------GSQELKTLHRAEWM--GGWRQPQGRALFSGLYVNELVLKL
RECO_NEIG2      PFVPASVSWY----------GSQELKTLHRAEWM--GGWRQPQGRALFSGLYVNELVLKL
RECO_NEIMF      PFVPVSASWY----------GSQELKTLHRAEWI--GGWPQPQGRALFSGLYVNELMLKL
RECO_CHRVO      PFQPLTLSWF----------GKGELRTLHAADWD--GGVRALTGLPLVCGFYLNELMMKL
RECO_COXBN      LFSPLLISWS----------GRSDLKFLGDVEAN--GMPYLLEGEALLCGFYLNELLIRL
RECO_COXBU      LFSPLLISWS----------GRSDLKFLGDVEAN--GMPYLLEGEALLCGFYLNELLIRL
RECO_COXB1      LFSPLLISWS----------GRSDLKFLGDVEAN--GMPYLLEGEALLCGFYLNELLIRL
RECO_COXB2      LFSPLLISWS----------GRSDLKFLGDVEAN--GMPYLLEGEALLCGFYLNELLIRL
RECO_COXBR      LFSPLLISWS----------GRSDLKFLGDVEAN--GMPYLLEGEALLCGFYLNELLIRL
RECO_NITOC      PFCPLLLSWT----------GRGDLVTLTGAEAA--GPIPVLTGEGLICAFYLNELLLRL
RECO_METCA      PFVPLLVSWS----------GRGELANLNHAEAA--GIGVRLQHTALFCGFYLNELLMRL
RECO_XYLF2      PLQWIRFSAI----------QRGELGQLRQAEAL--DTAPRLKGETMLASFYINELLLRL
RECO_XYLFT      PLQWIRFSAI----------QRGELGQLRQAEAL--DTAPRLKGETMLASFYINELLLRL
RECO_XYLFM      PLQWIRFSAI----------QRGELGQLRQAEAL--DTAPRLKGETMLASFYINELLLRL
RECO_XYLFA      PLQWIRFSAI----------QRGELGQLRQAEAL--DTAPRLKGEAMLASFYINELLLRL
RECO_XANCB      PLQLIQFTAV----------QRGELAQLRQAEAI--DTAPRLLGEAMLAGFYISELLLRL
RECO_XANC8      PLQLIQFTAV----------QRGELAQLRQAEAI--DTAPRLLGEAMLAGFYISELLLRL
RECO_XANCP      PLQLIQFTAV----------QRGELAQLRQAEAI--DTAPRLLGEAMLAGFYISELLLRL
RECO_XANOP      PLQLIQFSAV----------QRGELAQLRQAEAL--DTAPRLVGDTMLAGFYISELLLRL
RECO_XANOR      PLQLIQFSAV----------QRGELAQLRQAEAL--DTAPRLVGDTMLAGFYISELLLRL
RECO_XANOM      PLQLIQFSAV----------QRGELAQLRQAEAL--DTAPRLVGDTMLAGFYISELLLRL
RECO_XANC5      PLQLIQFSAV----------QRGELAQLRQAEAL--DTAPRLVGDTMLAGFYISELLLRL
RECO_XANAC      PLQLIQFSAV----------QRGELAQLRQAEAL--DTAPRLAGDTMLAGFYIGELLLRL
RECO_STRMK      PLQWIRFSAQ----------QRGELAQLRGAEAL--DAAPRLVGQAMLAGFYLSELTLRL
RECO_STRM5      PLQWIRFSAL----------QRGELAQLRGAEAL--DAAPRLVGQAMLAGFYLSELTLRL
RECO_HALHL      PFIPLQVSWR----------GRGDLKTLTTVDQA--GRGYALRGGALACGFYMAEVLLAL
RECO_ALKEH      PFSPVLASWQ----------GRGELRSLVAAEPD--GARPALAGAALASGFYLNELLLRL
RECO_NITHX      PGNSVSALWRARL------DEHLGAYALEGTRMR--AANLLGASHATYGVTHLASLARL-
RECO_NITWN      PGNSVSALWRARL------DEHLGTYALEGTRMR--AASLLASSHATYGVTHLAALARL-
RECO_RHOP2      PGNSVLAVWRARL------DEHLGYYQLEGTRMR--AATMLASSHAVYGITHLASLARL-
RECO_RHOPS      PGNSVLAVWRARL------DEHLGYYQLEGTRMR--AATMLASSHAVYGVTHLASLARL-
RECO_RHOPB      PGNSVSAVWRARL------DEHLGYYVLEGTRMR--AAMLLASSHAVYGVTHLASLARL-
RECO_RHOPT      PGNSVLASWRARL------DEHLGYYQLEATKMR--AATLLGSSHAVYGVTHLASLARL-
RECO_RHOPA      PGNSVLASWRARL------DEHLGYYQLEATKMR--AATLLGSSHAVYGVTHLASLARL-
RECO_BRADU      PGNSVSAVWRARL------DEHLGTYAVEGLKLR--AATLLASSHGVYGVTHLASIARL-
RECO_RHOP5      PGNSVHAGWRARL------DEHLGYYALEGMRLR--AATLLAVPHAAYGITHLAALARL-
RECO_BRASO      PGNTVRAIWRARL------DEHLGMYAVDGLTLR--AAELMSASHGAYGVTHLASLARL-
RECO_BRASB      PGNTVRAVWRARL------DEHLGMYAIDGLTLR--AAELMSVAHGAYGVTHLAALARL-
RECO_OLICO      PGNSVGAVWRARL------DEHLGYYALEGTRLR--AATMLSYSHAAYGITHLAALARL-
RECO_XANP2      PGNTVSATWRARL------DEHMGNYALEPAVVR--TEVLMRAPHAAFGFTHMAQILHL-
RECO_CHESB      PGNRVDLTWRARL------DEHLGLFQVEPLELN--AARLLNSAVAIYGIQLLAAHLRL-
RECO_RHILO      PGNRVDLLWRARL------DEHLGTFQAEAIEMN--AARLMDSAVAVYGLQTMAAHLRL-
RECO_BRUSU      PGNHVDVSWWARL------DEHMGTFTIEPLSFA--AARLIETPVALYGIQLAAAHLRL-
RECO_BRUA2      PGNHVDVSWWARL------DEHMGTFTIEPLSFA--AARLIETPVALYGIQLAAAHLRL-
RECO_BRUAB      PGNHVDVSWWARL------DEHMGTFTIEPLSFA--AARLIETPVALYGIQLAAAHLRL-
RECO_BRUME      PGNHVDVSWWARL------DEHMGTFTIEPLSFA--AARLIETPVALYGIQLAAAHLRL-
RECO_RHIME      PGNSVEVSWRARL------DEHLGEFRVEPLQLR--AASLIETATSVYGIQALGALLRL-
RECO_SINMW      PGNSVEVVWRARL------DEHLGEFRVEPLQLR--AARLIETATSVYGIQALGSLLRL-
RECO_RHIL3      AGNAVEVIWRARL------DEHLGEFRVEPVTLR--AARLMETATAVYGVQAMGALLRL-
RECO_RHILW      AGNAVEVIWRARL------DEHLGEFRVEPVTLR--AARLMETATAVYGVQAMGALLRL-
RECO_RHIE6      PGNAVEVIWRARL------DEHLGEFRVEPVTLR--AARLMETATAVYGVQAMGALLRL-
RECO_RHIEC      PGNAVEVVWRARL------DEHLGEFRVEPVTLR--AARLMDTATAVYGVQAMGALLRL-
RECO_AGRFC      AGNRVDVIWRARL------HDHLGEFRIEPLQLR--AGQLMETATAVYGVQAMGALLRL-
RECO_METEP      PGNTLRATWRARL------DGALGAYAVEPLTLN--ASRLMDSGLALYGVAHLSALLRL-
RECO_METPB      PGNTLRATWRARL------DGALGSYAVEPLTLN--ASRLMDSGLALYGIGHLSTLLRL-
RECO_BEII9      PGNQADFTWRARL------DQQLGLLAVEPTKLM--TTRLFASGLALQGMNLIAALLRL-
RECO_BARQU      PGNFVEAEWWARL------DEHLGLFRLEALDLY--AARLILLPEALYALQLIVFHLRL-
RECO_BARHE      PGNFVEAEWWARL------DEHLGLFRLEALDLH--AARLILFPEALYALQLIVFHLHL-
RECO_BART1      PGNFVEAEWSARL------EEHLGLFRLEALDFH--AARLICLPEALYALQLIAFHLRL-
RECO_BARBK      PGNFVEAEWWARL------DEHLGLFKLEALDLC--ASRLMFLPEALYGLQLMASHFRL-
RECO_RHORT      PGSLVQATWKARL------EDHLGSLVVELLAGV--AGGLLDDRDRLAALAAACALAETV
RECO_RHOCS      PGNRVAARWAARL------VEQLGTLALELERAT--AAGLLEDPLRLAALSSACALVDAA
RECO_CAUVC      PGARVIVRYRAKV------EGQLGSATLEPMGEG--PSSLFDDRLALAGLSAAAAVAAAA
RECO_CAUSK      AGAKVIARYRARM------SDQMGAATLEPMGEG--PSSLFDEPLALSGLSAAASVAAGA
RECO_ROSDO      PGAQLDLTWRARL------EDHIGSFLVEPVRSR--AAAAMGDRLALAGLNAVTALLGFC
RECO_RUEPO      PGAQLDLSWRARL------EDHLGSFTVEPLRSR--AAAAMSGRLALAGLNAVVSLLSFC
RECO_RUEST      PGAQLDLTWSARL------EDHLGTYKAEPLRSR--AGMALSGRLALAGLNAVCALLAFA
RECO_RHOS1      PGAQLDLTWKARL------DEHMGAFTVEPLRSR--TAL-LGDRLGLAGLNAICAMLHVT
RECO_RHOS4      PGAQLDLTWKARL------DEHMGAFTVEPLRSR--TAL-LGDRLGLAGLNAICAMLHVT
RECO_RHOS5      PGAQLDLTWKARL------DDHMGAFTVEPLRAR--TGI-FGDRLALAGLNAICAMLHVV
RECO_JANSC      VGAQLDATWRARL------SDHIGSYTVELVKGR--AAEVMEDRVALAGLSSVCALLSFS
RECO_GLUDA      PGNLIRASWRGRL------PDQLGNLSGELVHGS--AARLMSAPLALAMLASACAVADGT
RECO_GRABC      PGNLVMARWTARL------ADQLGSLTAELIHPA--AALAMDDPLNLAVLRSLCTVAEGA
RECO_CHLTB      PISFSLFTIQ---------QSPPKMRKVIQGELQNPFTTIKSSYPLLQSAGKMIQAILKT
RECO_CHLT2      PISFSLFTIQ---------QSPPKMRKVIQGELQNPFTTIKSSYPLLQSAGKMIQAILKT
RECO_CHLTR      PISFSLFTIQ---------QSPPKMRKVIQGELQNPFTTIKSSYPLLQSAGKMIQAILKT
RECO_CHLTA      PISFSLFTIQ---------QSPPKMRKVIQGELQNPFTTIKSSYPLLQSAGKMIQAILKT
RECO_CHLMU      PISFSLFTIQ---------HTPPKMRKVLQGELKNPFTTIKNSYRLLQSTGKMIQAILKT
RECO_CHLPN      PISLGKYTLH---------RNGSRLPKLTHGDILNAFEAIKQTYALLEASGKMIQALLAS
RECO_BACSU      PFLYGSFLMQK---------TSGLGTLQQGEMILSMRG-IREDLFLTAYAAYVAELVDRG
RECO_BACVZ      PFLYGSFLMQR---------TSGLGTLQQGEMILSMRT-IREDLFLTAYAAFIAELTDKG
RECO_BACLD      PFLYASFLFRK---------SSGLGTLEQGEMIESMRN-IREDLFLTAYAAYIAELIDKG
RECO_BACP2      PFLYGTFLIQS---------STGLGTLQQGEMIESMRT-IREDLFLTAYAAYMTELLDKG
RECO_BACC7      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACCZ      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACAN      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACC0      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACHK      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACCR      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACC4      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACC2      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-IREDIFLTAYASFIVELTDKA
RECO_BACC1      LMTHGHFLIQM---------GSGLGTLQQGEIISTMKE-FREDIFLTAYASFIXELTDKQ
RECO_BACMK      LMTHGHFLIQM---------GSGLGTLQQGEIISSMKE-IREDIFLTAYASFIIELTDKA
RECO_BACCN      LMTHGHFLIQM---------GSGLGTLQQGEMISSMKE-IREDIFLTAYASFIVELTDKA
RECO_BACHD      LFTYGMMMFQK---------NAGLGTLTQGEIIQSFRE-VRNDLFRASYVSYVTDLTNKL
RECO_GEOTN      PLAYGHYLIRR---------SRGVGLLHQGELIDSMRV-LREDLFAAAYAAYIVELTDKS
RECO_GEOKA      PLSYGHYVIRR---------SRGVGVLHQGELIDSMRA-LREDLFAAAYAVYIVELTDKS
RECO_LISIN      LFTNGYFTFFG---------GNGLGTLQQGEVIENFSS-IQQDIFMTAYATYVCELLDKA
RECO_LISW6      LFTNGYFTFFG---------GNGLGTLQQGEVIENFSS-IQQDIFMTAYATYVCELLDKA
RECO_LISMO      LFTNGYFTFFG---------GNGLGTLQQGEVIETFSS-IQQDIFMTAYATYVCELLDKA
RECO_LISMF      LFTNGYFTFFG---------SNGLGTLQQGEVIENFSS-IQQDIFMTAYATYVCELLDKA
RECO_BACSK      PFVYGSYLYFQ---------GNGLPSLSQGEAVDSFKE-LQFDIVKSAYAAYITELVDKL
RECO_OCEIH      PFINARFFVYI---------GSGLSTIQQGEVLDSFRI-IREDIFKTAYVSYMAELTDKL
RECO_EXIS2      PFVRAIYVYPR---------SRGLGQLKSADVITGYSK-IRQDVFLMAYAMYLLELADKA
RECO_STAAM      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYASLAAETIERS
RECO_STAA1      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYASLAAETIERS
RECO_STAAN      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYASLAAETIERS
RECO_STAAT      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYAALAAETIERS
RECO_STAAE      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYAALAAETIERS
RECO_STAAC      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYAALAAETIERS
RECO_STAA3      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYAALAAETIERS
RECO_STAAB      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYASLAAETIERS
RECO_STAAW      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLFVSSYASLAAETIERS
RECO_STAAS      LFVYGLFIYNQ---------WRGMGTLNSVDVISQHYK-LQMDLFVSSYASLAAETIERS
RECO_STAAR      LFVYGLFIYNK---------WRGMGTLNSVDVISQHYK-LQMDLYVSSYASLAAETIERS
RECO_STAEQ      LFVYGLFIYNK---------WRGMGTLNSVDVINQHYE-LQLDLFESSYASLCAETIDRS
RECO_STAES      LFVYGLFIYNK---------WRGMGTLNSVDVINQHYE-LQLDLFESSYASLCAETIDRS
RECO_STAHJ      LFVYGLFIYNK---------WKGMGTLSSVDVINQYYD-LRLDIFNSSYATLCTEAIERS
RECO_STAS1      LFVYGLFIYSK---------WKGMGTLSSVDVIDQNYH-LRLDIYESSYASLCTETIDRS
RECO_STRSV      PLTAANLLMKI--------NDDGLSYIEDYQDVVTYHR-INEDLFIMAYASYVAALADAS
RECO_STRGC      PLTLANLLMKV--------NDDGLSYIQDYQDVQPFTR-INSDLFIMAYATYVAALADAS
RECO_STRPI      PLVLARFLLRI--------NDDGLSYIEDYHEVMTFPK-INSDLFVMAYATYVAALADAS
RECO_STRPN      PLVLARFLLRI--------NDDGLSYIEDYHEVMTFPK-INSDLFVMAYATYVAALADAS
RECO_STRPS      PLVLARFLLRI--------NDDGLSYIEDYHEVMTFPK-INSDLFVMAYATYVAALADAS
RECO_STRP4      PLVLARFLLRI--------NDDGLSYIEDYHEVMTFPK-INSDLFVMAYATYVAALADAS
RECO_STRP2      PLVLARFLLRI--------NDDGLSYIEDYHEVMTFPK-INSDLFVMAYATYVAALADAS
RECO_STRR6      PLVLARFLLRI--------NDDGLSYIEDYHEVMTFPK-INSDLFVMAYATYVAALADAS
RECO_STRPD      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRPG      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRP6      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRPC      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRPB      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRP1      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRP3      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRPZ      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRPM      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRP8      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STRPF      PLTIADFIFKL--------NDTGLSYVVDYSNVNTYRY-INNDIFRLAYASYVLALADAA
RECO_STREM      PLTAADFLLKI--------NDSSLSYIEDYNQVEAYRH-INEDFFRLSYASYVLALADAA
RECO_STRS2      PLTYADFIVKI--------NDDGLSYIEDFHQVQPFKN-INGDIFKLSYATYILALADAA
RECO_STRSY      PLTYADFIVKI--------NDDGLSYIEDFHQVQPFKN-INGDIFKLSYATYILALADAA
RECO_STRMU      PLILANFILKI--------NNHGLSYIEDYKGVSLFKE-INADIYKLAYATYLVSLADAA
RECO_STRA5      PLTIAHFILKI--------NDNGLSYIDDYKEVLAFQE-TNSDLFKLSYASYITSLADVA
RECO_STRA3      PLTIAHFILKI--------NDNGLSYIDDYKEVLAFQE-TNSDLFKLSYASYITSLADVA
RECO_STRA1      PLTIAHFILKI--------NDNGLSYIDDYKEVLAFQE-INSDLFKLSYASYITSLADVA
RECO_STRT2      PLNIAEFMMTV--------NDEGLSFIEDYSQAESFKE-ITSDIFKLSYATYLAALTDAA
RECO_STRT1      PLNIAEFMMTV--------NDEGLSFIEDYSQAESFKE-ITSDIFKLSYATYLAALTDAA
RECO_STRTD      PLNIAEFMMTV--------NDEGLSFIEDYSQAESFKE-ITSDIFKLSYATYLAALTDAA
RECO_LACLS      AFTDGKLTATI--------NDGGFSFIEDVSEVVVYKN-ISADIFINAHASYIISLADAA
RECO_LACLM      AFTDGKLTATI--------NDGGFSFIEDVSEVVVYKN-ISADIFINAHASYIISLADAA
RECO_LACLA      AFTDGKLTATI--------NDGGFSFIEDVSEVVVYKN-ISSDIFINAHASYIISLADAA
RECO_ENTFA      PFTEAVYIGNF--------REEGLSFLNSSKEVQPFRN-IQQDIFINAYGTYILNLVDAA
RECO_LACBA      PFTVGSYVGDI--------ADDGLSYIRTARETRQFQD-ISADIFKNAYATYIMSLVDTA
RECO_LACPL      PFTMGEYVGDL--------RDQGLSYINSVKSVQYLEH-ISQDIALNAYATYVMNLMDVA
RECO_LACSS      PFTQAEYGGDI--------RDDGLSFLNNVKSATQFQT-ISQDLFLNAYATYILNLIDVG
RECO_LACRD      PFTHGTYIGSL--------DENGLSFINTASDTSQYKK-IASDISKNAYVTYILALVDSA
RECO_LACRJ      PFTHGTYIGSL--------DENGLSFINTASDTSQYKK-IASDISKNAYVTYILALVDSA
RECO_LACF3      PFTYGSYVGIL--------ADEGLSYIVSAQETHHLTG-IGADLNRNAYATYLLELVDQA
RECO_LACS1      PFTHGTYIGSI--------NSEGLSFITATKGIDQFQS-INQDIILNAYATYILELVKAA
RECO_PEDPA      PFSHGQYTGLI--------RSNGLSYINAALDVQQFEN-IFQDITLNAYATFVLNLVDAA
RECO_LEUMM      PYTIVTFDGALPK------RETGLGYMNDVQDIKVYSR-LIEDIEANAYAALIASLIDAS
RECO_LEUCK      PHAVLSFEGAFPK------NNQGLGYINDIQTIKIYQR-LIDDIEVNAYAALIASLIDQT
RECO_OENOB      LFTYGDFFGKYPK------KN-GLGYLNSSESTSIFKN-ISLDIILNAYASHIAELLAAA
RECO_LACAC      NFSAGTYVIYT--------SGHGLSNLRTYKKVQQFDA-LYRDLTKNAYVSFIFDLIDHA
RECO_LACH4      NFSMGTYVIYT--------SGHGLSNLRTYKEVKQFDG-LYRDLTKNAYTSFIFDLIDHA
RECO_LACJO      NFSYGKYIVNT--------NWKGISTLRTFKDVKQLDQ-LYLDLTKNAYSSYVLDLLDHA
RECO_LACGA      NFSYGKYIVNT--------NWKGISSLRTFKDVKQLDQ-LYLDLTKNAYSSYVLDLLDHA
RECO_LACDB      PFTEGTFSILT--------RYKGISQLRTYKKLSQHDE-LFTDLDKNAYLSYLFDLADHA
RECO_LACDA      PFTEGTFGILT--------RYKGISQLRTYKKLSQHDE-LFTDLDKNAYLSYLFDLADHA
RECO_CLOPS      PLCYGDYLLFK---------GKGLYRLSEGKIRTSFQT-SLTDLEKLTYASYLCELIDIS
RECO_CLOP1      PLCYGDYLLFK---------GKGLYRLSEGKIRTSFQT-SLTDLEKLTYASYLCELIDIS
RECO_CLOPE      PLCYGDYLLFK---------GKGLYRLSEGKIRTSFQT-SLTDLEKLTYASYLCELIDIS
RECO_CLONN      TFCFGEYVLYR---------GKSLYSINEVEIIDSFQS-LLSDMDTITYGSYFCELILIA
RECO_CLOK5      QFCYGDYVVYK---------GKSLYVINESSLIDSFQH-LLNDLNDLTYASYFCELTDIA
RECO_CLOAB      NFCFGNFVFFK---------GKSMFSLNEGEIIDSFQE-FLSDFDTLTYCSYLCELIDIS
RECO_ALKMQ      PFSYSDFVLFK---------GRSLYTVNQTEPKEIFYN-LREDVKRLSYAAYLLELVESV
RECO_ALKOO      PFCYSEFVLYK---------GKNMYTVSQCEAKEIFYP-LREDLKRLSYASYLVELVEAV
RECO_CLOD6      LFSYSNFTLKK---------QGNMYKVTQSEIIKSFYN-ISYDIEAFSYATYITKLVENS
RECO_HUNT2      LLCYSEFVLFK---------GKDMYTVNSCDVIESFYD-IRNDLERLTYAAHMMDIVNDV
RECO_CALS8      PLIYSEFVFTK---------TKEIYSISSASVIESFFD-ITQNVDLTIYSSYLIELVDSF
RECO_THEPX      PFVVANYVIFE---------GQNYYYIDQWELIEAHKN-IEKDLAKFSVASYIAETINKI
RECO_THEP3      PFIVANYVIFE---------GKNYYYIDQWELIEAHRN-IEKDLVKFSVASYIAETINKI
RECO_CALS4      PFIVANYVIFE---------GQNYYYIDQWELVKNFEN-IEKDLKKFALASYISETISRV
RECO_NOSS1      MFVVNELLIAKGR---------SLDKITQAQTIKTYPG-LAKDLGKLAASQYLAEIVLCQ
RECO_TRIV2      MFVVNELLIAKGR---------SLDKITQAQTIKTYPG-LAKDLGKLAASQYLAEIVLCQ
RECO_NOSP7      MFVVNELLIAKGR---------SLDKITQAQTLKTYPG-LAKDLGKLAASQYLAEIVLSQ
RECO_TRIEI      LFVVNQLLISKGR---------SLDRINQAETITSYTG-LSQNLGKLAAGQYLAELVQQI
RECO_GLOC7      LFVVNQLLIVKGR---------SLDKLIQAETLESYPG-LSRDLGKLTASQYLAELVLSL
RECO_RIPO1      LFVINDLLIAKGR---------SLDKITQADTLESYPK-LSQELGKLASGQYLAELVLCL
RECO_SYNY3      LFVVNQFLLFAGK---------SLDRINQAETQYSYPG-LGQNVCNLAAGQYLIELILAL
RECO_ACAM1      LFVVNDLMLVQGR---------SLDKIAQAETLESYPG-LSQNLAKLTTSQYLAELTLYQ
RECO_SYNP6      LFVVGDCLIACGK---------SLDRLQQVETLTSHTA-LSGDLARLAAAQYLTELVLAQ
RECO_SYNE7      LFVVGDCLIACGK---------SLDRLQQVETLTSHTA-LSGDLARLAAAQYLTELVLAQ
RECO_THEEB      LFVVNDLFISPGR---------NLDRILQAETVATYQG-LHHQLTTLTAAQYLGEVVLYQ
RECO_SYNJB      PFVINDLLMVRGRWSAQTETSQRLQRIVQAETLQTFPR-LSRSLAHLTAAQYLAEVALLL
RECO_SYNJA      PFVVNDLLVARGRWSAQTDPSQCLQRIAQAETLQSFPR-LGRSLAHLTAAQYLAEVALLL
RECO_GLOVI      QFVVNDLQLYRGR---------SLDQLTQAESLRTFPG-LLQDLGRLTAAQYLAEGVLQE
RECO_NOCFA      PFSYIDVQLHP---------GRNLDTVTQVHTVESFAADIIDDYGRYTTACAILETAERL
RECO_RHOJR      PFAHIDVQLYP---------GRNLDIVTQVQTVDAFATDIVDDYSRYTTACAILETAERL
RECO_MYCSK      PFAHIDVQLHP---------GRNLDIVTQVQAIDAFASDIVSDYGRYTSACAVLETAERL
RECO_MYCSS      PFAHIDVQLHP---------GRNLDIVTQVQAIDAFASDIVSDYGRYTSACAVLETAERL
RECO_MYCSJ      PFAHIDVQLHP---------GRNLDIVTQVQAIDAFASDIVSDYGRYTSACAVLETAERL
RECO_MYCS2      PFAHIDVQLHP---------GRNLDIVTQVQAIDAFAADIVSDYGRYTTACAMLETAERL
RECO_MYCGI      PFAHIDVQLHP---------GRNLDIVTQVQAIDAFASDIVSDYGRYTCACAMLETAERI
RECO_MYCA9      PFAHIDVQLHP---------GRNLDIVTQVQAIDAFAADIVSDYGRYTTACAILETAERI
RECO_MYCMM      PFAHIDAQLHP---------GRNLDIVTQVVSIDAFAADIVNDYGRYTCGCAMLETAERL
RECO_MYCUA      PFAHIDAQLHP---------GRNLDIVTQVVSIDAFAADIVNDYGRYTCGCAMLETAERL
RECO_MYCTA      PFAHIEVQLHP---------GRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERL
RECO_MYCTU      PFAHIEVQLHP---------GRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERL
RECO_MYCBP      PFAHIEVQLHP---------GRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERL
RECO_MYCBO      PFAHIEVQLHP---------GRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERL
RECO_MYCPA      PFAHIDAQLHP---------GRNLDIVTQVVSIDAFATDIVSDYGRYTCACAMLETAERL
RECO_MYCLE      PFAYIDAQLHP---------GRNLDIVTQVVSIDAFATDIVSDYGRYTCGCAMLETAERL
RECO_SACEN      PFCHIDVQLYT---------GRTLDVITQVQTLDAFGAHIVDDYQRYTSACAVLETVDRL
RECO_STRCO      PFSHVDVQFFSKGSELV---GRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERF
RECO_STRAW      PFSHVDVQFFSRGSELI---GRGLPLCTQSETIAPYGGAIVTDYARYTAGTAMLETAERF
RECO_STRGG      PFSHVDVQFFARGGELV---GRGLPLCTQSETIAPYGGGIVADYARYTAGTAMLETAERF
RECO_THEFY      PFTHIDVQLHA---------GKSLDVVTQVDTLHAYGSVLVTDYPRYTAGVAMLETAEKV
RECO_NOCSJ      PFTHVDLQLAE---------GRNLDTITQAETLTPFSKGLGLDYDRYTAGTVMLETADRL
RECO_FRACC      PGTYVDLLLHS---------GRALDTVTQADIISPYGATIAVDYPRYTAAAVMLETAERL
RECO_LEIXX      PFMVADVQLYE---------GRSLDVVTQAETIGAYGAAIAEDYASYTAANAMVEAADRL
RECO_CUTAK      PFNLVDLQLVQ---------GRNLDVVAQVECLHPYSAPLRQDYSLFTAAEVMVEAADHL
RECO_BIFLO      PFMRVDVLIAE---------GRSLDVVSQAEAVAAYGAPIAADYAAYEAANVIVETIDKI
RECO_BIFLD      PFMRVDVLIAE---------GRSLDVVSQAEAVAAYGAPIAADYAAYEAANVIVETIDKI
RECO_BIFAA      PFMRVALLIAE---------GRSLDVVSQAESIAAYAGPICADFQAYTAANVICETADKL
RECO_RUBXD      PFSCVDFMAYR---------GRTLDTITQAESLRSFRG-VRERLDRLQAAAGMAGVLHAL
RECO_PELTS      PFTRSRFLLRR---------GRELDTVSQCEGVETFPF-LRESLERIGYASYVAELVEAL
RECO_DESAP      PFCRSRFLLER---------GREIDVVRQAEALEEFPA-LHADLEALALAGYVCELAEGF
RECO_DESRM      PFCFSEFMLHR---------GREIDAISQAELKEGFAE-IRYDLDRLTAAAYITELLDGF
RECO_MOOTA      QLCRSRFLFYA---------GKSLATVTQCEVQEIYGP-LRQDLKRLAYAYYLVEIADGV
RECO_SYMTH      LFSHVRAQLFS---------GRSLDTLSQVEIVESFRQ-LREDLVRMAYATYACELVDAL
RECO_DESHY      LFTYAEYLLHK---------GKSLDTVNQVSPRESFPH-LWTDLDMSMAATAMAELLDLA
RECO_HELMI      PLTHSQLVLYE---------GKNLQTVTQAEPVESFAA-LHGDVVRFSHASSMAELVDRL
RECO_HERA2      LFIHTRLQLAK---------GRSFDVVTESRVVQPFRS-LREDLSRISQGYYVAELLDQM
RECO_ROSS1      LFTHTMLMLAI---------GRNLHIVTQSSPLDRFER-LRTDLERIGAAYYAAELVDRL
RECO_DEHMC      LLCYSEVSLAR---------GKAIDTITGSQTIQSFLN-IRNSLQLSAMAFYACELAYHF
RECO_DEHMB      LLCYSEVSLAR---------GKAIDTITGSQTIQSFLN-IRNSLQLSAMAFYACELAYHF
RECO_DEHM1      LFCYSEVSLAR---------GKAIDTVTGSQTIQSFLN-IRSSLQLSAMAFYVCELAFHF
RECO_ANASK      PFTLLSAEVRE-------RSGSDLLGLDSVSVVRGFGA-LRGDLGRIACAGYAAELAREL
RECO_ANADE      PFTLLSAEVRE-------RSGSDLLGLDSVSVVRGFGA-LRGDLGRIACAGYAAELAREL
RECO_ANADF      PFTLLVAEARE-------RPGSDMLGLESVSVLRAHGG-IRGELARIACAGYAAELSREL
RECO_MYXXD      PFMRLRVHIVE-------TRGS-TVRLDGTDIVAGFYA-AREDLSLIARALYAVELCREL
RECO_GEOMG      PFARIGVELVV-------REG--LSSLRGADIVTLYPG-IRRDLRAIGLAGYAVELVDRY
RECO_GEOSL      PFARLSVELVV-------REG--LSSLRGVDIVTVYPR-IRQDLAAIGHGGYAVELVDRL
RECO_GEOUR      PFARLRLHLAM-------KVG--LSTLNGADIVTIFPH-IRQDLVKIGHAAYACELVERL
RECO_PELPD      IFARIEAHVEI-------KQGG-LSGLRQAEIDCIYPG-IRGDLGRIAYALYACELVDAM
RECO_DESAL      LFSKVSIVYAHG------KKKGGLPLLSESNLEQHFSN-IRMDIHKTALASLWAETIYSW
RECO_DESOH      PFCCLDAVFTDP------SARSGMTILKEAAMTAPFGA-IRLNMEKVAYASYWSEMVNRW
RECO_PROA2      TGNMVELVIYKKQ-------NRDLHLVSDALLLQSPMS-ARPDMERFTTIYQLIETLKQV
RECO_CHLPB      TGSLLEVVLYNRS-------NRDLQLVSEARIIRSPMT-AEPSMERFSAIYRLIEILKIS
RECO_CHLL2      AGNVLDIVLYKKN-------GRDIQLISDGSLLFSPLS-AEPDMERFATMYRIIDLISQA
RECO_CHLPD      AGTVLDIVLYKKT-------TREIQLVSEGNLLFSPMV-PQPDIERYAIMYRIIDLVSQS
RECO_PELPB      AGNVVDLVLYKKS-------SRDIQLATDGNLVLSPMV-PEPDLERFAILYRIIDFVRHT
RECO_CHLP8      PGNLIDAVLYKKG-------NRDLQLASDASLVKSPLS-ETPDLERFSVLYRVLDLVRYA
RECO_PELCD      PFSTVHMRWQS--------RSGRDLVTLQDAELIDLRSGLRHNLLAMALAAYGCELVENL
RECO_SYNWW      PFCHSSLFFSR---------GKGMNLITQGKLLD-FYGNTREDFERSLYALYLMELLDKS
RECO_SYNAS      PFCCSSLLFSR--------KQRDQLAWLESCQVINEFPEIRKSLDRTLLASYLIDLVDHF
RECO_SYNFM      PCSLVELQFRE----------KGTLVWLESCKLLEPFLSLRTELIRWGIAALISEIVIEM
RECO_CARHZ      EFSRTNIYLRQ----------SNDYFIVEQAEGIEYFPNLYGNKDLLHAAGQIAWLTDRF
RECO_KORVE      PLTHVRVYYED--------RERQELTRLDSCDVLASPMSAEVDYPRALALGHVAEVIDDL
RECO_RHOBA      LLSVCAITLID--------KPGDTLDLLTESKLRRRFRGAQRSLERLHAGYYIAEMLRLL
RECO_SALRD      PMAYTQVVFYHK--------PSRTLQTLSESSHVQSFHRLREKLPTITVGLRIVELVDAL
RECO_SYNSC      PLTLLELQVG----------GRSGLARVRQLRVLRSFSGLGQQLETLAAAQALCDLCIQL
                                                                            

RECO_ECOL6      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_SHIDS      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOUT      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOLI      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOLC      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECO5E      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECO45      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOK1      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECODH      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECO57      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOL5      LEYETRFSE--LFFDYLHCIQSLAGVTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_SHIFL      LEYETRFSE--LFFDYLHCIQSLAGDTG--------TPEPALRRFELALLGHLGYGVNFT
RECO_SHIF8      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECO24      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOSM      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECO7I      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECO8A      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOHS      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOSE      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ESCF3      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_SHISS      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_ECOLU      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_SHIBS      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_SHIB3      LEYETRFSE--LFFDYLHCIQSLAGATG--------TPEPALRRFELALLGHLGYGVNFT
RECO_SALEP      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALG2      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALDC      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALA4      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALPB      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALTI      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALNS      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALCH      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALTY      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALHS      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALPK      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALPA      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_SALSV      LEYETRFSE--LFFDYLNCIQALAGTTG--------SPEPALRRFELALLGHLGYGVNFT
RECO_KLEP7      LEHETRFSE--LFFDYLHCIQALAGASG--------SPEPALRRFELALLGHLGYGVDFL
RECO_KLEP3      LEHETRFSE--LFFDYLHCIQALAGTSG--------SPEPALRRFELALLGHLGYGVDFL
RECO_ENT38      LEHETRFSE--LFFDYLHCIQALAGATD--------SPEPALRRFELALLGHLGYGVDFL
RECO_CROS8      LEPETRFSE--LFFDYLHCIQALAGASG--------SPEPALRRFELALLGHLGYGVDFL
RECO_ERWT9      LQHETAFSE--LFFDYLNCIQTLAADPP--------SPEPALRRFELSMLGHLGYGVDFL
RECO_YERPB      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERPN      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERPS      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERPA      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERPE      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERP3      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERPG      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERPY      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERPP      LEHQTSYSA--LFFDYLHCLQALAGSDG--------SPEHALRQFELAMLANLGYGVDFL
RECO_YERE8      LEHQTNYSA--LFFDYLHCLQSLAGSDG--------SPEYALRQFELAILAHLGYGVDFL
RECO_PROMH      LENGTSYST--LFFEYLSCLQILAASET--------TPEAALRRFELALLTQLGYGLDFL
RECO_PHOLL      LEQGTAYPA--LFFDYLQCLQILAASEY--------TPEYALRRFELALLANLGYGVDYL
RECO_PECAS      LEHETNYSA--LFFDYLHCLQHLAAQDA--------SPEPALRRFELALLGYLGYGVDFL
RECO_SERP5      LEQEANYSV--LFFDYLQCLQALAAEDV--------SPEQALRQFELALLNHLGYGLDFL
RECO_SODGM      LDHETDYSK--LFYDYLHCLQWLAGATG--------SPEPALRRFELALLSHLGYGVDFL
RECO_VIBCH      LMPEVASPG--LFHDYLFALTELAQST---------NPEPALRRFELALLAAMGYGVDFL
RECO_VIBC3      LMPEVASPG--LFHDYLFALTELAQST---------NPEPALRRFELALLAAMGYGVDFL
RECO_VIBVY      LMQEVPMPG--LFHDYLFALTELAQAD---------NPEPALRRFELALLAAMGYGVDFL
RECO_VIBVU      LMQEVSMPG--LFHDYLFALTELAQAD---------NPEPALRRFELALLAAMGYGVDFL
RECO_VIBPA      LMAEVPMPA--LFHDYLHALTELAQCE---------NPEPALRRFELALLSSMGYGVDFL
RECO_ALIF1      VEQETPYPA--LFLDYLTALTELAQST---------NPEPALRRFELALLSAMGYGVDFL
RECO_ALIFM      VEQETPYPA--LFLDYLTALTELAQST---------NPEPALRRFELALLSAMGYGVDFL
RECO_ALISL      IEQETPYPA--LFLDYLTALTELAQTK---------NPEPALRRFELALLSSLGYGVDFL
RECO_PHOPR      LENDTPYPV--LFMDYLNALRELAQAD---------NPEPALRRFELALLHHLGYGIDFL
RECO_ACTP2      LENQTAYPE--LFQHYLQCMTRLATQPK--------QIEPILRTFEFQMLKALGYGVNFS
RECO_ACTPJ      LENQTAYPE--LFQHYLQCMTRLATQPE--------QIEPILRTFEFQMLKALGYGVNFS
RECO_ACTP7      LENQTAYPE--LFQHYLQCMTRLATQPE--------QIEPILRTFEFQMLKALGYGVNFS
RECO_HAEDU      LENQTAYTA--LFQHYLQCITQLATQPE--------KLQVTLRTFEFHLLKALGYGVNFS
RECO_HAEI8      IESETPNPA--LFQHYLKCLTGLATETN---------VEPTLRLFEFQLLQMLGYGVDFL
RECO_HAEIE      IESETPNPA--LFQHYLKCLTGLATETN---------VEPTLRLFEFQLLQILGYGVDFL
RECO_HAEIG      IESETPNPA--LFQHYLKCLTGLATETN---------IEPTLRLFEFQLLQILGYGVDFL
RECO_HAEIN      IESETPNPA--LFQHYLKCLTGLATETN---------IEPTLRLFEFQLLQILGYGVDFL
RECO_MANSM      IEPETPNPQ--LFQDYLHCLTSLAVSQN--------FVEPALREFEFKLLNILGYGVDFL
RECO_ACTSZ      IEAETPNGE--LFQDYLHCLTRLASEDG---------VEPALRTFEFQLLTMLGYGVDFT
RECO_PASMU      LEPETGYPH--LFQDYLRCLTGLASAEH--------LIEPSLRHFEFQLLQTLGYGVDFC
RECO_PSYIN      LQAETACDG--LFECYQQTLLAIAGAV---------DPQIALRLFELTLIETLGYGVNFS
RECO_IDILO      VPTEAEAPE--LFESYLSALQNMTNSE---------RVEPALRQFEWQLLQHLGAAFDWH
RECO_PSEA6      LADEIPHPE--IFVLYQQSMHALVAQT---------NFEPVLRSFELGLLDALGYGIDLT
RECO_HAHCH      LQPLEGCRK--VFDAYKSSLTFLSLPQP--------NLEPGIRELEFALLNELGFGVDFC
RECO_MARHV      LPVADPSPA--LFASYIETLQALADLSSQD------DVEPLLRRFERAFAASLGYDFAWD
RECO_CELJU      LPEQDVITG--LFERYEWTLDALHRG---E------PLEPLLREFEFMLLQGLGYALDFL
RECO_PSEA8      LPAEDPQPE--IFAHYAATLPLLAAGRP---------IEPLLRAFEWRLLEQLGYGFALD
RECO_PSEAE      LPAEDPQPE--IFAHYAATLPLLAAGRP---------IEPLLRAFEWRLLEQLGYGFALD
RECO_PSEAB      LPAEDPQPE--IFAHYAATLPLLAAGRP---------IEPLLRAFEWRLLEQLGYGFALD
RECO_PSEA7      LPAEDPQPE--IFAHYAATLPLLAAGRP---------LEPLLRAFEWRLLEQLGYGFALD
RECO_PSEU5      LPAEDAHPA--LFEHYVATLPALAEHRP---------LEPLLRAFEWRLLDELGYGFALD
RECO_PSE14      LPAEDPHPA--VFEHYAATLLALALGRP---------LEPLLRSFEWRLLDDLGYGFAMD
RECO_PSEU2      LPAEDPHPA--VFEHYAATLLALALGRP---------LEPLLRSFEWRLLDDLGYGFAMD
RECO_PSESM      LPAEDPHPA--VFEHYAATLLALALGRP---------LEPLLRSFEWRLLDDLGYGFAMD
RECO_PSEPF      LPAEDPHPA--VFDHYAATLLALAEGRP---------LEPLLRSFEWRLLDDLGYGFSLN
RECO_PSEF5      LPAEDPHPA--VFDHYAATLLALAEGRP---------LEPLLRAFEWRLLDDLGYGFALD
RECO_PSEP1      LPAEAPFPA--IFEHYTLTLQALAEGRP---------LEPLLRSFEWRLLDELGYAFSLS
RECO_PSEPK      LPAEAPFPT--IFEHYTLTLQALAEGRP---------LEPLLRSFEWRLLDELGYAFSLN
RECO_PSEPG      LPAEAPFPT--LFEHYTLTLQALGAGRP---------LEPLLRSFEWRLLDELGYAFSLQ
RECO_PSEE4      LPAEAPYPA--LFEHYTLTLQALAAGRP---------LEPLLRSFEWRLLDELGYAFSLS
RECO_PSEPW      LPAEAPQPE--LFEHYALTLQALAAGRP---------LEPLLRSFEWRLLEDLGYAFALD
RECO_CUPMC      CPREDAHPT--LFRHYMATLTRLSHGE---------PASFVLRSFERVLLQETGFAVAFD
RECO_CUPPJ      CPREDGHPA--LFRHYMATLTRLAHGE---------AAGLVLRSFERVLLQETGFAVAFD
RECO_BURPS      CAREDPHPP--LFQHYLVTLTRLAHGE---------PPVQVLRSFERVLLRETGYAMTLK
RECO_BURP1      CAREDPHPP--LFQHYLVTLTRLAHGE---------PPVQVLRSFERVLLRETGYAMTLK
RECO_BURMA      CAREDPHPP--LFQHYLVTLTRLAHGE---------PPVQVLRSFERVLLRETGYAMTLK
RECO_BURTA      CAREDPHPP--LFQHYLVTLTRLAHGE---------PPVQVLRSFERVLLRETGYAMTLK
RECO_BURCA      CAREDPQPP--LFNHYVLTLTRLAHGE---------PAVQVLRSFERVLLRETGYAMALN
RECO_BURL3      CAREDPQPP--LFNHYVLTLTRLAHGE---------PAVQVLRSFERVLLRETGYAMALN
RECO_PARXL      CAREDPHPQ--LFHHYVVTMTRLAHDE---------PPVQVLRSFERVLLRETGYAMALD
RECO_NITMU      LHRNDPHER--LFACYQEALSDLSTAS---------DYIPILRRFEQRLLQEMGYALTLD
RECO_AZOSB      TPRDDPHPN--LFVAYADAVRELGLGR---------PPPPVLRQFELALLQELGYGIELV
RECO_AROAE      TAREDAHPA--LFEAYADALSQLGRG----------DVAPILRRFELTLLRELGYGIGLD
RECO_DECAR      LPREDAHEQ--LFASYAKMLALLAADPSG------KVREADLRCFEKALLQELGYGLTLN
RECO_THIDA      LARGDAHER--LYDRYVETLDQLARSAAASDAERATAFERILRRFEKNLLSEIGYGATFD
RECO_POLSJ      LARDDPHPV--LFDAYSATVQLLAS-------QSVDTLQLALRAFELRLLRDIGLLPLLD
RECO_POLNA      LARDDPHPL--LFDAYAATVQLLAS-------QNPDTLQLALRAFELRLLQGIGLLPRLD
RECO_RHOFT      LARDDPHTR--LFDVYTQVVQVIAS-------GHGEVLQSALRAFELLLLREIGLLPLLD
RECO_ACIAC      LAREDTHAA--LFDAYAGVVRVLAS-------EHGDALEPVLRSFELLLLREIGLLPALD
RECO_ACISJ      LAREDTHAP--LFDTYAGVVRVLATVDHEG--EHGDALEPVLRSFELLLLREIGLLPGLD
RECO_VEREI      LARSDPHAA--LFDAYTGVVRVLAS-------EHGDALEPVLRSFELLLLRAIGLLPSLA
RECO_DELAS      LARDDPYAA--LFDIYAGVVRVLAG-------QHGDAIEPVLRTFELLLLRELGHLPALN
RECO_NEIMB      TAREDPVPE--LYDALAEVMEAVCC---------KAAYIDDLRRFEWRLLNLLGVAPDLN
RECO_NEIMA      TVREDPLPE--LYDALAEVMEAVCC---------KAAYIDDLRRFEWRLLNLLGVAPDLN
RECO_NEIG1      TAREDPMSE--LYDALAKVMEAVCR---------EANHIADLRRFEWKLLNALGVAPDLH
RECO_NEIG2      TAREDPMSE--LYDALAKVMEAVCR---------EANHIADLRRFEWKLLNALGVAPDLH
RECO_NEIMF      TVREDPLPE--LYDALAEVMEAVCC---------KAAYIDDLRRFEWRLLNLLGVAPDLH
RECO_CHRVO      TARDDPEPR--AFSVYDRAVRELAG---------GAPLSTALRRYELRLAQVLGYAPALS
RECO_COXBN      LHHDDPYLR--LFHHYQNTLEKLVNGR----------LEATLRCFEKQLLDELGYGLPLS
RECO_COXBU      LHHDDPYLR--LFHHYQNTLEKLVNGR----------LEATLRCFEKQLLDELGYGLPLS
RECO_COXB1      LHHDDPYLR--LFHHYQNTLEKLVNGR----------LEATLRCFEKQLLDELGYGLPLS
RECO_COXB2      LHHDDPYLR--LFHHYQNTLEKLVNGR----------LEATLRCFEKQLLDELGYGLPLS
RECO_COXBR      LHHDDPYLR--LFHHYQNTLEKLVNGR----------LEATLRCFEKQLLDELGYGLPLS
RECO_NITOC      LPRRDPLEA--LFSVYAHSLPSLIHAQ---------QRQQILRLFERDLLAYLGYGLILK
RECO_METCA      LPPHDPCPE--LFGTYRGGLETLAAGE---------DLETALRSFELSLLEAIGYGLQLR
RECO_XYLF2      VPRHAPVNE--LYLAYSQTRERLRTNDS---------LAWSLRLFELDILETLGVGFNLE
RECO_XYLFT      VPRHAPVNE--LYLAYSQTRERLRTNDS---------LAWSLRLFELDILETLGVGFNLE
RECO_XYLFM      VPRHAPVNE--LYLAYSQTRERLRTNDS---------LAWSLRLFERDILETLGVGFNLE
RECO_XYLFA      VPRHAPVNE--LYLAYSQTRERLRTSDS---------LAWSLRLFEREILETLGVGFNLE
RECO_XANCB      APRHAPVPE--LFDCYAQARAHLASGAA---------LAWGLRQFERDVLDGLGFGFDLQ
RECO_XANC8      APRHAPVPE--LFDCYAQARAHLASGAA---------LAWGLRQFERDVLDGLGFGFDLQ
RECO_XANCP      APRHAPVPE--LFDCYAQARAHLASGAA---------LAWGLRQFERDVLDGLGFGFDLQ
RECO_XANOP      APRNDPVPE--LYACYTQARTHLAADLP---------LAWGLRRFERDVLEGLGFAFDLQ
RECO_XANOR      APRNDPVPE--LYACYTQARTHLAADLP---------LAWGLRRFERDVLEGLGFAFDLQ
RECO_XANOM      APRNDPVPE--LYACYTQARTHLAADLP---------LAWGLRRFERDVLEGLGFAFDLQ
RECO_XANC5      APRNDPVPE--LYACYAQARTYLASDLP---------LAWGLRRFERDVLDGLGFAFDLQ
RECO_XANAC      APRHDPVPE--LYACYAQARRHLASDLP---------LAWGLRRFERDVLEGLGFAFDLQ
RECO_STRMK      APRQDPLPE--LYLAYGEARARLAVGAG---------LAWTLRRFERELLTALGLGFELD
RECO_STRM5      APRQDPLPE--LYLAYGEARARLGVGAG---------LAWTLRRFERELLTSLGLGFELD
RECO_HALHL      TRREDPHPR--TWERYAVAVDCLATDDA----------EPALRRFELALLEESGYGLELE
RECO_ALKEH      LRRDDPHPE--LHPLYGDTLNRLPD-------------EAALRGFECRLLEALGYGLLLL
RECO_NITHX      LPERDPHDG--IFERLERTLDDFDTAG---------EAAIHLIRFELAMLTELGFGLDLS
RECO_NITWN      LPERDPHEV--IFAMLERTLDDFDRAG---------GAAIHLIRFELAMLSELGFGLDLS
RECO_RHOP2      LPERDPHED--IYEMLERTLDDFDDVG---------DAATHLIRFELAMLAELGFGLDLS
RECO_RHOPS      LPERDPHED--IYEMLERTLDDFDDVG---------DAATHLIRFELAMLAELGFGLDLS
RECO_RHOPB      LPERDPQPE--IYERLERTLDDFDDVG---------EAAVHVIRFELTMLAELGFGLDLA
RECO_RHOPT      LPERDPHEE--IYQRLVLTLDDFDDFG---------VAAAHLIRFELAILAELGFGLDLS
RECO_RHOPA      LPERDPHEE--IYQRLVLTLDDFDDFG---------VAAAHLIRFELAILAELGFGLDLS
RECO_BRADU      LPERDPHEE--IFGLLEHSLDDFDDIG---------SAAVHVIHFELAMLAELGFGLALD
RECO_RHOP5      LPERDPHPE--MYETVERILEDFDDAT---------MAGAHLVRFELAMLGELGFGLDLS
RECO_BRASO      LPERDPHED--MYFRLEHALDDFADAG---------AAAAHIVRFELAILTELGFGLDLE
RECO_BRASB      LPERDPHQE--MYLRLEHALDDFAEAG---------GAAVHIVRFELAILAELGFGLDLE
RECO_OLICO      LPERAPHDG--IYEQFEAILEDFDDPV---------IAATHVVRFEMAMLEELGFGLDLS
RECO_XANP2      LPERDPHEG--LFLTVGAILDAFENRE---------SAGRLLARFELALLAELGFGLELE
RECO_CHESB      LPERDPHPG--LFEALGVIAAHLDEPE---------TAGVLVARFELAVLDALGFGLDLA
RECO_RHILO      LPERDAHGG--LYEALSVMIVHLDDAD---------AAGELVARFELLILDELGFGLDLS
RECO_BRUSU      LPERDPHRG--LYETLRLIIEHFDDPL---------AAGELLLRFEVMMLEELGFGLDLK
RECO_BRUA2      LPERDPHRG--LYETLRLIIEHFDDPL---------AAGELLLRFEVMMLEELGFGLDLK
RECO_BRUAB      LPERDPHRG--LYETLRLIIEHFDDPL---------AAGELLLRFEVMMLEELGFGLDLK
RECO_BRUME      LPERDPHRG--LYETLRLIIEHFDDPL---------AAGELLLRFEVMMLEELGFGLDLK
RECO_RHIME      LPERDPHPH--LYEALAVIVDHLQDPA---------DAGELFVRFELAVLNDLGFGLDLS
RECO_SINMW      LPERDPHPH--LYEALAVIVDHLQDPA---------DAGELFVRFELAVLNDLGFGLDLS
RECO_RHIL3      LPERDPHPH--LFDALEVILDHLHNPA---------DAGELFVRFELAVLNDLGFGLDLA
RECO_RHILW      LPERDPHPH--LFDALEVILDHLHNPA---------DAGELFVRFELAVLNDLGFGLDLA
RECO_RHIE6      LPERDPHPH--LFDALEVILDHLHNPA---------DAGELFVRFELAVLNDLGFGLDLG
RECO_RHIEC      LPERDPHPH--LFDALEVILDHLHNPA---------DAGELFVRFELAVLNDLGFGLDLA
RECO_AGRFC      LPERDPHPH--LYQALDVILDNLHDPV---------DAGELFVRFELAVLNDLGFGLDLS
RECO_METEP      LPERDPHPA--LYEAAQILIAHLDDPE---------IAPALMVRFELALLAGLGFGLDLS
RECO_METPB      LPERDPHPA--LYEAAQVLIAHLDEPE---------IAPALMVRFELALLAGLGFGLDLS
RECO_BEII9      LPERDPHPE--LYAVVRVLLEHLDEPA---------VAPILLARFELAMLTETGFGLDLS
RECO_BARQU      LPERDPYPS--LYDILHLFMQNFDESF---------VNAELLVRFEMRLLEELGFGLDLS
RECO_BARHE      LPERDPHPI--LYDILHLFMQSFDEPF---------INAELLVRFEMRFLEELGFGLDLS
RECO_BART1      LPERDPHPV--LYDILHLFMQNFDEPF---------VNAELLVRFEMRLLEELGFGLDLS
RECO_BARBK      LPERDPHPI--LYDILHLFMQNFDEQF---------VNAELLVRFEMRLLEELGFGLDLS
RECO_RHORT      LPERAPQAD--VYDATLALLDALAEGGEGT----PLVWAGAFVRWEIGLLAALGFGLDLS
RECO_RHOCS      LPEREPHPA--LFDATLALFDALQTE----------VWAEIYVRWEIGLLEEAGFGLDFG
RECO_CAUVC      LPEREAHPG--AFHALEALIRVLEIPE---------IWPAVYVRYEAGLLQELGFGLDLS
RECO_CAUSK      LPEREAHPG--AFHALEALIAALAIPA---------IWPAVYVRFEAGLLQDLGFGLDLS
RECO_ROSDO      LPEREAHRP--LYVETERLLDLLGEG---------EIWPLAYLRWEVQLLHDMGYALALE
RECO_RUEPO      LPEREAHPR--LYKQSEQLLDLLGQD---------EIWPLAYLRWELALLDTLGFGLDLS
RECO_RUEST      LPDRAPYPA--LYHRSSALLDLLDSE---------DLWPLAYLRWELSLLEDLGYGLDLS
RECO_RHOS1      LPEREPHST--LWQESMALLDALDR----------PGWPPAYLRWEMRLLEETGFGLDLT
RECO_RHOS4      LPEREPHST--LWQESMVLLDALDR----------PGWPPAYLRWEMRLLEETGFGLDLT
RECO_RHOS5      LPEREPHVG--LWRESIELMDALAA----------PGWPAAYLRWEMRLLEEAGFGLDLT
RECO_JANSC      LPERAAYPG--LFARTLAVLDGLGA----------ERWAEAYLGWEMALLTEMGFGLDLS
RECO_GLUDA      LPEREPHPR--IFHLLTRFFSLLSLDPDMA----GWGGMAALLRWEACLLGDLGYGMDLS
RECO_GRABC      LPDREAHPA--AFIPLPGLLTRLSLG--------GGQVVEDAIRWEAILLRELGYGLDLQ
RECO_CHLTB      QWHEKPSPH--LFSLFFNFLQRIPETQY---------PNFFSSMFLLKLLQHEGSLDLSR
RECO_CHLT2      QWHEKPSPH--LFSLFFNFLQRIPETQY---------PNFFSSMFLLKLLQHEGSLDLSR
RECO_CHLTR      QWHEKPSPH--LFSLFLNFLQRIPETQY---------PNFFSSMFLLKLLQHEGSLDLSR
RECO_CHLTA      QWHEKPSPH--LFSLFLNFLQRIPETQY---------PNFFSSMFLLKLLQHEGSLDLSR
RECO_CHLMU      QWQEKPSPQ--LFSLFLNFLQRIPETPH---------PYFFSSMFLLKLLQHEGSLDLSH
RECO_CHLPN      QWKEKPSHK--LFSLFLNFLHRIPESSN---------PEFFAAIFVLKLLQYEGILDLTP
RECO_BACSU      TEEKKPNPY--LFEFILESLKQLNEGT---------DPDVITFIVQMKMLGVMGLYPELN
RECO_BACVZ      TEEKKPNPY--LFELILESFKRLNDGT---------DPDVITFIVQMKMLGVMGLYPELN
RECO_BACLD      TEEKKPNPF--LFELLLQSMRRLNDGT---------DPDIIANLIEVKMLSVMGLYPELD
RECO_BACP2      TEEKKPNPY--LFELLLQSLRHLNEGT---------DADIILFIVEVKMLSVMGMKPELD
RECO_BACC7      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACCZ      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACAN      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACC0      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACHK      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACCR      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACC4      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACC2      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DSEVLSLIYQTKMLPVLGMRPYFD
RECO_BACC1      XXDKXHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACMK      TEDKKHNPY--LFEMLYQTLHYMCEGV---------DPEVLSLIYQTKMLPVLGMRPYFD
RECO_BACCN      TEDKKNNPY--LFEMLYQTLHYMCDGV---------DPEVLSLIYQTKMLPVLGMHPYFD
RECO_BACHD      TEDEKRNPY--LFELLYQTIHYMNEGM---------DPDVLTRIFEVKMFTVAGIKPELD
RECO_GEOTN      TEEQKRNPY--LFELLLQTLQYMSEGR---------DLEIMTFIYEMKMLSVLGIPPVLD
RECO_GEOKA      TEEQKRNPY--LFELLLQTLQYMSEGR---------DLEILTFIYEMKMLAVLGIPPVLD
RECO_LISIN      TEERQPNPY--LYELTFQILRDIDEGY---------DPQILTQIYEMKMLPVLGLYPTMD
RECO_LISW6      TEERQPNPY--LYELTFQILRDIDEGY---------DPQILTQIYEMKMLPVLGLYPTMD
RECO_LISMO      TEERQPNPY--LYELTFQILRDIDEGY---------DPQILTQIYEMKMLPVLGLYPTMD
RECO_LISMF      TEERQPNPY--LYELTFQILRDINEGY---------DPQILTQIFEMKMLPVLGLYPTMD
RECO_BACSK      TEERKPTFF--LFDWLLLALRQINTGQ---------DAEIIARIMDMKMLPLAGAKPELD
RECO_OCEIH      LDAKENDPF--LYEQFYQTLLWINNQD---------EVDIPVIMYELKLYKKAGFAPVLH
RECO_EXIS2      LDERVPQPA--LYDLFVDGLEAMDEGL---------DPDVVSFIVELRLLRHLGIAPHLN
RECO_STAAM      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAA1      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAN      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAT      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAE      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAC      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAA3      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAB      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAW      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAS      MDEGDIAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAAR      MDEGDVAPY--NYQLLQFVLEKIESGT---------SAQLMSVVVMLKCMKRFGFTASFN
RECO_STAEQ      MEENEVSKY--NYDLLQFVLSKINEGT---------PAQLMSVIVLLKNMSKFGFTASFD
RECO_STAES      MEENEVSKY--NYDLLQFVLSKINEGT---------PAQLMSVIVLLKNMSKFGFTASFD
RECO_STAHJ      MDNDDISPF--HYKLLHFVLEKISNGD---------SAQLMSIIVLLKCMNRFGFTAFFN
RECO_STAS1      METDGISKN--SYELLHFVLDKIRQGI---------SAQLMSVVVLLKCMTKFGFNAVFD
RECO_STRSV      LQDNQPDPA--LFAFLQKTLELMNNGL---------DYEVLTNIFEIQILSRFGVSLNFH
RECO_STRGC      IPDSQPDAA--LFAFLTKTLELMEEGL---------DHEILTNIFEVQILSRFGVSLNFH
RECO_STRPI      LQDNQQDAP--LFAFLQKTLELMEAGL---------DYQVLTNIFEIQILTRFGISLNFN
RECO_STRPN      LQDNQQDAP--LFAFLQKTLELMEAGL---------DYQVLTNIFEIQILTRFGISLNFN
RECO_STRPS      LQDNQQDAP--LFAFLQKTLELMEAGL---------DYQVLTNIFEIQILTRFGISLNFN
RECO_STRP4      LQDNQQDAP--LFAFLQKTLELMEAGL---------DYQVLTNIFEIQILTRFGISLNFN
RECO_STRP2      LQDNQQDAP--LFAFLQKTLELMEAGL---------DYQVLTNIFEIQILTRFGISLNFN
RECO_STRR6      LQDNQQDAP--LFAFLQKTLELMEAGL---------DYQVLTNIFEIQILTRFGISLNFN
RECO_STRPD      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRPG      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRP6      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRPC      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRPB      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRP1      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRP3      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRPZ      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRPM      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRP8      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STRPF      IADNESDSH--LFTFLKKTLDLMEEGL---------DYEILTNIFEIQILDRFGISLNFH
RECO_STREM      IPDNEPDPQ--LFAFLKKTLDLIEEGL---------DYDILTNIFEIQILDRFGVRMNFH
RECO_STRS2      LQDKVYDPA--LFAFLVKTLDLMESGL---------DYEVLTNIFEIQLLGRFGISLNFH
RECO_STRSY      LQDKVYDPA--LFAFLVKTLDLMESGL---------DYEVLTNIFEIQLLGRFGISLNFH
RECO_STRMU      ISDAVYDAP--LFAFLIKTLELMDEGL---------DYEILTNIFEIQILDRFGVQLNFH
RECO_STRA5      ISDNVADAQ--LFIFLKKTLELIEDGL---------DYEILTNIFEVQLLERFGVALNFH
RECO_STRA3      ISDNVADAQ--LFIFLKKTLELIEDGL---------DYEILTNIFEVQLLERFGVALNFH
RECO_STRA1      ISDNVADAQ--LFIFLKKTLELIEDGL---------DYEILTNIFEVQLLERFGVALNFH
RECO_STRT2      IADGVVDAQ--LFAFLEKTLVLMEEGL---------DYEILTNIFEIQVLDRFGVRLNFH
RECO_STRT1      IADGVVDAQ--LFAFLEKTLVLMEEGL---------DYEILTNIFEIQVLDRFGVRLNFH
RECO_STRTD      IADGVVDAE--LFAFLEKTLVLMEEGL---------DYEILTNIFEIQVLDRFGVRLNFH
RECO_LACLS      ISDNQYDPA--LYGFLKRSLELLDQGF---------DMEVVTNIFELQVLHRFGVSLNFS
RECO_LACLM      ISDNQYDPA--LYGFLKRSLELLDQGF---------DMEVVTNIFELQVLHRFGVSLNFS
RECO_LACLA      ISDNQYDPG--LYGFLKRSLELLDQGF---------DMEVVTNIFELQVLHRFGISLNFS
RECO_ENTFA      IEDQHYDPN--LFQFTHMALSALNEQK---------DPEIITNIFEIQLLERFGVRPEWH
RECO_LACBA      FPDSQPLPD--WYHRVQRALTLIDDGV---------NAAIVTNIMEIQLMPAFGVAPQLQ
RECO_LACPL      FPDNQPVGR--WYQQLTSALQLIDQDV---------APALVANVVEIQLLQPFGVAPELR
RECO_LACSS      FPDSEPLGI--WYDKVEQALNLIDEGF---------DAAMITHIIEIQLLQVFGVQPQLQ
RECO_LACRD      FNDGRSIGG--WFKQVAAALDLIEKGL---------DEQIITNVIETQLLVAFGVAPVWD
RECO_LACRJ      FNDGRSIGG--WFKQVAAALDLIEKGL---------DEQIITNVIETQLLVAFGVAPVWD
RECO_LACF3      FEEGRALGG--WYKQVMAALNLINTGR---------DPQVVVNVLEVQLLNRFGIAPVWD
RECO_LACS1      FEDSIDVTNTLWFEKVLKALSLINDGF---------DAQIIANIIEVQLLGKFGVQPNWR
RECO_PEDPA      FDDNVKITS--WFERINRALILIDAGN---------DAEIITDLIQIQLLNSFGISITWD
RECO_LEUMM      FEEGEKITR--WYNQLYVALQKLDEGL---------DPQIIANIFEIQLLVPLGVAPNLR
RECO_LEUCK      FEEGEQLTR--WYNQFVLGLQKLDEGL---------DPQIIANIFEIQLLVPLGVAPNWR
RECO_OENOB      FDENTNIDQ--WYFMFFQALKKIDAGL---------DPQVIANVFEIQLLSVFGVEPNLF
RECO_LACAC      FVEYQPLGQ--YYNLAVFALEKISAGV---------DSEMITQIVQMKMLSAYGVKPELS
RECO_LACH4      FVEYQPLGK--YYDLAVFALKKIDAGV---------DNEMITQIVQMKMLSAFGVEPELR
RECO_LACJO      FVEYKDIGS--FYDLIIKALLKINSGE---------DAAIITQMVQLKLLNAYGVAPQLD
RECO_LACGA      FVEYKDIGS--FYDLIMKALLKINSGE---------DVAVITQMVQLKLLNAYGVAPQLD
RECO_LACDB      FSEYQKLGG--YYDLLLVAFNRIVAGQ---------DPEIIAQIVQLQLLDAFGVAPQLG
RECO_LACDA      FSEYQKLGG--YYDLLLVAFNRIVAGQ---------DPEIIAQIVQLQLLDAFGVAPQLG
RECO_CLOPS      LQDEEENFN--LYKEFITCLYLINTEAI--------SYELLIRAFELKLLKYTGYGLRFD
RECO_CLOP1      LQDEEENFN--LYKEFITCLYLINTEAI--------SYELLIRAFELKLLKYTGYGLRFD
RECO_CLOPE      LQDEEENFN--LYKEFITCLYLINTEAI--------SYELLIRAFELKLLKYTGYGLRFD
RECO_CLONN      LEQEQSDRE--LFKDFIKSFYFLKNQAM--------DLEILARTFELKLLKATGYGFDFE
RECO_CLOK5      MDDGESSRE--LFRYLATSFYLIRSHAV--------DIETLARTFELKILKTTGYGLNFD
RECO_CLOAB      MAEGESNRD--LFKEFVSTFYLIKNKVG--------DIETLSRAFELKLLRYTGYNLNLD
RECO_ALKMQ      TEEGQTNNR--LFNLLGRTLHLMKKEEI--------ELETILRAFELKLMEYSGLKPHLT
RECO_ALKOO      TTEGQTNHR--LFNLFGKTLFLLKKSDI--------EINPIVRAFEIKLMNYLGYKPQLM
RECO_CLOD6      ILENQTNNR--LFILLAQTLYLYTQDNT--------DNRFITAAFELKFLDYIGFKPIVN
RECO_HUNT2      ILENQPASR--LLQLFLNSLYMLSKTDR--------SPLQIVRVFEIRLLSTMGYAPWVS
RECO_CALS8      IQIEQKNED--ILRLLLNSLYMLKKGA---------DPETVCRIFEIKMLIFTGFFPQFT
RECO_THEPX      LEENQKSER--LYLFLKHSLKAVDELQI--------DPLIFISSYNLKLVSLLGYMPQLD
RECO_THEP3      LEENQKSER--LYLFLKHSLKAVDELQI--------DPLIFISSYNLKLVSLLGYMPQLD
RECO_CALS4      LEEKQKNTK--LYFFTKHSLEAVESLNV--------ETSIFLFSYTLKLISLLGYMPVLD
RECO_NOSS1      ALSEQPQE--ELYELLNEHLHRLEELPKGE----SFGVLAYLAHAVFHLLALAGLTPQVQ
RECO_TRIV2      ALSEQPQE--ELYELLNEHLHRLEELPKGE----SFGVLAYLAHAVFHLLALAGLTPQVQ
RECO_NOSP7      ALSEQPQE--ELYELFNEHLHRLEALSNAN----ASGVLAHLAHGVFHLLALAGVTPQVQ
RECO_TRIEI      ALKENPQT--ELFHLLNEHLERIEQLQHKTDRLWSTQLIAFLAHGIYHLLAIEGIAPQVH
RECO_GLOC7      ALCEQPQI--ELYELLNEHLRRIEQKATPQ------TLYPHLAQAVFHLLAIAGVAPQVY
RECO_RIPO1      AVSEQPQG--ELYELLKEHLRRLEDISSGQ------SLHSHLAQAVFHLLAIAGIGPQVH
RECO_SYNY3      GTEASAQT--SLYELFTEHLRRLETEATVE------NIYGHLAQALFHCLGAEGIAPQFH
RECO_ACAM1      ALSGQPQT--ELWDLFCQQLTQLQNATLAQ-------VPCCLIHGTLKLLAGAGIAPQVH
RECO_SYNP6      ALERHPQP--ELFALLCRDLARIETQSGLE-------VLPYLLQSTWQLLAWAGWAPQTH
RECO_SYNE7      ALERHPQP--ELFALLCRDLARIETQSGLE-------VLPYLLQSTWQLLAWAGWAPQTH
RECO_THEEB      IHPQQPQP--ELFDWFCATLDQLQGASSRA-------ALAILVRGLCGILRLGGIAPEWY
RECO_SYNJB      ALPDQAQE--ELFVVLVEHLERIERAASEQA------VLPLLTHGLYHLLALAGFAPQVQ
RECO_SYNJA      ALPNQPQE--ELFVLLVEHLERIEQAPATEA------VLPLLVHGLYHLLVVGGVAPSVQ
RECO_GLOVI      ATEGQAQE--DLYDLLLVHLERLAATPSHQ-------IAARLVHGVYQLLAVGGVAPEVH
RECO_NOCFA      AGEERAPAP-KLHALTASALRAIAAKQRP--------HELVLDAYLLRAMRFAGWAPALD
RECO_RHOJR      AGEERAPAP-QLHRLTVGALRAVAEHNRP--------CELILDAFLLRAMGFAGWAPALD
RECO_MYCSK      AGEERAPMP-ALHRLTVGALRAVADGSRP--------RELVLDAYLLRAMGIAGWAPALT
RECO_MYCSS      AGEERAPMP-ALHRLTVGALRAVADGSRP--------RELVLDAYLLRAMGIAGWAPALT
RECO_MYCSJ      AGEERAPMP-ALHRLTVGALRAVADGSRP--------RELVLDAYLLRAMGIAGWAPALT
RECO_MYCS2      AGEERAPMP-DLHRLTVAALRAIADGRRA--------RELVLDSYLLRAMAIAGWAPALT
RECO_MYCGI      AGEERAPVP-ALHRLTVAALRAVADGTRP--------RELVLDAYLLRAMGVAGWAPALI
RECO_MYCA9      AGEERAPAV-ALHRLTVGALRAIADQQRS--------RELILDAYLLRAMSIAGWAPAIG
RECO_MYCMM      AGEERAPAP-ALHRLTVGALRAVADGSRP--------RDLLLDAYLLRAMGIAGWAPALT
RECO_MYCUA      AGEERAPAP-ALHRLTVGALRAVADGSRP--------RDLLLDAYLLRAMGIAGWVPALT
RECO_MYCTA      AGEERAPAP-ALHRLTVGALRAVADGQRP--------RDLLLDAYLLRAMGIAGWAPALT
RECO_MYCTU      AGEERAPAP-ALHRLTVGALRAVADGQRP--------RDLLLDAYLLRAMGIAGWAPALT
RECO_MYCBP      AGEERAPAP-ALHRLTVGALRAVADGQRP--------RDLLLDAYLLRAMGIAGWAPALT
RECO_MYCBO      AGEERAPAP-ALHRLTVGALRAVADGQRP--------RDLLLDAYLLRAMGIAGWAPALT
RECO_MYCPA      AGEERAPAP-ALHGLTVSALRAVADGRRS--------RDLLLDAYLLRAMGIAGWAPALT
RECO_MYCLE      AGEERAPAP-TLHRLTVSALRAVADGNRP--------RDLLLDAYLLRAMGIAGWAPALT
RECO_SACEN      AAEEGEPVL-RLYLLATGALRALAGRERD--------SSLVLDAFLLRAMSFAGWAPALD
RECO_STRCO      TDHEGEPAV-QQYLLLVGALRTLARGEHA--------PTLVLDAFLLRSLAVNGYAPTFG
RECO_STRAW      TDHEGEPAV-QQYLLLVGGLRTLARGEHE--------PHLVLDAFLLRSLAVNGYAPSFS
RECO_STRGG      TDHEGEPAV-QQYLLLVGGLRTLARGEHA--------PHLILDAFLLRSLAVNGYAPSFE
RECO_THEFY      VSVEKDPAL-RQFLLLWGGLRTLAEGAHD--------PRLVLDAYLLRSLAVAGYAPALE
RECO_NOCSJ      VAEEREPSV-QQFLLLVGGLRAMVAGEHA--------PGQVLDSYLLRSLAVAGYAPSFE
RECO_FRACC      TSEERQPAL-RLFLLLVGGLRTLAGDERP--------PALVLDAFLLRALAVSGYGMALD
RECO_LEIXX      T--DAEASL-QQYLLLVGALRSLSRGEHG--------PGLTLDSYLLRVLSLAGWAPSFQ
RECO_CUTAK      VPVDREPAP-AQYRLLAGALRVLGQGTTDGPRP----PEMVLDSYLLRSLSASGYAPDLV
RECO_BIFLO      ASTEHEQLP-NQYRLLIGALNALAKQSHA--------PQAIGDSYVMRALALAGWTPRLG
RECO_BIFLD      ASTEHEQLP-NQYRLLIGALNALAKQSHA--------PQAIGDSYVMRALALAGWTPRLG
RECO_BIFAA      VATEKEPAV-AQYRLVLGALNALAKHAHE--------PSTIGDSYVLRALAIAGWTPRLR
RECO_RUBXD      SGGTPDR---RTFNLLYRALDALEKGEEG--------FGMIEASFGLKLAVLSGYAPRLD
RECO_PELTS      TPEGEPNE--SLFFLLLDVLRLLAG--GDA--------EMLARAFELKVAALLGYCPVLE
RECO_DESAP      AAEGQAEP--GIYGLLLQVLRRLAE--DKS--------GLPVRFFEARILALTGFGPELG
RECO_DESRM      VAEGEPNQ--NLFSLLYSALHLIAV--GNS--------EMILRGFEAKLLGFSGLQPDLT
RECO_MOOTA      VMPGQVNQ--AMYLLLQQGLEALGE--LEP--------ALVARAFEARTLKLLGLAPRLE
RECO_SYMTH      LPERQRQE--APYLLLLTSLHLWGEPDRDP--------EPLLRAFELKLLSMLGFRPSLA
RECO_DESHY      TLPGQPHP--ELFTLTFSSLFLVES--CDP--------ALVQCTYALKLMNYLGYRPRLV
RECO_HELMI      S-PDHSGA--DLFPLLLTGWHLLSV--FPG--------DLVACLFQLRLLDRLGYCPELS
RECO_HERA2      TPDESDNP--ALFRLTCETLAALDVLDDVVR------RDVILRYYELHTLILSGYRPHLF
RECO_ROSS1      VEEEAENK--RAFSILLGTLRALNAGAAI---------DLTLRAYELHLLDALGYRPQLY
RECO_DEHMC      SPEEAANP--AMFQLLLSTLEELDNGSQP---------ELCLKYFEINLLASSGYKPELR
RECO_DEHMB      SPEEAANP--ALFQLLLSTLEELDNGSQP---------ELCLKYFEINLLASSGYKPELR
RECO_DEHM1      SPEESANP--AIFQLLLSTLEELDNTTQA---------ELCTKYFEIHLLEMSGYKPELR
RECO_ANASK      VRDHQPHD--ELFELLVAYLDALDAGPPR---------PAALRAFELGALRAAGLMPRLD
RECO_ANADE      VRDHQPHD--ELFDLLVAYLGALDAAPPR---------PAALRAFELGALRAAGLMPRLD
RECO_ANADF      VRDHEPHA--ELLALLLEYLGALDAGPAR---------PEGLRAFELGALRAAGLMPRVD
RECO_MYXXD      TRDHEPQP--ELFALLESYLTRLDAKEAG---------PTSLLAFELSALAHAGLMPRFD
RECO_GEOMG      LPDGAPSP--RLFRLLSSYLERLDQGEPL---------PSDRRFFEANFLNILGYRISLD
RECO_GEOSL      LPDGASVP--RLFRLLVSYLEHLDQGGAS---------PSDRRFFEANLLNILGYRLSLD
RECO_GEOUR      VPEAEQNH--RLFRLLAAYLDHLDQFQHD---------PSDRRFFEANLLKVVGYQPALS
RECO_PELPD      TPEGHPLP--RLFRLLAAYLDRLEAYPAS---------EQERRFFEINLLNILGYRPSLE
RECO_DESAL      AEEEHAQE--EIFQLLIRSLENLDNEKVDR--------DKVNILFLLRFLALAGLSPSLD
RECO_DESOH      VKEDDTQS--ALFHLLHYVLFMLDSGKASH--------ADLSILFQVRFMTLAGLFPGMA
RECO_PROA2      TGSEEPHPV--LFRFLAATIEELCKPERD--------YQLVLAWFLIRLVTVLGFEPELE
RECO_CHLPB      TGNEEKNIR--LFNALERTLEKLCAPCRN--------ADAAVAWFMLKLISESGFEPSIE
RECO_CHLL2      LEGEEKNLP--LFSLLTGVLEILYSTEER--------FELLFIWFLLRMISTLGFEPSLD
RECO_CHLPD      IDGQEKNIP--LFSLIASVLEELYSTSDR--------FRLLYSWFLLKLVSLLGFEPSIH
RECO_PELPB      TENDEKNLP--LFTLLTGTLEQLYHTNVN--------FQQLYAWFLLRFVSLLGFQPSLR
RECO_CHLP8      SGPEEKNVP--LFTLVAATIERLCDTERD--------FQPILAGFLLRLVSVLGFTPALK
RECO_PELCD      VGETGAQPP--VYDLLTAFLTHVNHHGG---------SEEARLLLELRLLCLSGYAPHLV
RECO_SYNWW      LMEGVAIPR--LYTSTLEVLSHLNHSGY---------NPMLIRYFEMNLLVNLGYSPLLD
RECO_SYNAS      SIEEKPGRE--LFELLRSFLLLIEEGD---------TSERLLRFFEIRHLKLTGYAPALD
RECO_SYNFM      VPEGDPQPE--LFELLKETLRQLCEDKD---------SLNVALLFIFRFQDKMGYLPALE
RECO_CARHZ      WPLGQLNPK--LYNWVLYSLRLLNSGVW---------PKIVLRNFELKLLAFTGFRPITT
RECO_KORVE      LPDREPNDA--VFRLSLAVLGQLVPGAV----------WMPLTYFDLWMVRLAGFLPDLM
RECO_RHOBA      VDDDDPHRE--LFDMTLSAMGMIDGEG---------HVAKTLLAFDAQCLRLLGHSPATQ
RECO_SALRD      MEEEDPQPA--AFALVVRALHRLNIAEA--------RVSNLWPYVQLQLAQILGVAPAVD
RECO_SYNSC      AAEDPVEGLLDTMQLHLERLEEHRADPEL--------VLAGTVQACIHLLTLGGYGLPLQ
                                                                     *      

RECO_ECOL6      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_SHIDS      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOUT      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOLI      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOLC      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECO5E      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECO45      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOK1      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECODH      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECO57      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOL5      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_SHIFL      HCAGSGEPVDG--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_SHIF8      HCAGSGEPVDG--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECO24      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOSM      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECO7I      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECO8A      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOHS      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOSE      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ESCF3      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_SHISS      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_ECOLU      HCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_SHIBS      YCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_SHIB3      YCAGSGEPVDD--------TMTYRYREEKGFIASVVIDN-------KT------------
RECO_SALEP      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALG2      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALDC      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALA4      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALPB      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALTI      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALNS      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALCH      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALTY      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALHS      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALPK      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALPA      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_SALSV      HCAGSGERVDD--------TMTYRYREEKGFFASVVIDN-------NT------------
RECO_KLEP7      HCAGSGEPVDD--------TMTYRYREEKGFIASLVIDN-------NT------------
RECO_KLEP3      HCAGSGEPVDD--------TMTYRYREEKGFIASLVIDN-------NT------------
RECO_ENT38      HCAGSGDSVDD--------TMTYRYREEKGFIASIVIDN-------TT------------
RECO_CROS8      HCAGTGDEVDD--------AMTYRYREEKGFIASLVIDN-------TS------------
RECO_ERWT9      HCAGSGEEIAD--------GMTYSYREEKGFIASLVTGH-------RS------------
RECO_YERPB      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERPN      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERPS      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERPA      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERPE      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERP3      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERPG      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERPY      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERPP      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_YERE8      HCAGSGQPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_PROMH      HCAGSGEPVSD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_PHOLL      HCAGSGEPVAD--------TMTYRYREEKGFIASLVVDH-------YS------------
RECO_PECAS      HCAGSGEPVAD--------TMTYQYREERGFTASLVVDN-------KS------------
RECO_SERP5      HCAGSGLPVDD--------GMTYRYREEKGFIASLVVDH-------YS------------
RECO_SODGM      HCAGSGEPVDD--------AMTYRYREEKGFTASVLLDR-------YS------------
RECO_VIBCH      HCAGTGEPVSP--------DMTYRYREQKGFIASVRRDN-------LT------------
RECO_VIBC3      HCAGTGEPVSP--------DMTYRYREQKGFIASVRRDN-------LT------------
RECO_VIBVY      HCAGTGEPIDP--------QMTYRYREQKGFIASVRRDN-------LT------------
RECO_VIBVU      HCAGTGEPIDP--------QMTYRYREQKGFIASVRRDN-------LT------------
RECO_VIBPA      HCAGTGEPVDP--------EMTYRYREQKGFIASVRRDN-------LT------------
RECO_ALIF1      HCAGSGEMVSP--------EMTYRYREQQGFMASIRHDPL------MS------------
RECO_ALIFM      HCAGSGEMVSP--------EMTYRYREQQGFMASIRHDPL------MS------------
RECO_ALISL      HCAGSGEMVSP--------EMTYRYREQKGFMASIRHDPL------MS------------
RECO_PHOPR      HCAGSGLPIDD--------LMTYHYREQKGFIASMMTGH-------FT------------
RECO_ACTP2      ICAATGDPVSP--------SMTYQFRENQGFIASLLQNN-------YT------------
RECO_ACTPJ      ICAATGDPVSP--------SMTYQFRENQGFIASLLQNN-------YT------------
RECO_ACTP7      ICAATGDPVSP--------SMTYQFKENEGFIASLLRNN-------AS------------
RECO_HAEDU      ICAATGQPIDA--------GMYYQFSENKGFFASLLRNH-------YT------------
RECO_HAEI8      HCAGSGEPVDF--------SMTYRYREEKGFVASLVKDN-------LT------------
RECO_HAEIE      HCAGSGEPVDF--------SMTYRYREEKGFVASLVKDN-------LT------------
RECO_HAEIG      HCAGSGEPVDF--------SMTYRYREEKGFIASLVKDN-------LT------------
RECO_HAEIN      HCAGSGEPVDF--------SMTYRYREEKGFIASLVKDN-------LT------------
RECO_MANSM      HCAGSGEPVDE--------NMTYRYREEKGFIASLIKDN-------LT------------
RECO_ACTSZ      HCAGSGEPVDE--------AMTYRYREEKGFTASLIKDN-------AT------------
RECO_PASMU      HCAGSGELVDE--------NMTYRYREEKGFIASLIKDN-------LT------------
RECO_PSYIN      EDIYSGELIES--------GYEYQYQHQAGFFAKQAIHKQH-----DV------------
RECO_IDILO      YDADTGNVLSD--------SKWCYFIPDHGFVTQARDNQQ------RA------------
RECO_PSEA6      HDADTGQPVAD--------NGYYRIVPELGCVYQGDIRLS------GC------------
RECO_HAHCH      VESATGDIVKN--------NIAYYFSLTEGVSRTPEPCS-------VV------------
RECO_MARHV      ETTDTGMSVQA--------GELYGYDPGQGIVSNLAPELPL-----RQ------------
RECO_CELJU      HDCHSQQPIQS--------GYFYLCDIHQGFYSVPADSDPR-----FW------------
RECO_PSEA8      VDID-GRPIEP--------QALYQLLPEAGLEPVAQLQP-------GL------------
RECO_PSEAE      VDID-GRPIEP--------QALYQLLPEAGLEPVAQLQP-------GL------------
RECO_PSEAB      VDID-GRPIEP--------QALYQLLPEAGLEPVAQLQP-------GL------------
RECO_PSEA7      VDIH-GRPIEP--------QALYQLLPEAGLEPVTQLQP-------GL------------
RECO_PSEU5      IDIA-GQPIDA--------QRLYRLVPDAGLEPVVGFQP-------GL------------
RECO_PSE14      ADIN-GEPLAI--------DGMYRLQVDAGLERVYLLQP-------GL------------
RECO_PSEU2      ADIN-GEPLAI--------DGMYRLQVDAGLERVYLLQP-------GL------------
RECO_PSESM      ADIN-GEPLAV--------DGMYRLQVDAGLERVYLLQP-------GL------------
RECO_PSEPF      TDIN-DEPVAV--------DGLYRLQVDAGLERVYLLQP-------GL------------
RECO_PSEF5      SDIH-GAPIAA--------DGLYRLQVDAGLEQVFLLQP-------GL------------
RECO_PSEP1      QDVN-DQPIAA--------DGLYRLRVDAGLERVELLQP-------GL------------
RECO_PSEPK      QDVN-DQPIAA--------DGLYRLRVDAGLERVELLQP-------GL------------
RECO_PSEPG      QDVN-DQPVAA--------DGLYRLRVDAGLERVELAQP-------GL------------
RECO_PSEE4      QDVN-DAAVVA--------DGLYRLRVDAGLERVELFQP-------GL------------
RECO_PSEPW      HDVS-DEPIEA--------DGLYRLQVDAGLERVYLVQP-------GL------------
RECO_CUPMC      QCLRSGERVQP--------GLDYVYQPERGVRRTHASDPS----SWPV------------
RECO_CUPPJ      QCLSTGERVQP--------HLDYVYQPERGVRRAQPSDPS----SWPV------------
RECO_BURPS      RTVAR-RAVEP--------DKLYVFDPQRGVRDAGSDAPS----HWPV------------
RECO_BURP1      RTVAR-RAVEP--------DKLYVFDPQRGVRDAGSDAPS----HWPV------------
RECO_BURMA      RTVAR-RAVEP--------DKLYVFDPQRGVRDAGSDAPS----HWPV------------
RECO_BURTA      RTVAR-RAVEP--------GKLYVFDPERGVRDADSDVPP----HWPV------------
RECO_BURCA      RTVAR-RAVEP--------ERRYVFDPERGVRNADDDVPS----HWPV------------
RECO_BURL3      RTVAR-RAVEP--------DRRYVFDPERGVRNADDEVPS----HWPV------------
RECO_PARXL      RTVAR-KAVLA--------EGRYVFDPERGVREAADDLPA----QWPV------------
RECO_NITMU      HDVSSGKPIKP--------TQMYCYEIERGPIASSNGSCP----FNLE------------
RECO_AZOSB      HDVQSGEAVRG--------DATYAYIIEGGPAALDAPGDAPP--DLPV------------
RECO_AROAE      LEGDSNRPVDP--------VQQYVYIIEKGPVRLAGDDEG-----LPG------------
RECO_DECAR      HDSDAN-LIEP--------DTFYTYRIEQGPVRIDHGEGA-----TQV------------
RECO_THIDA      VEAGGA-AIEP--------GAAYVFQPERGALRAAGQPGC-------P------------
RECO_POLSJ      AETATLAPLEP--------QARYVLVAEAGLRQAHDDDRNSLPGVQWQ------------
RECO_POLNA      AETATLTPLAP--------HQRYVLVAEAGLRQAHDDDRFSLSGAQWQ------------
RECO_RHOFT      AQTMTLLALDP--------ESRYSLVPEGGLRQTNDADRASLSGAQWV------------
RECO_ACIAC      VETSTLAPLAP--------AARYALVPEAGLRPALPSDRSTLGGAQWR------------
RECO_ACISJ      AETSTLAPLHA--------AARYALVPEAGLRPAVPADRAALSGGQWL------------
RECO_VEREI      AQTMTLAPLQA--------DTRYTLVPEGGLRAAAAAERAALPGHQWQ------------
RECO_DELAS      EESATLAPLAE--------GRRYALVAEGGLRPALQGERAVLGAAQWQ------------
RECO_NEIMB      RD-GDGGTIAA--------GGTYLVRPETAVFPVGKGFAVPPHAAGVV------------
RECO_NEIMA      RD-GDGGTIAA--------GGTYLVRPETAVFPVGKGFAVPPHAAGVV------------
RECO_NEIG1      AD-GTGGDILA--------DKTYRLMPEEAVMPVCRDTGALSHEAGAI------------
RECO_NEIG2      AD-GTGGDILA--------DKTYRLMPEEAVMPVCRDTGALSHEAGAI------------
RECO_NEIMF      AD-GTGGDILA--------DKTYRLMPEEAVMPVCEDADALSHEAGAI------------
RECO_CHRVO      RD-SRGEAIAA--------DRHYLCRDAALPEP-DEHPELAPVGRVVR------------
RECO_COXBN      CDVEMKLPFKP--------DQFYQYLPDRGFLLCEKSEE------RDV------------
RECO_COXBU      CDVEMKLPFKP--------DQFYQYLPDRGFLLCEKSEE------RDV------------
RECO_COXB1      CDVEMKLPFKP--------DQFYQYLPDRGFLLCEKSEE------RDV------------
RECO_COXB2      CDVEMKLPFKP--------DQFYQYLPDRGFLLCEKSEE------RDV------------
RECO_COXBR      CDVEMKLPFKP--------DQFYQYLPDRGFLLCEKSEESE---ERDV------------
RECO_NITOC      YEAGTSRPIEA--------GQWYSYQLEKGPVRLLSEDLE-----GMK------------
RECO_METCA      VEAESGEAIRP--------ERLYSYRIDAGPV---PAGDE-----ADA------------
RECO_XYLF2      CDAN-GTPLDP--------AARYVLDPLEGPRLLLSEHNNA--ERRDT------------
RECO_XYLFT      CDAN-GTPLDP--------AARYVLDPLEGPRLLLSEHNNA--ERRDT------------
RECO_XYLFM      CDAN-GTPLDP--------AAHYVLDPLEGPRRLLSEHNNA--ERRDT------------
RECO_XYLFA      CDAN-GTPLDP--------ATRYVLDPLEGPRRLLSEHNNA--KRRDT------------
RECO_XANCB      HDSD-GQPIDP--------AARYRLDPQDGARRVLSERLAQ--DRRET------------
RECO_XANC8      HDSD-GQPIDP--------AARYRLDPQDGARRVLSERLAQ--DRRET------------
RECO_XANCP      HDSD-GQPIDP--------AARYRLDPQDGARRVLSERLAQ--DRRET------------
RECO_XANOP      HDSD-GQPIDP--------AARYRLDPEEGALRVLSERLAQ--DRRET------------
RECO_XANOR      HDSD-GQPIDP--------AARYRLDPEEGALRVLSERLAQ--DRRET------------
RECO_XANOM      HDSD-GQPIDP--------AARYRLDPEEGALRVLSERLAQ--DRRET------------
RECO_XANC5      HDSD-GQPIDP--------AARYRLDPQEGALRVLSERLAQ--DRRET------------
RECO_XANAC      HDSE-GQPIDP--------AARYRLDPQDGALRVLSERLAQ--DRRET------------
RECO_STRMK      SASD-GQPIDP--------AARYELDPQEGAQRLLSERGG---ERRAA------------
RECO_STRM5      SASD-GQPIDP--------AARYELDPQEGAQRLLSERAG---ERRAA------------
RECO_HALHL      QDVH-GEPVVA--------QARYRYSPERGADR-AGT---G--ECGVE------------
RECO_ALKEH      EDMG-GEPVHG--------EAHYRYHLEHGPER-LAAVPEA--GEGLL------------
RECO_NITHX      TCVATGTTTE----------LIYVSPKSGGAVSRQAGEP---------------------
RECO_NITWN      ACAATGATGD----------LIYVSPKSGGAVSRQAGEP---------------------
RECO_RHOP2      ACAATGATTD----------LIYVSPKSGGAVSRTAGEP---------------------
RECO_RHOPS      ACAATGATVE----------LIYVSPKSGSAVSRAAGEP---------------------
RECO_RHOPB      NCAATGVTSD----------LIYVSPKSGGAVSRAAGEP---------------------
RECO_RHOPT      ACAATGSTTE----------LIYVSPKSGSAVSRSAGEP---------------------
RECO_RHOPA      ACAATGSTTE----------LIYVSPKSGSAVSRSAGEP---------------------
RECO_BRADU      NCAVTGETTD----------LIYVSPKSGGAVSRGAGEP---------------------
RECO_RHOP5      ACAATGVTSD----------LIYVSPKSGGAVSRTAGEP---------------------
RECO_BRASO      SCAATGETSD----------LIYVSPKSGGAVSRTAGAP---------------------
RECO_BRASB      SCAATGETTD----------LVYVSPKSGGAVSRSAGAP---------------------
RECO_OLICO      CCAATGTHTD----------LIYVSPKSGCAVSRSAGEP---------------------
RECO_XANP2      TCAATGRRED----------LVYVSPKSGRAVCGEAGAP---------------------
RECO_CHESB      RCAVTGSRED----------LAYVSPKTGRAVTREAGAP---------------------
RECO_RHILO      QCAATGTRQD----------LAYVSPKSGRAVSREAGAP---------------------
RECO_BRUSU      ECAATGRKDD----------LIYVSPKSGRAVCREAGAP---------------------
RECO_BRUA2      ECAATGRKDD----------LIYVSPKSGRAVCREAGAP---------------------
RECO_BRUAB      ECAATGRKDD----------LIYVSPKSGRAVCREAGAP---------------------
RECO_BRUME      ECAATGRKDD----------LIYVSPTSGRAVCREAGAP---------------------
RECO_RHIME      RCGATGARSE----------LVYVSPKSGRAICREAGAP---------------------
RECO_SINMW      RCGATGARSE----------LVYVSPKSGRAICREAGAP---------------------
RECO_RHIL3      ECAATGARSD----------LVYVSPKSGRAVSRAAGAP---------------------
RECO_RHILW      ECAATGARSD----------LAYVSPKSGRAVSRSAGAP---------------------
RECO_RHIE6      ECAATGARSD----------LAYVSPKSGRAVSRSAGAP---------------------
RECO_RHIEC      ECAATGARSD----------LAYVSPKSGRAVSRSAGAP---------------------
RECO_AGRFC      ECAATGLRSD----------LIYVSPKTGRAVCRTAGAP---------------------
RECO_METEP      HCAATGANDA----------LVYVSPKSGRAVSASAGEP---------------------
RECO_METPB      HCAATGANDA----------LVYVSPKSGRAVSASAGEP---------------------
RECO_BEII9      ACAATGATQE----------LIYVSPKSGRAVSARAGAP---------------------
RECO_BARQU      RCAATGRQER----------LFYVSPKSGRAVCEEAGRP---------------------
RECO_BARHE      RCAATGRLEK----------LCYVSPKSGRAVCEEAGHP---------------------
RECO_BART1      CCAATGRKQK----------LYYVSPKSGRAVCEEAGEP---------------------
RECO_BARBK      HCAVTGRQEK----------LYYVSPKSGRAVCEEVGLP---------------------
RECO_RHORT      CCAVSGECGD----------LAYVSPRSGRAVGREAGAP---------------------
RECO_RHOCS      SCAATGITDND--------QLAYVSPRTGRAVSLSAGEP---------------------
RECO_CAUVC      KCAATGAFDD----------LVYVSPRTGRAVSREAGKP---------------------
RECO_CAUSK      KCAATGSLDD----------LVYVSPRTGRAVSRAAGQP---------------------
RECO_ROSDO      ACAVTGQRDD----------LIYVSPKSGRAVSAKGAGD---------------------
RECO_RUEPO      SCAVTGNSDD----------LVYVSPRSGRAVSAGAAGE---------------------
RECO_RUEST      ACAATGVTQD----------LRYVSPKTGRAVSGAAAGE---------------------
RECO_RHOS1      RCAVTGSRED----------LAFVSPKTGRAVSRGAAGG---------------------
RECO_RHOS4      RCAVTGSRED----------LAFVSPKTGRAVSSGAAGG---------------------
RECO_RHOS5      RCAVTGSRED----------LAFVSPRTGRAVGRAAAGD---------------------
RECO_JANSC      QCAATGVTQD----------LAFISPRTGRAVSRAAAGE---------------------
RECO_GLUDA      ACAVTGGSAE----------LAWVSPRTGRAVSDAAAGE---------------------
RECO_GRABC      RCAVTGQVSG----------LHYVSPRTGRAVSSDAAEP---------------------
RECO_CHLTB      SCTLCKTSLES--------STIYRYEGALFCEKHAHEETISFSQEEDH------------
RECO_CHLT2      SCTLCKTSLES--------STIYRYEGALFCEKHAHEETISFSQEEDH------------
RECO_CHLTR      SCTLCKTPLES--------STIYRYEGALFCEKHAHEETISFSQEEDH------------
RECO_CHLTA      SCTLCKTPLES--------STIYRYEGALFCEKHAHEETISFSQEEDH------------
RECO_CHLMU      SCTLCKSSLES--------STVYRHEGSLFCEKHAHEKTILFSQEEEQ------------
RECO_CHLPN      ACSLCKASLPY--------AC-YRYQGHKLCKKHQHKQAISIEKEEEQ------------
RECO_BACSU      HCVHCKSQD----------GTFHFSVRDNGFICHRCFEKDPYRIPIKP------------
RECO_BACVZ      HCVHCKSGE----------GTFHFSIRDNGFICHRCFEKDPYRVPMSP------------
RECO_BACLD      ECVHCKSKD----------GTFHFSIRDNGFICHRCFAKDPYRIPLSP------------
RECO_BACP2      QCVHCGQKE----------GQFHFSIRDNGFICQNCFSKDPYKLPLSP------------
RECO_BACC7      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDQYRIPVGE------------
RECO_BACCZ      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDQYRIPVGE------------
RECO_BACAN      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDQYRIPVGE------------
RECO_BACC0      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDQYRIPVGE------------
RECO_BACHK      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDQYRIPVGE------------
RECO_BACCR      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDPYRIPVGE------------
RECO_BACC4      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDPYRIPVGE------------
RECO_BACC2      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDPYRIPVGE------------
RECO_BACC1      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDQYRIPVGE------------
RECO_BACMK      TCAICHQET----------DFVAFSVREGGFLCSRHAEQDPYRIPVGE------------
RECO_BACCN      TCAICHQET----------DFVAFSVREGGFLCFRHAEQDPYRIPVGE------------
RECO_BACHD      QCVSCRSTD----------VPVGFSIKEAGFLCKRCIEKDPHAYKITA------------
RECO_GEOTN      RCARCGATE----------GRFSFSVKEAGFLCHRCESADPHRFPLSP------------
RECO_GEOKA      RCARCGATE----------GRFSFSVKEAGFLCHRCEASDPHRFPLSS------------
RECO_LISIN      KCAICGETT----------GHFDFSTRSNGIICHRCFDKDRYRMHLPE------------
RECO_LISW6      KCAICGETT----------GHFDFSTRSNGIICHRCFEKDRYRMHLPE------------
RECO_LISMO      KCAICGETT----------GHFDFSTSSNGIICHRCFEKDRYRMHLPE------------
RECO_LISMF      KCAICGETT----------GHFDFSTSSNGIICHRCFEKDRYRMHLPE------------
RECO_BACSK      CCACCRSETR---------DPVAFSVAYAGFLCSNCIHKDERAFPITL------------
RECO_OCEIH      QCSRCGNQE----------GLSKFSIREGGMLCQQCAYFDPEAIHISE------------
RECO_EXIS2      GCTVCGSVE----------APFAFSLNHGGLLCRRHRQEDEHAVSLTE------------
RECO_STAAM      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAA1      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAN      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAT      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAE      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAC      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAA3      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAB      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAW      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAS      RCAVSGNDTQA--------DLIGYSFKFDGAISRQEASKDVHAVILSN------------
RECO_STAAR      RCAVSGNDTQA--------DLIGYSFKYDGAISRQEASKDVHAVILSN------------
RECO_STAEQ      HCAITGIQDQS--------KLIAYSFKFDGAISESALYQDQHAFHLSN------------
RECO_STAES      HCAITGIQDQS--------KLIAYSFKFDGAISESALYQDQHAFHLSN------------
RECO_STAHJ      HSAISNSYDQS--------KLVAYSFVYDGTILESELYKDPHAFRISN------------
RECO_STAS1      RCVITQSEDQS--------KLVGYSFKYDGAISENVAYKDTHAFQLSN------------
RECO_STRSV      DCAFCHRTG----------LPFDFSFKYSGVLCPDHYHQDERRCHLNP------------
RECO_STRGC      ECVFCHRTG----------LPFDFSFKFSGVLCPDHYREDDRRCHLHP------------
RECO_STRPI      ECVFCHRVG----------QAFDFSFKYGACLCPEHYHEDKRRCHLNP------------
RECO_STRPN      ECVFCHRVG----------QAFDFSFKYGACLCPEHYHEDKRRCHLNP------------
RECO_STRPS      ECVFCHRVG----------QAFDFSFKYGACLCPEHYHEDKRRCHLNP------------
RECO_STRP4      ECVFCHRVG----------QAFDFSFKYGACLCPEHYHEDERRCHLNP------------
RECO_STRP2      ECVFCHRVG----------QAFDFSFKYGTCLCPEHYHEDERRCHLNP------------
RECO_STRR6      ECVFCHRVG----------QAFDFSFKYGTCLCPEHYHEDERRCHLNP------------
RECO_STRPD      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRPG      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRP6      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRPC      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRPB      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRP1      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRP3      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRPZ      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRPM      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRP8      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STRPF      ECAICHRTD----------LPLDFSHRFSAVLCSEHYYKDNRRNHLDP------------
RECO_STREM      DCVFCHSTN----------LPFDFSHKYSGVLCPQHYHEDEGRYGLDP------------
RECO_STRS2      ECAFCHRVG----------LPFDYSYKYSGVLCPQHYQQDERRAYLDP------------
RECO_STRSY      ECAFCHRVG----------LPFDYSYKYSGVLCPQHYQQDERRAYLDP------------
RECO_STRMU      DCVFCHRVG----------LAFDFSHRYSGLLCPEHYEKDLYRSHLDP------------
RECO_STRA5      DCVFCHRVG----------LPFDFSHKYSGLLCPNHYYKDERRNHLDP------------
RECO_STRA3      DCVFCHRVG----------LPFDFSHKYSGLLCPNHYYKDERRNHLDP------------
RECO_STRA1      DCVFCHRAG----------LPFDFSHKYSGLLCPNHYYKDERRNHLDP------------
RECO_STRT2      ECVFCHRVG----------LPFDFSYKFSGLLCPNHYEEDERRSHLDP------------
RECO_STRT1      ECVFCHRVG----------LPFDFSYKFSGLLCPNHYEEDERRSHLDP------------
RECO_STRTD      ECVFCHRVG----------LPFDFSYKFSGLLCPNHYEEDERRSHLDP------------
RECO_LACLS      ECAFCHKTV----------GPFDFSYKFSGCLCPRHFDEDLRRSHLDP------------
RECO_LACLM      ECAFCHKTV----------GPFDFSYKFSGCLCPRHFDEDLRRSHLDP------------
RECO_LACLA      ECAFCHKTV----------GPFDFSYKFSGCLCPQHFDEDLRRSHLDP------------
RECO_ENTFA      HCVACGETQ----------GKFDYSSKYSGVLCEKHWHLDEQRYHADP------------
RECO_LACBA      GCAVCGRND----------LPFDYSESYGGLLCQAHWTLDPRRLHVSQ------------
RECO_LACPL      WCTVCGRSD----------LPLDYSESYGGLLCQQHWHLDPHRLHASP------------
RECO_LACSS      GCAVCGRTD----------LAFDYSESYGGLLCQRHWHLDPNRFHSSQ------------
RECO_LACRD      RCVVCGRND----------LALDFSEQYGGMLCQNHWSLDEHRLYLDR------------
RECO_LACRJ      RCVVCGRND----------LALDFSEQYGGMLCQNHWSLDEHRLYLDR------------
RECO_LACF3      RCVVCGRSD----------LPLDYSEKMGGMLCLHHFAEDPYRFHLTP------------
RECO_LACS1      SCVICGETQ----------SQFDYSESYGGILCRKHWYMDKNRLNLDQ------------
RECO_PEDPA      HCVICGRTD----------LPLDYSEAFGGMLCQSHWERDEHRWHLKP------------
RECO_LEUMM      ADPITGQVD----------GKFDYSEKYNGIISEHHFNLDDQRLMLDQ------------
RECO_LEUCK      QDPISGQSV----------GQFDYSEKYNGIISDKHYDLDDHRLMLDQ------------
RECO_OENOB      SDPINGQTE----------GEFDFSEQYNGILSKKNYHLDDRRLHANP------------
RECO_LACAC      HCVICGKEK----------GIFDYSIKLGGVICSDHFNVVESRLHLKP------------
RECO_LACH4      HCVICGKER----------GVFDYSIKLGGIVCSDHFAKVNSRLHLTP------------
RECO_LACJO      RCLICGKVQ----------GKFDYSLELGGIICSDHFNSVSQRMHLDP------------
RECO_LACGA      RCLICGKVQ----------GTFDYSLELGGIICSDHFNSVSQRMHLDP------------
RECO_LACDB      ACVICGKEK----------GIFDYSIAAGGVVCSDHFRSV-SRLHLSP------------
RECO_LACDA      ACVICGKEK----------GIFDYSIAAGGVVCSDHFRSV-SRLHLSP------------
RECO_CLOPS      NCVFCKNKLS---------VSNYISLRYFGGVCDKCP--KEHGLYINK------------
RECO_CLOP1      NCVFCKNKLS---------VSNYISLRYFGGVCDKCP--KEHGLYINK------------
RECO_CLOPE      NCVFCKNKLS---------VSNYISLRYFGGVCDKCP--KEHGLYINK------------
RECO_CLONN      KCCICGKRIN---------KTNYLSIQYYGGVCDNCE--KTGGFKISY------------
RECO_CLOK5      YCALCRKKIT---------SFEYLHLQYLGGICRECD--KENSMHISY------------
RECO_CLOAB      YCSKCKKRIN---------SASYISYKYYGGICGDCS--KEGGMSVTP------------
RECO_ALKMQ      SCVSCGQTSS---------NSWRFSSKEGGLICHQCHGIDSFSIKINV------------
RECO_ALKOO      SCVNCDSKET---------TAWKFSATEGGLLCSSCYSADLFAMKISN------------
RECO_CLOD6      KCINCECKIL---------QNSVFNIYEGGILCSKCSKLFDNNIKLDL------------
RECO_HUNT2      SCIKCGSTVF---------DSMYFSFLKCGFLCSKCLENDKGALKISE------------
RECO_CALS8      QCVKCQKSNL---------SRIFFSFKNAGVVCAECKEEND--MEISL------------
RECO_THEPX      NCVVCGKRE----------NLKYFSNSCGGAVCINCKNKCFDAKPLHE------------
RECO_THEP3      NCVVCGKRE----------NLKYFSNSCGGAVCINCKNKCFDAKPLHE------------
RECO_CALS4      SCAVCGKKE----------NLSYFSSSCGGAVCKDCNETCKDAKFLNK------------
RECO_NOSS1      ICCLTQRSLTPDFAD--PNWRVGFSIASGGIVCLEAWEGLRKEARKESKEK----SLPHP
RECO_TRIV2      ICCLTQRLLTPNFVD--PNWRVGFSIAAGGIVCLEAWEGLRKEAQKESREK----SLPHP
RECO_NOSP7      ICCLSGRSLKPDFTE--PNWQIGFSVPTGGTICLEAWKRLRTEGKGEINNQYPIPHIPLP
RECO_TRIEI      QCCATGNELQPDFNN--SKWQVGFSIDAGGIIKVDETSVVQSFCKDLSDYY---------
RECO_GLOC7      QCCLSREPIETNFID--SLWRVGFSFESGGAINLSSDRRQPFQPSDD-------------
RECO_RIPO1      RCCLTQETLAANFSD--PRWRVGFSFEGGGLINLS-----PQNPP---------------
RECO_SYNY3      HCAITAQTISPNFYD--RQWRVGFSPELGGIVDLR-------SSR---------------
RECO_ACAM1      ACCVTHQPLDPPTSN--PTWRVGFSAGAGGTVTLTGPPRPRTAIQQAAEQA---------
RECO_SYNP6      YCCLTQQAVQPRLEQ--SRWRVRYSPSLGGVLADTAAYQRRPNQR---------------
RECO_SYNE7      YCCLTQQAVQPRLEQ--SRWRVRYSPSLGGVLADTAAYQRRPNQR---------------
RECO_THEEB      QCHESGCKIAVPTAD--TDWRLGFSFAGGGVFRIRADHPVGNESV---------------
RECO_SYNJB      ACYFCQGGL---------VGSVFFSPQWGGLICDPCRVAQRPSPI---------------
RECO_SYNJA      ACYSCGEEL---------AGEAFFSPHAGGLVCDPCRLAQRLSPV---------------
RECO_GLOVI      FCTVSHRPIS--------AESAGFSVEGGGLVALECLSHERVG-----------------
RECO_NOCFA      ECAKCATP----------GPHRAFHVAAGGAVCVHCRPPGAATPA---------------
RECO_RHOJR      DCARCSAP----------GPHRAFHVAAGGAVCVHCRPPGAATPS---------------
RECO_MYCSK      ECARCATP----------GPHRAFHVAAGGSVCVHCRPSGSVTPP---------------
RECO_MYCSS      ECARCATP----------GPHRAFHVAAGGSVCVHCRPSGSVTPP---------------
RECO_MYCSJ      ECARCATP----------GPHRAFHVAAGGSVCVHCRPSGSVTPP---------------
RECO_MYCS2      ECARCAAP----------GPHRAFHVAAGGSVCVHCRPSGSSTPP---------------
RECO_MYCGI      ECARCAAP----------GPHRAFHVAAGGSVCVHCRPSGSVTPP---------------
RECO_MYCA9      ECARCATP----------GPHRAFHVAAGGSVCVHCRPAGAVTPP---------------
RECO_MYCMM      ECARCATP----------GPHRAFHIAAGGSVCPHCRPAGSTTPP---------------
RECO_MYCUA      ECARCATP----------GPHRAFHIAAGGSVCPHCRPAGSTTPP---------------
RECO_MYCTA      ECARCATP----------GPHRAFHIATGGSVCAHCRPAGSTTPP---------------
RECO_MYCTU      ECARCATP----------GPHRAFHIATGGSVCAHCRPAGSTTPP---------------
RECO_MYCBP      ECARCATP----------GPHRAFHIATGGSVCAHCRPAGSTTPP---------------
RECO_MYCBO      ECARCATP----------GPHRAFHIATGGSVCAHCRPAGSTTPP---------------
RECO_MYCPA      ECARCATP----------GPHRAFHVGAGGSVCPHCRPAGSTTPP---------------
RECO_MYCLE      ACARCATP----------GPHRAFHIAAGGSVCVHCRPAGSTTPP---------------
RECO_SACEN      ECARCNAR----------GPHAAFNVAAGGAVCAECRPAGSVRPS---------------
RECO_STRCO      DCAKCGMP----------GPNRFFSVGSGGSVCVDCRVPGSVVPS---------------
RECO_STRAW      NCAKCGMP----------GPNRFFSVAAGGSVCVDCRVPGSVVPS---------------
RECO_STRGG      DCAKCGMP----------GPNRFFSVAAGGVICGDCRVPGSVVPS---------------
RECO_THEFY      ECAHCGVP----------GPHREFAVHAGGMVCSLCRPAGSVKPS---------------
RECO_NOCSJ      HCARCGTLSAE-------GAHRWFNPSMGGMLCSTCRVPGSASPA---------------
RECO_FRACC      HCARCGGP----------GLHLSLSVPGGGVVCPQCRPHGAASVS---------------
RECO_LEIXX      DCSRCGRP----------GPHRQVVVQLGGVVCPDCAPQGASRVD---------------
RECO_CUTAK      DCVRCGTP----------GPHQGFSPSLGGVVCINCQPPGTPHPH---------------
RECO_BIFLO      TCVVCGKAEPA-----------YLSIASGGVMCEADHTTDARRIA---------------
RECO_BIFLD      TCVVCGKAEPA-----------YLSIASGGVMCEADHTTDARRIA---------------
RECO_BIFAA      VCVVCGEPISS-------ALSWYFSIPAGGLMCAADHTPESEAVS---------------
RECO_RUBXD      GCAECGGDVP--------GEGARFAPAAGGFLCRDCRSDAPPDSF---------------
RECO_PELTS      RCSHCQGAL---------AGPLFFSSSLGGAVCGLCVAFAAN------------------
RECO_DESAP      SCAGCGAQP---------VVPARFSPALGGVLCRGCRDRDPP------------------
RECO_DESRM      NCSVCGAEIR--------ETKVSFAVQQGGILCKDCATHEKR------------------
RECO_MOOTA      ACALCQRELKG-------NGRVAIAPAAGGALCPECRGHQGR------------------
RECO_SYMTH      ACVGCGSEAVQQ------NGGVRFAPVLGGVLCPQCTDEGEG------------------
RECO_DESHY      ECAECGQRVQ--------GERLLFSPDAGGVVCRQCQTQGSSPAV---------------
RECO_HELMI      LCLDCGEPVEIAD----SGPWPAYSPEMGGLVGNCCRHRHSE------------------
RECO_HERA2      DCANCERELS--------PDADRYSPITGGVLCQQCSSNEPR------------------
RECO_ROSS1      ECAACGAVLT--------EATNRFSPVTGGALCPDCAGVDRL------------------
RECO_DEHMC      ECANCHKKLQ--------ATINYYSPESGGVICPNCRNTQ-I------------------
RECO_DEHMB      ECANCHKKLQ--------ATINYYSPESGGVICPNCRNTQ-I------------------
RECO_DEHM1      ECANCHQKLL--------ATTNYFSPESGGIICPDCRNTQ-T------------------
RECO_ANASK      ACARCGAPVG-E-------GPVRFDAGEGGALCAGCAP--GVPRTLP-------------
RECO_ANADE      ACARCGAPVG-E-------GPVRFDAGEGGALCGGCAP--GVPRTLP-------------
RECO_ANADF      ACVACGGALGPE-------GRVRFDPGQGGVLCPPCAP--AAAPGAPW------------
RECO_MYXXD      SCSLCGGAPG---------ERPRFDQAHGGAVCEPCGV--RARESVA-------------
RECO_GEOMG      HCASCGVELP-A-------TAERRTGASGMILCANCGR--YGASVGPE------------
RECO_GEOSL      ACAACGVEFP-A-------DAARRAGAAGTVLCTGCGR--YGAPLSAE------------
RECO_GEOUR      RCAACDADLAGA-------LVLRWSPSSAGVLCGRCGK--TGRPIASQ------------
RECO_PELPD      ACSRCGTPFDDR-------GALLLD--DGELVCRACTG--HGRDMTQV------------
RECO_DESAL      QCVLCCRSLEDW-----GQGGICFDHARGGIVCPKCG---VCLAPGPV------------
RECO_DESOH      ACRVCKTEIDRLS----GSPTLYLDIARGGIVCHRCGGEGAGSQYRKP------------
RECO_PROA2      QCVISGEPLIPAAEAMAPDENLYFLFDPGGIAFAGPSALIRSEKRALP------------
RECO_CHLPB      QCVTTGKSILPMLQEGSADD-LCLTYDPGGVSLPVPAAQKGPPGQRLP------------
RECO_CHLL2      RCVYSGEPLSAAAETMMLRE-LSFVMNPGGVALPAAALRQISQQHSIT------------
RECO_CHLPD      RCVLSHEEISPATLAENKGE-LCFLFNPGGVALPASKSVIENENRPLS------------
RECO_PELPB      TCVFSGEELLPAIEALQLTE-LYFVMNPGGLALPKAAGSSLAKKQLIP------------
RECO_CHLP8      RCVFSNYDLLGSIEEMQLDE-LLFVHDPGGFALPGSAVPMGATIQRVP------------
RECO_PELCD      HCCKCGASFTS--------ETVAFAASLGGSLCLDCVTGVDVQYLSLL------------
RECO_SYNWW      HCVLCGKKDD----------LKVFSLPDGGMLCRDCSYQASGAVSLSK------------
RECO_SYNAS      CCMICKAPLNPQ-------QRYVFNIAQGGLHCRSCYTTPAAPDVLPI------------
RECO_SYNFM      NCGICGRSLRSA-------TKWCWQVDRGLLACPDHPVERVRALELDL------------
RECO_CARHZ      HCAVCRKPYRG--------EVWYFGAGEGGIVCPSCRPIEGIYFEIFP------------
RECO_KORVE      HCVVCGEELDD---------RAFFHPLVDGLVCANDKRLASTELTVES------------
RECO_RHOBA      RCTVCGRDAERS------RRRASFSLVGGGVVCENCRPSQSHLMTASW------------
RECO_SALRD      RTRVEAVTGDE----------GLLSLADGGVYPADGTPDQPKRASRAA------------
RECO_SYNSC      TCCITGDPLEP---------PLGQWDWRCSLLAQDGFAIDEQPGAAIQLN----------
                                                                            

RECO_ECOL6      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_SHIDS      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOUT      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOLI      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOLC      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECO5E      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECO45      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOK1      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECODH      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECO57      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOL5      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_SHIFL      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_SHIF8      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECO24      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOSM      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECO7I      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECO8A      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOHS      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOSE      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ESCF3      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_SHISS      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_ECOLU      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_SHIBS      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_SHIB3      -----------------------FTGRQLKALNAREFPDA-----------------DTL
RECO_SALEP      -----------------------FTGRHLKALEEREFPDV-----------------DTL
RECO_SALG2      -----------------------FTGRHLKALEEREFPDV-----------------DTL
RECO_SALDC      -----------------------FTGRHLKALEEREFPDV-----------------DTL
RECO_SALA4      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALPB      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALTI      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALNS      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALCH      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALTY      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALHS      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALPK      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALPA      -----------------------FTGRHLKALEAREFPDV-----------------DTL
RECO_SALSV      -----------------------FTGRHLKALDAREFPDV-----------------DTL
RECO_KLEP7      -----------------------FTGHHLKALASREFPDV-----------------DTL
RECO_KLEP3      -----------------------FTGHHLKALASREFPDV-----------------DTL
RECO_ENT38      -----------------------FTGRHLRALSEREFPDQ-----------------DTL
RECO_CROS8      -----------------------FTGRQLKALATREFPDV-----------------DTL
RECO_ERWT9      -----------------------FTGRQLRALSTREFPDA-----------------DTL
RECO_YERPB      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERPN      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERPS      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERPA      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERPE      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERP3      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERPG      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERPY      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERPP      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_YERE8      -----------------------FTGRQLLALANREFPDA-----------------DTL
RECO_PROMH      -----------------------FTGLELKSLAKREFPTA-----------------GTL
RECO_PHOLL      -----------------------FTGRELKSLATREFPDS-----------------ATL
RECO_PECAS      -----------------------FTGHELHSLASREFPDV-----------------GTL
RECO_SERP5      -----------------------FTGRELRALAERQFPDV-----------------QTL
RECO_SODGM      -----------------------FSGRELRALAEGEFPDI-----------------DTL
RECO_VIBCH      -----------------------FLGNELIAISERRFTSK-----------------EQL
RECO_VIBC3      -----------------------FLGNELIAISERRFTSK-----------------EQL
RECO_VIBVY      -----------------------FLGNELIAISERRFLTK-----------------EQL
RECO_VIBVU      -----------------------FLGNELIAISERRFLTK-----------------EQL
RECO_VIBPA      -----------------------FLGNELIAISERRFVTK-----------------EQL
RECO_ALIF1      -----------------------FKGNELIAISERRFTTP-----------------EQL
RECO_ALIFM      -----------------------FKGNELIAISERRFTTP-----------------EQL
RECO_ALISL      -----------------------FKGDELIAISERRFITP-----------------EQL
RECO_PHOPR      -----------------------FTGNQLLAIAARRFETP-----------------DQL
RECO_ACTP2      -----------------------FLGKDLLAFEQLNFSDK-----------------ATL
RECO_ACTPJ      -----------------------FLGKDLLAFEQLDFSDK-----------------ATL
RECO_ACTP7      -----------------------FLGKDLLAFEQLDFSDK-----------------ATL
RECO_HAEDU      -----------------------FCGKDLLAFEKGDFSDT-----------------DTL
RECO_HAEI8      -----------------------FYGRDLLAFEALDFSDD-----------------AVR
RECO_HAEIE      -----------------------FYGRDLLAFEALDFSDD-----------------AVR
RECO_HAEIG      -----------------------FYGRDLLAFEALDFSDD-----------------AVR
RECO_HAEIN      -----------------------FYGRDLLAFEALDFSDD-----------------AVR
RECO_MANSM      -----------------------FFGRELIAFERQDFSEK-----------------SVL
RECO_ACTSZ      -----------------------FYGRDLLAFEARDFRDP-----------------AVR
RECO_PASMU      -----------------------FYGRELLAFDARQFHDS-----------------ATL
RECO_PSYIN      -----------------------YSGQDILALAQRDFSNQ-----------------NVL
RECO_IDILO      -----------------------YSVADIQKLAAWDVDDE-----------------NRL
RECO_PSEA6      -----------------------YSGQSLLNVASENW-DK-----------------DSL
RECO_HAHCH      -----------------------IEGHHLIAIAGRDWSVP-----------------GSL
RECO_MARHV      -----------------------LPGEALLALAAGDFISE-----------------APR
RECO_CELJU      -----------------------IAGAHLLAIAAGDYSAA-----------------DTR
RECO_PSEA8      -----------------------FQGSELLSMADADWSAP-----------------GAL
RECO_PSEAE      -----------------------FQGSELLSMADADWSAP-----------------GAL
RECO_PSEAB      -----------------------FQGSELLSMADADWSAP-----------------GAL
RECO_PSEA7      -----------------------FQGVELLSMADADWSAP-----------------GAL
RECO_PSEU5      -----------------------FNGAELLAMAEADWQVP-----------------GAL
RECO_PSE14      -----------------------FQGAELLAMSEADWSVP-----------------GAL
RECO_PSEU2      -----------------------FQGAELLAMSEADWSVP-----------------GAL
RECO_PSESM      -----------------------FQGAELLAMSDADWSVP-----------------GAL
RECO_PSEPF      -----------------------FNGTELLAMAEADWSAP-----------------GAL
RECO_PSEF5      -----------------------FNGTELLAMADADWSAP-----------------GAL
RECO_PSEP1      -----------------------FRGIELLALAEADWDAP-----------------GAL
RECO_PSEPK      -----------------------FRGIELLALAEADWDAP-----------------GAL
RECO_PSEPG      -----------------------FRGTELLALAEANWEAP-----------------GAL
RECO_PSEE4      -----------------------FKGSELLALAEADWDAP-----------------GAL
RECO_PSEPW      -----------------------FNGAELLALAQADWDAP-----------------GAL
RECO_CUPMC      -----------------------VSGQTLLDMAQDDYSRA-----------------QTV
RECO_CUPPJ      -----------------------VSGQTLLDMSQDDYGRA-----------------QTA
RECO_BURPS      -----------------------IAGQTLLDMEEDDYHRA-----------------QTV
RECO_BURP1      -----------------------IAGQTLLDMEEDDYHRA-----------------QTV
RECO_BURMA      -----------------------IAGQTLLDMEEDDYHRA-----------------QTV
RECO_BURTA      -----------------------IAGQTLLDMEEDDYHRA-----------------QTV
RECO_BURCA      -----------------------ITGQTLLDMEQDDYHRA-----------------QTV
RECO_BURL3      -----------------------ISGQTLLDMEQDDYHRA-----------------QTV
RECO_PARXL      -----------------------IAGQTLLDMEQDDYHRA-----------------QTV
RECO_NITMU      -----------------------LSGKTLLDMYQGDYLAP-----------------LTR
RECO_AZOSB      -----------------------VSGQTLLDMAAGDFSRS-----------------ETL
RECO_AROAE      -----------------------VSGQTLLDMAHGDFSRA-----------------ETL
RECO_DECAR      -----------------------VRGKTLLDLDAEDFSDP-----------------RTR
RECO_THIDA      -----------------------VSGQTLLDLAGDSFERL-----------------ATL
RECO_POLSJ      -----------------------ALQQALGDNALFSDTVR--------------ACIPGL
RECO_POLNA      -----------------------ALQQALGGKSLFSDTLQ--------------ACVACA
RECO_RHOFT      -----------------------ALQQSLVDSAPFTATLR--------------ACSEVM
RECO_ACIAC      -----------------------QLERSLGEAQPYTATLRAIVAGL-------AASASPA
RECO_ACISJ      -----------------------ALQGALDEPARYTATLRAIAT----------AEAPVA
RECO_VEREI      -----------------------VLQHALDDAASHQATVR--------------ACAPVC
RECO_DELAS      -----------------------AIESALQARQAFNATLHVV------------AQPEQA
RECO_NEIMB      -----------------------APGQSLIDLREGSFRTA-----------------ESL
RECO_NEIMA      -----------------------APGQSLIDLREGSFRTA-----------------ESL
RECO_NEIG1      -----------------------VEGQSLIDLREGSFRTA-----------------ESL
RECO_NEIG2      -----------------------VEGQSLIDLREGSFRTA-----------------ESL
RECO_NEIMF      -----------------------VEGQSLIDLREGSFRTA-----------------ESL
RECO_CHRVO      -----------------------LPGEALLALDADDYREP-----------------ATR
RECO_COXBN      -----------------------FSGKSLLALQEESFSDE-----------------SSL
RECO_COXBU      -----------------------FSGKSLLALQEESFSDE-----------------SSL
RECO_COXB1      -----------------------FSGKSLLALQEESFSDE-----------------SSL
RECO_COXB2      -----------------------FSGKSLLALQEESFSDE-----------------SSL
RECO_COXBR      -----------------------FSGKSLLALQEESFSDE-----------------SSL
RECO_NITOC      -----------------------VRGHTLQALARGALADP-----------------ASL
RECO_METCA      -----------------------VHGMTLLALRDRRFDTS-----------------QTR
RECO_XYLF2      -----------------------ATGHVLLALAHKQIP-----------------NTNDL
RECO_XYLFT      -----------------------ATGHVLLALAHKQIP-----------------NTNDL
RECO_XYLFM      -----------------------ATGHVLLALAHKQIP-----------------NTNDL
RECO_XYLFA      -----------------------ATGHVLLALARNQIP-----------------NTNDL
RECO_XANCB      -----------------------VTGAALLALGEDRVP-----------------ATEDM
RECO_XANC8      -----------------------VTGAALLALGEDRVP-----------------ATEDM
RECO_XANCP      -----------------------VTGAALLALGEDRVP-----------------ATEDM
RECO_XANOP      -----------------------VTGAALLALGEDVMP-----------------AAEDM
RECO_XANOR      -----------------------VTGAALLALGEDVMP-----------------AAEDM
RECO_XANOM      -----------------------VTGAALLALGEDVMP-----------------AAEDM
RECO_XANC5      -----------------------VTGAALLALGEDVMP-----------------DADDM
RECO_XANAC      -----------------------VTGAALLALGQDVMP-----------------DADDM
RECO_STRMK      -----------------------ATGSALLALAADEEP-----------------AAADL
RECO_STRM5      -----------------------ATGSALLALAADEEP-----------------DAADL
RECO_HALHL      -----------------------VSGATLLALAATEGQGL--------------SEEPVR
RECO_ALKEH      -----------------------VRGRTLLALAGREAL-----------------AGPSL
RECO_NITHX      ------------------------WRDRLLRLPPFLRE--ADEEQ-S-GWSDQDLLDGFE
RECO_NITWN      ------------------------WRDRLLPLPPFLRV--THDEQ-D-GWSEQDLLDGFE
RECO_RHOP2      ------------------------WREKLLRLPDFLRE--DNDGR-N-GWSDQDLRDGFD
RECO_RHOPS      ------------------------WRDKLLRLPAFLRD--DNDGR-N-GWSDQDLRDGFD
RECO_RHOPB      ------------------------WRDKLLRLPPFLRE--GSAQR-N-DWSDQDLQDGFL
RECO_RHOPT      ------------------------WRDRLLRLPAFLRD--DEAESGN-GWSGQDLFDGFE
RECO_RHOPA      ------------------------WRDRLLRLPAFLRD--DEAESGH-GWSGQDLFDGFE
RECO_BRADU      ------------------------WRDRLLRLPPFLRH--GETAT---ELTDQDLQDGFR
RECO_RHOP5      ------------------------WRDKLLRLPPFLRE--DEDAA---GCTADDLRDGFA
RECO_BRASO      ------------------------WADRLLPLPPFLRE--SDEDH---GWSDQDLLDGFR
RECO_BRASB      ------------------------WADRLLPLPPFLRE--SEDDH---GFSDQDLLDGFR
RECO_OLICO      ------------------------WRERLLPLPAFLRA--GNEES-S-PDGEADIMEGFR
RECO_XANP2      ------------------------YADRLFALPRFLVD--GTAPP------AGDVEDALR
RECO_CHESB      ------------------------WADKLLPLPTFLTA--GNEAL----YDRAILSQAFA
RECO_RHILO      ------------------------WRDKMLALPAFLQR--GSGLR----ADPAAVEDAFR
RECO_BRUSU      ------------------------WAEKLLSLPSFVND--TALRA----SCYDDLDRAFT
RECO_BRUA2      ------------------------WAEKLLSLPSFVND--TALRA----SCYDDLDRAFT
RECO_BRUAB      ------------------------WAEKLLSLPSFVND--TALRA----SCYDDLDRAFT
RECO_BRUME      ------------------------WAEKLLSLPSFVND--TALRA----SCYDDLDRAFT
RECO_RHIME      ------------------------YADRMLALPDFLS---GGSRA----ADHESLAAAFR
RECO_SINMW      ------------------------YAERMLALPDFLS---GQNRA----ADHESLAAAFR
RECO_RHIL3      ------------------------WADKMLLLPPFLSI--EGNHA----ADFDSLSAAFR
RECO_RHILW      ------------------------WADKMLLLPPFLGI--EGNHA----ADFDSLSAAFR
RECO_RHIE6      ------------------------WADKMLLLPPFLGV--EGNHA----ADFDSLAAAFR
RECO_RHIEC      ------------------------WADKMLLLPPFLGV--EGNHA----ADVDSLAAAFR
RECO_AGRFC      ------------------------YAARMLALPAFLGE--GQSKA----ADPESLAAAFR
RECO_METEP      ------------------------FRDRLLPLPPFLRDRDQPGSGWR-TPDTHDVREGFT
RECO_METPB      ------------------------FRDRLLALPPFLRDRDQPGSGWR-TPDAHDVREGFT
RECO_BEII9      ------------------------YHDKLLGLPPFFLD----GSLLK-NPTLEEVEAGFA
RECO_BARQU      ------------------------WKEKLLTLPQFLVR--RAIRP----VNFSDIINGFI
RECO_BARHE      ------------------------WREKLLNLPQFLVQ--RTVRP----VDFSDIKNGFI
RECO_BART1      ------------------------WKKKLLILPQFLVQ--RATRP----ADFRDIINGFN
RECO_BARBK      ------------------------WKNKLLLLPKFLIE--RTNRP----VDFDDIRNGFT
RECO_RHORT      ------------------------WQARLLALPAFLLS-----PAEV-PANAQAVGDGLR
RECO_RHOCS      ------------------------YRDRLLALPPFLVG-----RS---AGGAEEVVQGLA
RECO_CAUVC      ------------------------YHDKLLPLPPFMLS-----SQG--GLAEGDVKAGLD
RECO_CAUSK      ------------------------YHDKLLPLPPFMLS-----AQG--GLVEGDVKAGLD
RECO_ROSDO      ------------------------WADRLLPLPPILRG-----IGG---GPDAEIAQAFI
RECO_RUEPO      ------------------------WAERLLPLPPCLRG-----EGP---APDPEIAQALR
RECO_RUEST      ------------------------WADRLLPLPPVMRG-----EGA---AEDIEILTALR
RECO_RHOS1      ------------------------WADRLFPLPLALLG-----QGP---ASAEEVRQGLA
RECO_RHOS4      ------------------------WADRLFPLPLALLG-----QGP---ASAEEVRQGLA
RECO_RHOS5      ------------------------WADRLFPLPLALLG-----QGP---ASGPEVRQGLA
RECO_JANSC      ------------------------WADRLLPLSPALEG-----MAR---GPE-DILAGLA
RECO_GLUDA      ------------------------WRPRLLRLPPLFLD-----ESDP--GTVQDWRDGLR
RECO_GRABC      ------------------------WLDRLLPLPAFLLH-----QAET-DSDPVAWRDGLR
RECO_CHLTB      -----------------------ILRVIVQAKKFQELVCL----------------AEFP
RECO_CHLT2      -----------------------ILRVIVQAKKFQELVCL----------------AEFP
RECO_CHLTR      -----------------------ILRVIVQAKKFQELVCL----------------AEFP
RECO_CHLTA      -----------------------ILRVIVQAKKFQELVCL----------------AEFP
RECO_CHLMU      -----------------------ILRIIVQAKKFQELMCL----------------AEFP
RECO_CHLPN      -----------------------ILQAIIHAKQFSELLAI----------------AEFP
RECO_BACSU      -----------------------QTARLLRLFYYFDLSRLGNVSLKE----------ETK
RECO_BACVZ      -----------------------QTARLLRLFYYFDIGRLGSVSLKQ----------ETK
RECO_BACLD      -----------------------ASARLLRLFFYFDLSRLGNVSVKQ----------ETK
RECO_BACP2      -----------------------AAARLLRLFHYFDLSRLGQVDVKP----------QTK
RECO_BACC7      -----------------------AVHKLLRLFYHFDLHRLGNVSVKD----------STK
RECO_BACCZ      -----------------------AVHKLLRLFYHFDLHRLGNVSVKD----------STK
RECO_BACAN      -----------------------AVHKLLRLFYHFDLHRLGNVSVKD----------STK
RECO_BACC0      -----------------------AVHKLLRLFYHFDLHRLGNVSVKD----------STK
RECO_BACHK      -----------------------AVHKLLRLFYHFDLHRLGNVSVKD----------STK
RECO_BACCR      -----------------------AVHKLLRLFFHFDLHRLGNVSVKD----------STK
RECO_BACC4      -----------------------AVHKLLRLFFHFDLHRLGNVSVKD----------STK
RECO_BACC2      -----------------------AVHKLLRLFFHFDLHRLGNVSVKD----------STK
RECO_BACC1      -----------------------AVHKLLRLFYHFDLHRLGNVSVKD----------STK
RECO_BACMK      -----------------------AVHKLLRLFFHFDLHRLGNVSVKD----------STK
RECO_BACCN      -----------------------AVHKLLRLFYHFDLGRLGNVSVKD----------ETK
RECO_BACHD      -----------------------QVAKLLRLFYHFDLQRLGTISLKP----------ETK
RECO_GEOTN      -----------------------ASIRLLRLFYHIDLTRLGAISVKE----------GTK
RECO_GEOKA      -----------------------ASVRLLRLFFHIDLARLGSISVKE----------STK
RECO_LISIN      -----------------------NVVKLLRLFFIFQLDRLGNIDVKQ----------ETK
RECO_LISW6      -----------------------NVVKLLRLFFIFQLDRLGNIDVKQ----------ETK
RECO_LISMO      -----------------------NVVKLLRLFFIFQLDRLGNIDVKQ----------ETK
RECO_LISMF      -----------------------NVVKLLRLFFIFQLDRLGNIDVKP----------ETK
RECO_BACSK      -----------------------PFAKLFRVLYYVDLTKVGTISVKA----------ETK
RECO_OCEIH      -----------------------KLSRLLYLFSEVDLKRIGNIRMKK----------ENV
RECO_EXIS2      -----------------------SVAKMLYVFSVYDFSRIGTVDVKP----------ETK
RECO_STAAM      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAA1      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAN      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAT      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAE      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAC      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAA3      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAB      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAW      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAS      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAAR      -----------------------KTLYLLDVLQKLPIDKMNSLNIHQ----------EII
RECO_STAEQ      -----------------------RTLYLLNILQQLPISKMNHLNIQQ----------DIL
RECO_STAES      -----------------------RTLYLLNILQQLPISKMNHLNIQQ----------DIL
RECO_STAHJ      -----------------------KTLYLLDVLQKLPIDKMNQFNISQ----------EIL
RECO_STAS1      -----------------------KTLYLLDILQKLPINQMSSLSIHE----------TIV
RECO_STRSV      -----------------------NLPFLLDQFQAVRFSELETISLKP----------DIK
RECO_STRGC      -----------------------NIPFLLDQFQAVEYSTLETISLKA----------EIK
RECO_STRPI      -----------------------NIPYLLNQFQAIDFETLETISLKP----------GIK
RECO_STRPN      -----------------------NIPYLLNQFQAIDFETLETISLKP----------GIK
RECO_STRPS      -----------------------NIPYLLNQFQAIDFETLETISLKP----------GIK
RECO_STRP4      -----------------------NIPYLLNQFQAIDFETLETISLKP----------GIK
RECO_STRP2      -----------------------NIPYLLNQFQAIDFETLETISLKP----------GIK
RECO_STRR6      -----------------------NIPYLLNQFQAIDFETLETISLKP----------GIK
RECO_STRPD      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRPG      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRP6      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRPC      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRPB      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRP1      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRP3      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRPZ      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRPM      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRP8      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STRPF      -----------------------NVIYLLSRFQKITFDDLRTISLNK----------DIK
RECO_STREM      -----------------------NVIYLINRFQTINIDELKTISVNA----------DMK
RECO_STRS2      -----------------------NVPYLLDQFQAISFDELETISIKP----------EMK
RECO_STRSY      -----------------------NVPYLLDQFQAISFDELETISIKP----------EMK
RECO_STRMU      -----------------------NVPYLLNQFQTLHFDSLKTISVKP----------DMK
RECO_STRA5      -----------------------NMLYLINRFQSIQFDDLQTISVKP----------EMK
RECO_STRA3      -----------------------NMLYLINRFQSIQFDDLQTISVKP----------EMK
RECO_STRA1      -----------------------NMLHLINRFQSIQFDDLQTISVKP----------EMK
RECO_STRT2      -----------------------NVPYLLDRFQGLSFEELRSISVKD----------EMK
RECO_STRT1      -----------------------NVPYLLDRFQGLSFEELRSISVKD----------EMK
RECO_STRTD      -----------------------NVPYLLDRFQGLSFEELRSISVKD----------EMK
RECO_LACLS      -----------------------NVIYLINLFQEISLDELKKISIKA----------EMK
RECO_LACLM      -----------------------NVIYLINLFQEISLDELKKISIKA----------EMK
RECO_LACLA      -----------------------NVIYLVNLFQEISLDELKKISIKA----------DMK
RECO_ENTFA      -----------------------RAIHFIRLFSQVSYEKVQNIQVKE----------ETK
RECO_LACBA      -----------------------RTIYYLRQFSVLDLDRLHTIKVKP----------QTE
RECO_LACPL      -----------------------AAIFYLRQFSVLDLAKVHSIKVKP----------RTA
RECO_LACSS      -----------------------RAIYYLRLFSVIDLFKIQSVNVKE----------ATQ
RECO_LACRD      -----------------------KTAYYLQQFATINLQKLNSIRINP----------ATK
RECO_LACRJ      -----------------------KTAYYLQQFATINLQKLNSIRINP----------ATK
RECO_LACF3      -----------------------KTVAYLRLFATLNLAKVDQVHVDE----------ATK
RECO_LACS1      -----------------------RTMYYLRKFSIVDLNYLNSIKVNA----------DTK
RECO_PEDPA      -----------------------KSARIIGILSAVSIFKLGQISISK----------ETK
RECO_LEUMM      -----------------------KTVFYLRQFSVIDMRQVHDIKMSA----------ITK
RECO_LEUCK      -----------------------KTVFYLRQFSIIDLRQINQINISE----------TTK
RECO_OENOB      -----------------------KAIYYLRMFSKIKISQFNSINISE----------NVK
RECO_LACAC      -----------------------KETAILRTIGLLPIERLGTIKVSE----------ESK
RECO_LACH4      -----------------------KQTAVLRTIGLLPIERLGNIELNS----------ETK
RECO_LACJO      -----------------------KVVALIRTLALVDIDRLGKIKINP----------QLK
RECO_LACGA      -----------------------KVVALIRTLALIDIDRLGKVKINP----------QLK
RECO_LACDB      -----------------------KATALIRTLALLPISRLGEIQIGE----------DLK
RECO_LACDA      -----------------------KATALIRTLALLPISRLGEIQIGE----------DLK
RECO_CLOPS      -----------------------ATYNALRFLNNTSLDKVYRLTLTE----------EVK
RECO_CLOP1      -----------------------ATYNALRFLNNTSLDKVYRLTLTE----------EVK
RECO_CLOPE      -----------------------ATYNALRFLNNTSLDKVYRLTLTE----------EVK
RECO_CLONN      -----------------------AAYGVLKFLYKTSIENAHIISVSN----------EIK
RECO_CLOK5      -----------------------STCSALKYLSSISMENVYKVVLTK----------EVK
RECO_CLOAB      -----------------------AAYSSLNYLSKLPIEKVYRVNLND----------NIK
RECO_ALKMQ      -----------------------LTVKLANYLLAKDMEEIQKLKVNP----------YLH
RECO_ALKOO      -----------------------TAVKLAIFLLMKDITEVQKLKISD----------HLN
RECO_CLOD6      -----------------------TTISLMEYVLRNDILTCSKAKVSK----------YIT
RECO_HUNT2      -----------------------GAAKALNYIVHSKMSNLFSFEVSE----------SVL
RECO_CALS8      -----------------------EVVEKILIIAATDLKKLSKIRISK----------NLN
RECO_THEPX      -----------------------VTLKAIKYFLKGDYDKLQNIKVSG----------VIK
RECO_THEP3      -----------------------VTLKAIKYFLKGDYDKLQNIKVSG----------VIK
RECO_CALS4      -----------------------KVLKFLLYLLKAKYEKLERISVPG----------VIK
RECO_NOSS1      VTPAYQTVVHRQEIPVISARLNSVELGMLQQLSQPEIMQI------------NTTSDASW
RECO_TRIV2      VTPAYQTVVHRQEIPVISARLNSVELGMLQQLSQPEIMQI------------NTTSDASW
RECO_NOSP7      MPHAQTVVVHRQEIPLISSRLGAMELALLQHLSQPEIMQI------------DGARDHNW
RECO_TRIEI      ------------LSTKINTLINANQLSLLQQLPQPQLQTIV-----------KLTSYQDW
RECO_GLOC7      -------LKKEIFLNKLNWKLTAVELTLLQQLGQKFLPQAYDIFPMDV---AISSIDVAW
RECO_RIPO1      ----------QTPVPRINQELGAIELCLLQHLGYSFLPQPRQILPPES---LNDFLGVAW
RECO_SYNY3      ----------DMGPIPQMRRLTAMELSLLQQLNQPALPDPQQYLPVIA---RKNFRLWDW
RECO_ACAM1      ------IAYPLGADYRVQGKLSAQELALLQDLNPAEIQPASP-LPLPL---IATYPLVIW
RECO_SYNP6      -----------------ELLLTATELAALQQIPTSQTVLPL-----------ASLPREAW
RECO_SYNE7      -----------------ELLLTATELAALQQIPTSQTVLPL-----------ASLPREAW
RECO_THEEB      ------------AGAGGDRQLTASEVRLGQWLAMPTTQFLARDEFLTQ---AEAYPLSVW
RECO_SYNJB      ------------------AWVSASALRALGSLPSSTLP-LPE----------DSLPLAAW
RECO_SYNJA      ------------------AWVSSSVLQALGSLPNPTLPSLAE----------RALPLASW
RECO_GLOVI      ------------------FRLDIEQVAALQLLADADLTPASL----------DWNYL--W
RECO_NOCFA      ----------------------PGVLDHLVALARGEWAGIEAVPES------------TR
RECO_RHOJR      ----------------------PGVLDLMDALIRGDWASTEDVPES------------LR
RECO_MYCSK      ----------------------QAVLDLMSALHDGDWPAAEASTPS------------HR
RECO_MYCSS      ----------------------QAVLDLMSALHDGDWPAAEASTPS------------HR
RECO_MYCSJ      ----------------------QAVLDLMSALHDGDWPAAEASTPS------------HR
RECO_MYCS2      ----------------------QAVLELMSALHDGDWEYAESSTPP------------HR
RECO_MYCGI      ----------------------QGVLDLMAALYDGDWEHAQISTPA------------HR
RECO_MYCA9      ----------------------QGVLELMAALHDGDWAATDDVPQT------------QR
RECO_MYCMM      ----------------------LGVLDLMSALHDGDWEAAQGAPQS------------HR
RECO_MYCUA      ----------------------LGVLDLMSALHDGDWEAAQGAPQS------------HR
RECO_MYCTA      ----------------------LGVVDLMSALYDGDWEAAEAAPQS------------AR
RECO_MYCTU      ----------------------LGVVDLMSALYDGDWEAAEAAPQS------------AR
RECO_MYCBP      ----------------------LGVVDLMSALYDGDWEAAEAAPQS------------AR
RECO_MYCBO      ----------------------LGVVDLMSALYDGDWEAAEAAPQS------------AR
RECO_MYCPA      ----------------------PGVLDLMSALHDGDWEFAEQTPQS------------HR
RECO_MYCLE      ----------------------RGVLELMSALHDGDWGTAQQAPQS------------HR
RECO_SACEN      ----------------------AATLPLLEALLHGDWAVAEAATTP------------VR
RECO_STRCO      ----------------------PQALELLGALLTGDWGTADAAEPR------------YV
RECO_STRAW      ----------------------AQALVLLGALLTGDWETADACEPR------------YV
RECO_STRGG      ----------------------AQALTLLSALLSGDWATADACEAR------------HV
RECO_THEFY      ----------------------PAAVALMVALLRGDWESADASAER------------DR
RECO_NOCSJ      ----------------------PETVALLGALLAGDWAVVDPAAAR------------NL
RECO_FRACC      ----------------------AGAVRLLADLLRGDWDGALVSDAR------------AR
RECO_LEIXX      ----------------------AATIALLGALLTGGWETAEAAGES------------TR
RECO_CUTAK      ----------------------EETISYLRALLVGDWTATRDVAWS------------RV
RECO_BIFLO      ----------------------PFVLNQFDALIRGDWSVLDAAP--------------VE
RECO_BIFLD      ----------------------PFVLNQFDALIRGDWSVLDAAP--------------VE
RECO_BIFAA      ----------------------WDAICRLSALVDGDWGELDGVPASA----------SIQ
RECO_RUBXD      ----------------------PVPPGTLGRLRELAALPLAEAASGR----------GLE
RECO_PELTS      -----------------PVEVNKGTLEILKALLNWPLARIGLLRVNR----------RFR
RECO_DESAP      -----------------ARPCRSAVVQVLGKLLEWPLDRLKVLRIDA----------ATG
RECO_DESRM      -----------------ILKFSRGTVEVLKTLYRWELTKLQQLKVSE----------PLK
RECO_MOOTA      -----------------EYLVSRGGVKTWQQLNRLNWSYLKRLQINP----------MLM
RECO_SYMTH      -----------------ALRLSLGALETMKRLLDGDIRRAHMVRLSG----------ELA
RECO_DESHY      -----------------GRWVSGGSLGLMRQLLQGELEKLNRLRWNQ----------WSK
RECO_HELMI      -----------------MGLIAPGALALLRHLLQMDPRDLGRLRVGP----------KLL
RECO_HERA2      -----------------TLPINLNTFKLLRYLARMPLETVVSLVPAP----------ATV
RECO_ROSS1      -----------------ALPMSLAAFKLLRYLQSQPLEISGELRISP----------ATR
RECO_DEHMC      -----------------GMPVSVNTVKVLRYIQENSFSSICRLKINR----------EIL
RECO_DEHMB      -----------------GMPVSVNTVKVLRYIQENSFSSICRLKINR----------EIL
RECO_DEHM1      -----------------GIPISVNAVKVLRYIQENDIPNIYRLKINR----------EIL
RECO_ANASK      --------------------LAAGTLAALLRLQDGGLAAAASEPLAP----------PAG
RECO_ANADE      --------------------LAAGTLAALLRLQEGGLAAAASEPLAA----------PAG
RECO_ANADF      --------------------VSIAAASALARLQAEGLAGA-SAALPP----------SVG
RECO_MYXXD      --------------------VPVALLSGLRALQEG-----ARTPLPP----------ELR
RECO_GEOMG      --------------------AAALLGRCIATGRFG------AVLFSP----------QSL
RECO_GEOSL      --------------------TVRLLHRCLGTGRFG------AIVFPP----------EPL
RECO_GEOUR      --------------------TVALLNRAMDTGRFG------LIRFSP----------TEL
RECO_PELPD      --------------------TLGRMLACLKTGTFG------LIHFPD----------EAQ
RECO_DESAL      --------------------LSVGAVKQLLWLNKGDLAAAGRMKLSR----------EAM
RECO_DESOH      --------------------LSRGLVKQFLWVRETDLPQAERMRFTA----------AAR
RECO_PROA2      ----------------------ALSFRLLRWLSRQNIDALPDIRIPE----------EHP
RECO_CHLPB      ----------------------VQVYLLMRTLNRLDIRSIDEIDIPA----------DNS
RECO_CHLL2      ----------------------MPAYRLLSELSSTPLSALDEVDAGK----------AET
RECO_CHLPD      ----------------------MATYALLSAISSTPLNLLKNIEAIP----------PQT
RECO_PELPB      ----------------------VRLAMLLSALAATRLPAGDSIKADP----------REI
RECO_CHLP8      ----------------------VSHYLFIRALAATG-SQAACPEASP----------EEV
RECO_PELCD      ------------------------SLGSLARALKAPLALFEGFRFGS----------QTL
RECO_SYNWW      -----------------------ETLALISLLGRSRLATVERVRVSN----------KAQ
RECO_SYNAS      ---------------------SVGTIKTLLLGREIETEKMKRILFSG----------QTA
RECO_SYNFM      -----------------------GTLLLIRQCRSLSLDRIWRLRFLH----------DTK
RECO_CARHZ      -----------------------EVVKGMNALLLASPEKLPELLLDE----------RVV
RECO_KORVE      ----------------------RAIADLMFRAPLENFAGAPWPR-------------QRC
RECO_RHOBA      -----------------------DALDALRELASEPELPPSTIDADTDNPSQPPSTAFPI
RECO_SALRD      -------------------------LRAYAVCARADLDTVMRLTMSP----------AVR
RECO_SYNSC      ----------------------PSELALLQRLTRAELPRRRDGELMG--------PPAVW
                                                                            

RECO_ECOL6      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_SHIDS      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOUT      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOLI      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOLC      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECO5E      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECO45      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOK1      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECODH      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECO57      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOL5      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_SHIFL      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_SHIF8      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECO24      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOSM      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECO7I      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECO8A      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOHS      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOSE      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ESCF3      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_SHISS      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_ECOLU      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_SHIBS      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_SHIB3      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTHYE-----------------
RECO_SALEP      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKMKKD-----------------
RECO_SALG2      RASKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKMKKD-----------------
RECO_SALDC      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKMKKD-----------------
RECO_SALA4      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALPB      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALTI      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALNS      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALCH      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALTY      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALHS      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALPK      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALPA      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_SALSV      RAAKRFTRMALKPYLGGKPLKSRELFRQFMPK---RTVKTKKD-----------------
RECO_KLEP7      RAAKRFTRIALKPYLGGKPLKSRELFRQFMPA---RKARADNTNND--------------
RECO_KLEP3      RAAKRFTRIALKPYLGGKPLKSRELFRQFMPA---RKARADNTNND--------------
RECO_ENT38      RAAKRFTRIALKPYLGGKPLKSRELFRQFVPK---R------------------------
RECO_CROS8      RAAKRFTRMALKPYLGGKPLKSRELFRQFVPKK--RPLPPEGETA---------------
RECO_ERWT9      RAAKRFTRIALKPWLGGKPLKSSELFRQFLPRKPANAAPADEE-----------------
RECO_YERPB      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERPN      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERPS      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERPA      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERPE      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERP3      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERPG      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERPY      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERPP      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPADPSP------------------
RECO_YERE8      RAAKRFTRIALKPYLGGKPLKSRELFRQFVIK---PPSEPLP------------------
RECO_PROMH      KAAKRFTRMALKPYLGGKPLKSRELFRQFAIK---KCAKKSVLIEDK-------------
RECO_PHOLL      KAAKRFTRIALKPYLGGKPLKSRELFRQFVRQ---QPEKKEN------------------
RECO_PECAS      KAAKRFTRIALKPYLGGKPLKSRELFRQFVPA---ANLSKPTSSDK--------------
RECO_SERP5      RAAKRFTRMALKPYLGGKPLKSRELFRQFVRK---QPDPPVDDA----------------
RECO_SODGM      RAAKRFTRMALKPYLGGKPLKSHELFRQFLDR---RPQASAGVAAARKAGGDGSDGDEGE
RECO_VIBCH      QAAKRFTRLALKPYLGGKPLKSRELFRQTTLPRARSTEE---------------------
RECO_VIBC3      QAAKRFTRLALKPYLGGKPLKSRELFRQTTLPRARSTEE---------------------
RECO_VIBVY      QAAKRFTRIALKPYLGGKPLKSRELFIQMRIPRTRSMEK---------------------
RECO_VIBVU      QAAKRFTRIALKPYLGGKPLKSRELFIQMRIPRTRSMEK---------------------
RECO_VIBPA      KAAKRFTRIALKPYLGGKPLKSRELFIQT--PRARSNGK---------------------
RECO_ALIF1      KAAKRFTRIALKPYLGGKPLKSREL----FLPRTRSILK---------------------
RECO_ALIFM      KAAKRFTRIALKPYLGGKPLKSREL----FLPRTRSILK---------------------
RECO_ALISL      KAAKRFTRIALKPYLGGKPLKSREL----FLPRTRSILK---------------------
RECO_PHOPR      KAAKRFTRIALKPYLGGKPLKSREL----FIPRTRNIGK---------------------
RECO_ACTP2      QAAKRFTRMALKPYLGSQPLKSRELF-QSILP-----NKLKSS-----------------
RECO_ACTPJ      QAAKRFTRMALKPYLGSQPLKSRELF-QNILP-----NKLKSG-----------------
RECO_ACTP7      QAAKRFTRMALKPYLGSQPLKSRELF-QSILP-----NKLKSG-----------------
RECO_HAEDU      QAAKRFTRIALRPYLGSQPLKSRELF-QAILP-----HKLKSS-----------------
RECO_HAEI8      QAAKRFTRIALKPYLGDKPLKSRELFTQNILL-----LK---------------------
RECO_HAEIE      QAAKRFTRIALKPYLGDKPLKSRELFTQNILL-----LK---------------------
RECO_HAEIG      QAAKRFTRIALKPYLGDKPLKSRELFTQNILL-----LK---------------------
RECO_HAEIN      QAAKRFTRIALKPYLGDKPLKSRELFTQNILL-----LK---------------------
RECO_MANSM      QAAKRFTRVALKPYLGNKPLKSRELFTQTILH-----LK---------------------
RECO_ACTSZ      SAAKRFTRMALKPYLGNKPLKSRELFAHNILF-----LK---------------------
RECO_PASMU      QAAKRFTRIALKQYLGNKPLKSRELFTQYMLY-----QK---------------------
RECO_PSYIN      KSAKRFCRQALANLLGGKPLHSRALFTAK-------------------------------
RECO_IDILO      RLLKYIMRDALAVYLGDKPLRSRELFRGTKRQ----------------------------
RECO_PSEA6      LAAKHITRTTLGELLGSKPLMSRELFKQTHFK---SRGREL-------------------
RECO_HAHCH      SAAKRLTRRCLDELLGGRPLHSRELMRSYLKL-----TKG--------------------
RECO_MARHV      KTAKRVMRVLVDYLLQGRPLHSRSLFSHSNPS----SGRES-------------------
RECO_CELJU      RVAKQLARLLFKPLLGKRPLKSRELFTPGSPH----------------------------
RECO_PSEA8      AAAKRLMRQALAPHLGGRPLVSRELFMNRKESPRD-------------------------
RECO_PSEAE      AAAKRLMRQALAPHLGGRPLVSRELFMNRKESPRD-------------------------
RECO_PSEAB      AAAKRLMRQALAPHLGGRPLVSRELFMNRKESPRD-------------------------
RECO_PSEA7      AAAKRLMRQALAPHLGGRPLVSRELFMNRKESPRD-------------------------
RECO_PSEU5      AAAKRLMRQALAPHLGGRPLVSRELFMNLKESPRD-------------------------
RECO_PSE14      SAAKRLMRQALAVHLGGRPLVSRELFRKP-------------------------------
RECO_PSEU2      SAAKRLMRQALAVHLGGRPLVSRELFRKP-------------------------------
RECO_PSESM      SAAKRLMRQALAVHLGGRPLVSRELFRKP-------------------------------
RECO_PSEPF      SAAKRLMRQALAVHLGGRPLVSRELFRKP-------------------------------
RECO_PSEF5      SAAKRLMRQALAVHLGGRPLVSRELFRKP-------------------------------
RECO_PSEP1      LAAKRLMRQALAVHLGAKPLVSRELFRKR-------------------------------
RECO_PSEPK      LAAKRLMRQALAVHLGAKPLVSRELFRKR-------------------------------
RECO_PSEPG      LAAKRLMRQALAVHLGAKPLVSRELFRKR-------------------------------
RECO_PSEE4      LAAKRLMRQALAVHLGTKPLVSRELFRKR-------------------------------
RECO_PSEPW      LAAKRLMRQALAVHLGPKPLVSRELFRKR-------------------------------
RECO_CUPMC      SQSRALMRFLLHYYLQGAPLKTRQILIDLQYL----------------------------
RECO_CUPPJ      LQSRALMRFLLHYYLQGAPLKTRQILIDLHYL----------------------------
RECO_BURPS      AQSKTLMRFLLNTYLGGTPLATRQILIDLQNL----------------------------
RECO_BURP1      AQSKTLMRFLLNTYLGGTPLATRQILIDLQNL----------------------------
RECO_BURMA      AQSKTLMRFLLNTYLGGTPLATRQILIDLQNL----------------------------
RECO_BURTA      AQSKTLMRFLLNTYLGGTPLATRQILIDLQNL----------------------------
RECO_BURCA      AQSKTLMRFLLNTYLGGTPLATRQILIDLQNL----------------------------
RECO_BURL3      AQSKTLMRFLLNTYLGGTPLATRQILIDLQNL----------------------------
RECO_PARXL      AQSKTLMRFLLNTYLGGTPLATRQILIDLQNL----------------------------
RECO_NITMU      LQSRILMRHLLSHYLGDKPLHTRQLLKEFQQL----------------------------
RECO_AZOSB      AQSKRLLRVLINHYLGGQPLQSRRVLQELLEL----------------------------
RECO_AROAE      FQSKALLRLLINHYLGGQPLQSRRVLKELQEL----------------------------
RECO_DECAR      HEAKALMRMLMAYYLAGKELETRKIFKELQEL----------------------------
RECO_THIDA      GEAKALMRALINHTLGTKPLYTRQLLRELTELNP--------------------------
RECO_POLSJ      NELKTQLRALLHYHCGVKVLKTRQMMMDLQAL----------------------------
RECO_POLNA      NELKIQLRALLHYHCGVRVLKTRQMMMDLQAL----------------------------
RECO_RHOFT      TQLKPQLRALLNYHCGVQTLRTRQMMIDLQSLSL--------------------------
RECO_ACIAC      ADLKPQLRALLQYHCGSPMLRTRQLMIDLQSL----------------------------
RECO_ACISJ      ADLKTQLRALLQYHCGSPLLRTRQLMMDLQKL----------------------------
RECO_VEREI      AELKPQLRTLLQYHCGSPMLRTRQLMIDLQAL----------------------------
RECO_DELAS      LALKPQLRALLQYHCGSPMLRTRQLMMDLQSL----------------------------
RECO_NEIMB      QQALKITRLFIRHLL-PEGLKSRQVLEQIRQFDRKETARETVPTSDGTASNAV-------
RECO_NEIMA      QQALKITRLFIRHLL-PEGLKSRQVLEQIRQFDRKETARETVPTSDGTASNAV-------
RECO_NEIG1      QQALKITRLLIGTLL-PEGLKSRQVLEQIRQFDRNTA-----------------------
RECO_NEIG2      QQALKITRLLIGTLL-PEGLKSRQVLEQIRQFDRNTA-----------------------
RECO_NEIMF      QQALKITRLFIRHLL-PEGLKSRQVLEQIRQFDRKETARETVPTSDGTASNAV-------
RECO_CHRVO      GHARLLSRVWLSALLGDEPLASRQLLQAIQSLSD--------------------------
RECO_COXBN      KEIKYLMRLTLNRLLGKKPLKTRELLF---------------------------------
RECO_COXBU      KEIKYLMRLTLNRLLGKKPLKTRELLF---------------------------------
RECO_COXB1      KEIKYLMRLTLNRLLGKKPLKTRELLF---------------------------------
RECO_COXB2      KEIKYLMRLTLNRLLGKKPLKTRELLF---------------------------------
RECO_COXBR      KEIKYLMRLTLNRLLGKKPLKTRELLF---------------------------------
RECO_NITOC      GEAKRLLRWLLAFHLGDKPLKSRGLLEELRRLGNVSRKEERP------------------
RECO_METCA      TEAKRLMRRIIAHHLNGRALKSR----ELFRSSS--------------------------
RECO_XYLF2      AGLRRSMRAVLLHHLGGRGLKSWEMIAAFRHQDTSP------------------------
RECO_XYLFT      AGLRRSMRAVLLHHLGGRGLKSWEMIAAFRHQDTSP------------------------
RECO_XYLFM      AGLRRSMRAVLLHHLGGRGLKSWEMIAAFRHQDTSP------------------------
RECO_XYLFA      AGLRRSMRAVLLHHLGGRGLKSWEMIAAFRHQDTSP------------------------
RECO_XANCB      PGLRRSMRGVLLHHLSGRGLKSWEMLEELARRGA--------------------------
RECO_XANC8      PGLRRSMRGVLLHHLSGRGLKSWEMLEELARRGA--------------------------
RECO_XANCP      PGLRRSMRGVLLHHLSGRGLKSWEMLEELARRGA--------------------------
RECO_XANOP      PGLRRSMRSVLLHHLGGRGLKSWEMLEDLARRR---------------------------
RECO_XANOR      PGLRRSMRSVLLHHLGGRGLKSWEMLEDLARRR---------------------------
RECO_XANOM      PGLRRSMRSVLLHHLGGRGLKSWEMLEDLARRR---------------------------
RECO_XANC5      PGLRRSMRGVLLHHLGGRGLKSWQMLEDLARRR---------------------------
RECO_XANAC      PGLRRSMRGVLLHHLGGRGLKSWEMLEDLARRR---------------------------
RECO_STRMK      ASLRLPMRRVLAHHLGPRGLKSWEMLEQLAPRR---------------------------
RECO_STRM5      ASLRLPMRRVLAHHLGPRGLKSWEMLEQLAPKR---------------------------
RECO_HALHL      SEARRLMRAVIQQHLGGRRLRSREMFRSLRD-----------------------------
RECO_ALKEH      PEARRLMRAALSLYLGDRPLQSRALYRQLARTPRAATPASPNDH----------------
RECO_NITHX      LTGRFLLRHVLEPRG-QGHSDARAGFINAVVKHQARASAAAISG----------------
RECO_NITWN      LTGRFLLRHVLEPRG-QGHSDARAGFINAVVRKRTAAIADGARVMAELNPPST-------
RECO_RHOP2      LTGRFLLRNVLEPRG-QGHSDARDGFINAV----AKHLARAAIV----------------
RECO_RHOPS      LTGRFLLRNVLEPRG-QGHSDARDGFINAV----TRHLARTAIP----------------
RECO_RHOPB      LTGRFLLRNVLEPRG-QGHSDARDGFINAVVRLRTRELAETAPPK---------------
RECO_RHOPT      LTGRFLLRNVLEPRG-QSHSDARAGFINAI----TRALQRPAES----------------
RECO_RHOPA      LTGRFLLRNVLEPRG-QSHSDARAGFINAI----TRALQRPAES----------------
RECO_BRADU      LTGLFLLRHVLEPRG-QVHSDARAGFINAL----TRQQARAAIPAP--------------
RECO_RHOP5      LTGRFLLRNVLEPRG-QGHSDARDGFINAV----TRPRGQGALPVVALPDPMGR------
RECO_BRASO      LTGLFLLRHVLEPRG-QGHSDAREGFINAV----TRARTRLTRA----------------
RECO_BRASB      LTGLFLLRHVLEPRG-QGHSDAREGFINAV----TRARARLAQV----------------
RECO_OLICO      LTGMFLLRNVLEPRG-QAHSDARAGFIAAV----ARSRVTLAAE----------------
RECO_XANP2      LTGYFLLTRVLEPRG-LGLSDARAAFISAW----RRSIAPA-------------------
RECO_CHESB      LTGFFFARHVYEPRG-LTEPEARAGFLAAVMRNLP-----EGESAP--------------
RECO_RHILO      LTGFFFTRHVYEPRA-IEQPDARAGFLAALRKHHATRKAIAGDNAA--------------
RECO_BRUSU      MTGYFLMRHVWEPRA-QTPPDSRSGFLNAVGRAINL------SQAS--------------
RECO_BRUA2      MTGYFLMRHVWEPRA-QTPPDSRSGFLNAVGRAINL------SQAS--------------
RECO_BRUAB      MTGYFLMRHVWEPRA-QTPPDSRSGFLNAVGRAINL------SQAS--------------
RECO_BRUME      MTGYFLMRHVWEPRA-QTPPDSRSGFLNAVGRAINL------SQAS--------------
RECO_RHIME      LTAYFLNRHVYEPRG-VDAASARDGFVHATLKALKSASSAA-------------------
RECO_SINMW      LTAYFLNRHVYEPRG-VDAASARDGFVHATLKALRTASSEAPQ-----------------
RECO_RHIL3      LTGFFLHRHVYEPRG-IEAVAARDGFVQAALKALNPTLRTLSGPNGVSA-----------
RECO_RHILW      LTGFFLHRHVYEPRG-IEAAAARDGFVQAALKALNPALRTLSGPNDISA-----------
RECO_RHIE6      LTGFFLHRHVYEPRG-MEAAAARDGFVQAALKALNPALRTLAGPNGVSA-----------
RECO_RHIEC      LTGFFLHRHVYEPRG-IEAVAARDGFVQAALKALNPASQTLSSPNGVSA-----------
RECO_AGRFC      LTDHFLHRHVYDPRG-LNENAARDGFVQAALKALERKAEPPALDKAV-------------
RECO_METEP      LTGYFLDQHVWRPRA-QDTPEERARFVALGTGQS--------------------------
RECO_METPB      LTGYFLDQHVWRPRA-QDTPEERARFVALGTGQR--------------------------
RECO_BEII9      LTGHFLMRDLFGPRG-QTLPDARHAFLAETAKTYPRVAPQCF------------------
RECO_BARQU      LTGFFLMRHVWEPRG-IKQPSVRVNLIQLFERRFRM------------------------
RECO_BARHE      LTGFFLMRHVWEPRN-IKQPSVRISLIQLFEQRFRMQASFVDLKTINRM-----------
RECO_BART1      LTSFFLMRYVWEPRD-IKQPSVRTNLIQLFERRFGIQAFIC-------------------
RECO_BARBK      LTDFFLTRHVWEPRG-IKQPSVRAILIQLFERRFHTKA----------------------
RECO_RHORT      LSGYFLEGHVLAPQG-RGLPASRQRFVERLRRWSAADR----------------------
RECO_RHOCS      LTGHFLDRHLFALRH-AEVPAARTRFVDRYRKAHTTSGITPAP-----------------
RECO_CAUVC      ITGHFLEQFVFGPLN-RPLPPARLWLLDRLAEADKL------------------------
RECO_CAUSK      ITGHFLEQFVFHPLN-RPLPPARVWLLDRLGEAGRL------------------------
RECO_ROSDO      TTGYFLTEHLARDLGGKPLPEARARFVETFSRRL--------------------------
RECO_RUEPO      TTGHFLEHRVAPALGHAPLPQARGRLLDLISRLP--------------------------
RECO_RUEST      TTGFFLESKLAPALGNRPIPEARGRFLDALARRV--------------------------
RECO_RHOS1      ITGHFLGRELAPLLNGRPLPEARARLMELLARA---------------------------
RECO_RHOS4      ITGHFLGRELAPLLNGRPLPEARARLMELLARA---------------------------
RECO_RHOS5      ITGHFLARELP--LAGRPLPEARARLIDLLARG---------------------------
RECO_JANSC      VTGHFLATHLAPSLGDKPLPAARQRLIDALERQVIRGGS---------------------
RECO_GLUDA      LTGHFLARDAFGQRH-RPLPPARLRLVDMIDALQPGALHPDD------------------
RECO_GRABC      LTGYFLSRDVFGTRH-RPLPPARMSLYDRIAALTETEREHA-------------------
RECO_CHLTB      IDIDTKIDALFSSFLSETS---EPSSLYYKGKTLL-------------------------
RECO_CHLT2      IDIDTKIDALFSSFLSETS---EPSSLYYKGKTLL-------------------------
RECO_CHLTR      IDIDTKIDALFSSFLSETS---EPSSLYYKGKTLL-------------------------
RECO_CHLTA      IDIDTKIDALFSSFLSETS---EPSSLYYKGKTLL-------------------------
RECO_CHLMU      IDIDSKIDSLFSSFLTEKM---NVLP----------------------------------
RECO_CHLPN      IAIAEKIFYLFDSLQEEKKSERNSSEDPYHEILRLSKVVHPY------------------
RECO_BACSU      AELKQVIDLYYEEYSGL--YLKSKRFLDQMESMKHLMG-ENKS-----------------
RECO_BACVZ      NEIKRVIDLYYEEYSGL--YLKSKRFLDQMESMKNLLD-ENKS-----------------
RECO_BACLD      DELKRVIQTYYDEYSGI--YLKSRRFMEQMDNMKKMLGDENKS-----------------
RECO_BACP2      QEIRQVLDHYYDEYSGL--YLKSKKFMNQMESMKKLMGGENKS-----------------
RECO_BACC7      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACCZ      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACAN      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACC0      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACHK      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACCR      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACC4      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACC2      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACC1      KQMRLVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACMK      KQMRTVLNTYYDEYCGI--YLKTRRFLEQLDKFQI-------------------------
RECO_BACCN      RQIRTVLNTYYDEYCGI--YLKSRRFLEQLDKFQI-------------------------
RECO_BACHD      ATLKTIIHQYYDEYSGL--HLKSRRFLDQLESMGFHDQSTD-------------------
RECO_GEOTN      AELRAVLSSYYDEYAGL--SLKAKRFLQQIGELKGTLDPGDGRNN---------------
RECO_GEOKA      MELGAVLSAYYDEYAGL--SLKTKRFLQQIGELKDKLSPDGGQGASFSL-----------
RECO_LISIN      EWLQKAIDTYYDEYSGL--YLKSRKFLRDMDKWENMLKKDSDD-----------------
RECO_LISW6      DWLQKAIDTYYDENSGL--YLKSRKFLRDMDKWENMLKKDSDD-----------------
RECO_LISMO      DWLQKAIDTYYDEYSGL--YLKSRKFIREMDKWENMLKKDSDD-----------------
RECO_LISMF      EWLQKAIDTYYDEYSGL--YLKSRKFLREMDKWENMLKKDSDD-----------------
RECO_BACSK      RRLEWMIRTYYDEYVGV--QLKARRFISQLDKMGGLSSDVDK------------------
RECO_OCEIH      QLIRKILYEYYDQYGGF--WIKSRKVLDQLDFFIPNVKNGNSYNE---------------
RECO_EXIS2      RLLRQIMDAYMERYSGL--RLRSKRVLDQLLNLGDD------------------------
RECO_STAAM      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAA1      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAN      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAT      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAE      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAC      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAA3      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAB      DEMSEIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAW      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAS      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAAR      DEMSDIILMLYREYAGM--FFKSQKLINQLKRLEQ-------------------------
RECO_STAEQ      NEMSELLIMLYREYAGM--FFKSQKLINQLNRLEKDSL----------------------
RECO_STAES      NEMSELLIMLYREYAGM--FFKSQKLINQLNRLEKDSL----------------------
RECO_STAHJ      DEMSELILLIYKEYAGM--YFKGQKLINQLKRIEY-------------------------
RECO_STAS1      DEMSELVILLYKEYAGM--YFKSQKLINQLYRLDNL------------------------
RECO_STRSV      KQLRDFIDLLYDEYVGI--HLKSKKFIDSLGDWGSILKDK-NEE----------------
RECO_STRGC      QQLREFIDQIYDDYVGI--HLKSKKFIDSLGDWGSILKDKENKESI--------------
RECO_STRPI      QELRQFMDQLYEEYVGI--HLKSKKFIDSLADWGQLLKEEKK------------------
RECO_STRPN      QELRQFMDQLYEEYVGI--HLKSKKFIDSLADWGQLLKEEKK------------------
RECO_STRPS      QELRQFMDQLYEEYVGI--HLKSKKFIDSLADWGQLLKEEKK------------------
RECO_STRP4      QELRQFMDQLYEEYVGI--HLKSKKFIDSLADWGQLLKEEKK------------------
RECO_STRP2      QELRQFMDQLYEEYVGI--HLKSKKFIDSLADWGQLLKEEKK------------------
RECO_STRR6      QELRQFMDQLYEEYVGI--HLKSKKFIDSLADWGQLLKEEKK------------------
RECO_STRPD      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRPG      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRP6      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRPC      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRPB      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRP1      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRP3      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRPZ      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRPM      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRP8      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STRPF      KKLRQFIDELYHDYVGI--KLKSKTFIDNLVKWGDIMK----------------------
RECO_STREM      KKLRLFIDALYEDYVGI--RLKSKVFIDDLAKWGDIMKNKQGL-----------------
RECO_STRS2      RKLRFFIDQLYEEYVGI--HLKSKKFIDDLSSWGQIMKPRTENEETE-------------
RECO_STRSY      RKLRFFIDQLYEEYVGI--HLKSKKFIDDLSSWGQIMKPRTENEETE-------------
RECO_STRMU      QKLRKFIDEVYEDYIGL--RLKSKKFIDDLDHWGQVMK----------------------
RECO_STRA5      LKIRQFLDMIYDEYVGI--HLKSKKFIDDLSSWGSIMKSD--------------------
RECO_STRA3      LKIRQFLDMIYDEYVGI--HLKSKKFIDDLSSWGSIMKSD--------------------
RECO_STRA1      LKIRQFLDMIYDEYVGI--HLKSKKFIDDLSSWGSIMKSD--------------------
RECO_STRT2      RKLRQFIDELYDNYVGI--HLKSKKFIDNLNSWGHIMSKEDNAD----------------
RECO_STRT1      RKLRQFIDELYDNYVGI--HLKSKKFIDNLNSWGHIMSKEDNAD----------------
RECO_STRTD      RKLRQFIDELYDNYVGI--HLKSKKFIDNLNSWGHIMSKEDNAD----------------
RECO_LACLS      AKIRQFIDGLYDEYVGI--HLKSKKFLDGMSGWADIMK----------------------
RECO_LACLM      AKIRQFIDGLYDEYVGI--HLKSKKFLDGMSGWADIMK----------------------
RECO_LACLA      LKIRQFIDGLYDEYVGI--HLKSKKFLDGMSGWADIMK----------------------
RECO_ENTFA      KSIRETIDMLYDEYVGL--HLKSKKFIDQMKTWENTLKIPPRKKEEK-------------
RECO_LACBA      HALRQLMDEIYDSQIGV--HPKSKRFLDQMQSWSARLKPPTDH-----------------
RECO_LACPL      AELRRILDEIYQNSVGV--RLKSKRFIDQMGSWYQPLAPRKNED----------------
RECO_LACSS      VELKMIIDRLYQDTVGL--SLKSKQFIDKMYSFDSQLPQLKKVPSEIDSTPKDD------
RECO_LACRD      RRLQQVLDTLYDNEVGL--NLKAKRFIKQMNKWEQNIGKLSMND----------------
RECO_LACRJ      RRLQQVLDTLYDNEVGL--NLKAKRFIKQMNKWEQNIGKLSMND----------------
RECO_LACF3      RQLGRTLDKIYDDQLGL--RLKSKRFINEMDSWTNRLLTARKNPGTDDEKKPAGS-----
RECO_LACS1      KKLKLTLNEIYDNQVGI--YVKARSFIDKMTKVENNLLKKD-------------------
RECO_PEDPA      QEIWNLTADIYKNQVGI--NLKSRSFIDQMKKWEI-------------------------
RECO_LEUMM      RGLQRVIDYIYEKQVGL--KPRAKSFIEQMHSWQNTLVNFRRNK----------------
RECO_LEUCK      RGLQRVIDHIYDNQIGL--KPKAKTFIEQMHAWQNTLINFRQNGEGKSE-----------
RECO_OENOB      RSLQRVINLIYDRQIGL--KTRSRTFIEQMNSLQIKYPNDSSN-----------------
RECO_LACAC      RATRKAIDRIYRETIDL--NLKTKKFLDELKLF---------------------------
RECO_LACH4      KATRKAIDRIYRETIDL--NLKTKKFLDEIKLF---------------------------
RECO_LACJO      KDSGKVIDRMYVNYLDL--NLKTKKFLDELALF---------------------------
RECO_LACGA      KNSGKVIDRMYANYLDL--NLKTKKFLDELALF---------------------------
RECO_LACDB      KESRRAIAQIYQATVDL--HLPSLRFLNEVRGS---------------------------
RECO_LACDA      KESRRAIAQIYQATVDL--HLPSLRFLNEVRGS---------------------------
RECO_CLOPS      AELFKVTSFIISSVYSR--KPKSLEMLKFIKE----------------------------
RECO_CLOP1      AELFKVTSFIISSVYSR--KPKSLEMLKFIKE----------------------------
RECO_CLOPE      AELFKVTSFIISSVYSR--KPKSLEMLKFIKE----------------------------
RECO_CLONN      EEVYKVLDMFISQSYSK--KPKSLEIFNYLKRSEYNE-----------------------
RECO_CLOK5      EELYKVLTLIISQNYFR--KPKSLDILRNLISFEKNKV----------------------
RECO_CLOAB      NEMFEILRGFISQNYAK--IPKSLDLLNIIKEE---------------------------
RECO_ALKMQ      ESLNKVLKQYIMVHLDRV-NFNSLEIAKKI------------------------------
RECO_ALKOO      EELKKILKQYILTHTNKY-DFKSLEVAEKL------------------------------
RECO_CLOD6      HELEDILDKYLKVYVDNI-NFKSLHVLQSVKNNKGVDNDE--------------------
RECO_HUNT2      DELGKVSQRYMKERLEK--NYTKLDFIKTLDRIKC-------------------------
RECO_CALS8      NVLKTLMTTYIKLVLQK--DVKILDFFKFIK-----------------------------
RECO_THEPX      EEVDKIITAYMKEHLEI--EFKSKDFINNLQNM---------------------------
RECO_THEP3      EEVDKIITAYMKEHLEI--EFKSKDFIDNLQNM---------------------------
RECO_CALS4      EEADKIITEYVRTHLEM--DFKSKDFAMKLSD----------------------------
RECO_NOSS1      LSVEQILRQYAQYHLGR--PIRSATLIDSYFAAN----------HDATV-----------
RECO_TRIV2      LSVEQILRQYAQYHLGR--PIRSATLIDSYFAAN----------HDATV-----------
RECO_NOSP7      LSVEQILRQYAQYQLGR--PIRSATLIDSYFAAN----------HDATI-----------
RECO_TRIEI      VKVEQLLRKYTQYHLGY--SIRSAELIDTYLKSISPLI------NNATI-----------
RECO_GLOC7      IKIERILREYAQYHFGR--SFRSATLVDTLAPVDF-------------------------
RECO_RIPO1      VRLELLLRNYAQYHLGR--SFRSAELVDTLSGLEF-------------------------
RECO_SYNY3      VKAENLMRYYAQRQLGK--SFRAAVLLDSMWEVDF-------------------------
RECO_ACAM1      QGVESALRHYAEAYFDR--PIRSAALIDTCFTPLPDLT------SVPS------------
RECO_SYNP6      QMLERALRHSAEYHLER--PLQSALLLETLLTGS----------HVASV-----------
RECO_SYNE7      QMLERALRHSAEYHLER--PLQSALLLETLLTGS----------HVASV-----------
RECO_THEEB      LSLERVLRQYLQFHLEQ--PLRVPPLLDSCFSPVAVSQ------P---------------
RECO_SYNJB      LEAERLLRRVLEHHTDR--EIRSAELLASCYAVPTAN-------GQGSP----AFPEGHP
RECO_SYNJA      LAAERLLRRVLELHADR--AIRSAGLLASCYSVPVAETLPPTPSGQGSPVAAAAFSEEDS
RECO_GLOVI      IGLERLLRRHIEFHFDR--PLRAATLLEICFEPLAVP-------AAASPQ----------
RECO_NOCFA      KQASGLVAAHLQWHLER--QLRTLPLIERS--GP--------------ARDAATAGHAG-
RECO_RHOJR      GQASGLVAAHLQWHLER--QLRTLPLIERA--RPHAAVRVEDSVRQDGDRDSTTRTSSPA
RECO_MYCSK      SQASGLVAAHLQWHLER--QLRTLPLVERV---YRVDHAVADHRISLLRQDVHRGDEPGD
RECO_MYCSS      SQASGLVAAHLQWHLER--QLRTLPLVERV---YRVDHAVADHRISLLRQDVHRGDEPGD
RECO_MYCSJ      SQASGLVAAHLQWHLER--QLRTLPLVERV---YRVDHAVADHRISLLRQDVHRGDEPGD
RECO_MYCS2      SQASGLIAAHLQWHLER--QLRTLPLVERG---YRVDRTVAEQRAALVRQDMAHGNHTGQ
RECO_MYCGI      SQASGLVAAHLQWHLER--QLRTLPLVERP---GRAEVARN------IRQDMAHGNQAEE
RECO_MYCA9      TQASGLIAAHLQWHLER--KLRTLPLVERG---S--------------RLNMSHGEEQPA
RECO_MYCMM      SYVSGLVAAHLQWHLER--QLKTLPLVERF---YQADRSVAERRAALIGQDSECG-----
RECO_MYCUA      SYVSGLVAAHLQWHLER--QLKTLPLVERF---YQADRSVAERRAALIGQDSECG-----
RECO_MYCTA      SHVSGLVAAHLQWHLER--QLKTLPLVERF---YQADRSVAERRAALIGQDIAGG-----
RECO_MYCTU      SHVSGLVAAHLQWHLER--QLKTLPLVERF---YQADRSVAERRAALIGQDIAGG-----
RECO_MYCBP      SHVSGLVAAHLQWHLER--QLKTLPLVERF---YQADRSVAERRAALIGQDIAGG-----
RECO_MYCBO      SHVSGLVAAHLQWHLER--QLKTLPLVERF---YQADRSVAERRAALIGQDIAGG-----
RECO_MYCPA      NYVSGLVAAHLQWHLER--QLKTLPLVERT---YHIDRTIADQRATLIGQDMDCG-----
RECO_MYCLE      SYASGLVAAHLQWHLER--QLKTLPLVERTHQAYQVDRSIAERRAALVRQDMACG-----
RECO_SACEN      REGSGLIAAHLQWHMER--QLRSLPLVERS--EWKVPEIIRERAAELGATQDPVASPAGE
RECO_STRCO      REGSGLVSAYLHWHLER--GLRSLRYVEK-------------------------------
RECO_STRAW      REGSGLVSAYLHWHLER--GLRSLRYVEK-------------------------------
RECO_STRGG      REGSGLVSAYLHWHLER--GLRSLRYVEK-------------------------------
RECO_THEFY      TECSGLVAAYLQWHLEN--GVRSLRLVERA------------------------------
RECO_NOCSJ      KEASTLVAAYLAWHLER--GLKSMAYVER-------------------------------
RECO_FRACC      REAGGIAAAYLQWHLER--GLRALPYLERA------------------------------
RECO_LEIXX      SQASGLVAAYAQWHLER--GLRSLQHLQTDRHHRKASG----------------------
RECO_CUTAK      REGSGLVAAFVSWHMDR--GLRSMPLLER-------------------------------
RECO_BIFLO      RVVQELVEDWGEYYLER--PIRSLRLIDS-------------------------------
RECO_BIFLD      RVVQELVEDWGEYYLER--PIRSLRLIDS-------------------------------
RECO_BIFAA      RETHQIVEEWGEYYLER--PIRSMRLLD--------------------------------
RECO_RUBXD      EALRRVVRAHVLAHAPG--AASLATPAGTAGGRP--------------------------
RECO_PELTS      NRIRLILRQYLTYHLER--DLKSYAFLDRFGQAPAGSGAADV------------------
RECO_DESAP      REVADILQACVCHHLER--EPRSLAFLRKMGISSS-------------------------
RECO_DESRM      TELSALLRSYIEYYLEK--KLKTTEFMDRLYKSNLGRGTNI-------------------
RECO_MOOTA      GELGEVMPAFLEYYLDR--RLRSRAFINEIGGDNIDGPGKNRPVAQAPGT----------
RECO_SYMTH      AEIDRALSAYILARTER--RLKSKEFLDTLRSAR--------------------------
RECO_DESHY      KEILEASQYFCEQTLDK--SLRSWSMGNRLVNVGQNPSGKDDLNERRDVDGTGES-----
RECO_HELMI      RHVSAVLKETIRCRSEG--NMRSWSVIESVGRSLTEEPELKAEQTEAEKESQRPR-----
RECO_HERA2      QEARLVLKASLSQILER--ELKSTQFLNLVRG----------------------------
RECO_ROSS1      AETESLLRAYLRHILER--DPRSLAFLDDVRQMLRTSSPASVGSSATRYFAQGDTDENDR
RECO_DEHMC      SELELAIRANIRFVLEK--EPKALLWLDSLRLADL-------------------------
RECO_DEHMB      SELELAIRANIRFVLEK--EPKALFWLDSLRLADL-------------------------
RECO_DEHM1      SELELAIRANIRFVLEK--EPKALLWLDSLSRANL-------------------------
RECO_ANASK      REAREALTAFLEHHLGR--RLAARRFLDEIGPLLGA------------------------
RECO_ANADE      REAREALTAFLEHHLGR--RLAARRFLDEIGPLLGG------------------------
RECO_ANADF      REARDALAAFLEHHLGR--RLAARRFLDEVGPLLGD------------------------
RECO_MYXXD      ARARGLLNVFIAHHLGR--RLKSVDFMAQVGLD---------------------------
RECO_GEOMG      REAGTLLDGAIAAHLTR--PLNSLAFLKQIEPD---------------------------
RECO_GEOSL      GEAGPLLDGAIGAHLAR--PLNSLAFLRQLTP----------------------------
RECO_GEOUR      EEAGELLNAAISCHLSR--PLKSLAFLREIGV----------------------------
RECO_PELPD      AQTGSALDRALAFHAGH--RLKSLEFLRQISNENQ-------------------------
RECO_DESAL      DRGRDLLESFLAYHLGK--EPKSLRFLKDLRRRHF-------------------------
RECO_DESOH      EQGLAALEAFVTYHLAM--EIKSLKVLQRIRHW---------------------------
RECO_PROA2      RRLCELLQDYCAVHIDHNPPVRNRRIISQIRPDNT-------------------------
RECO_CHLPB      RLLCDILQNYCSLHNNYNPSSKNRRIISRILYE---------------------------
RECO_CHLL2      EFLCKLLQEYCRLHLDHTPRNRNLAVVAQMLSK---------------------------
RECO_CHLPD      DLLCNLLEEYCTLHLVHHPHKKNIAIVSQILSE---------------------------
RECO_PELPB      EDLWNLLQEYCSLHLEHARGRKNLDIVSQILLK---------------------------
RECO_CHLP8      SAVTALLQEYCACHLGRMPHRKHLDIVSRLISA---------------------------
RECO_PELCD      QQGGQVVSSMLRQQLTR--PVKSLSFLSQLTEGSARVAAIR-------------------
RECO_SYNWW      KELEYFLEKYLEYYLERKFNLKKAMSILKRSMPRY-------------------------
RECO_SYNAS      RESKSLLSLFIGHILGK--ELKSLKVLDEIQRMGL-------------------------
RECO_SYNFM      VQLFYGLLDWVRGHIRK--ELKSLKLLQQAHST---------------------------
RECO_CARHZ      DRVKTILEYFLGYQLGEPIRLL--------------------------------------
RECO_KORVE      ADLRRFLVQILERHLEK--KLVTVTMLDKLD-----------------------------
RECO_RHOBA      GRLFPAMTPAIYRDLRGLLNRTLESLVGQTPRMQPFLPDKLDSL----------------
RECO_SALRD      REVEALVRDFLRYQFDDAYPDRSRSVIAQIEGAKPTDRAT--------------------
RECO_SYNSC      RRLLRVVEIWSRTHLNRPSKALAMLRETLLAGA---------------------------
                                                                            

RECO_ECOL6      ----------
RECO_SHIDS      ----------
RECO_ECOUT      ----------
RECO_ECOLI      ----------
RECO_ECOLC      ----------
RECO_ECO5E      ----------
RECO_ECO45      ----------
RECO_ECOK1      ----------
RECO_ECODH      ----------
RECO_ECO57      ----------
RECO_ECOL5      ----------
RECO_SHIFL      ----------
RECO_SHIF8      ----------
RECO_ECO24      ----------
RECO_ECOSM      ----------
RECO_ECO7I      ----------
RECO_ECO8A      ----------
RECO_ECOHS      ----------
RECO_ECOSE      ----------
RECO_ESCF3      ----------
RECO_SHISS      ----------
RECO_ECOLU      ----------
RECO_SHIBS      ----------
RECO_SHIB3      ----------
RECO_SALEP      ----------
RECO_SALG2      ----------
RECO_SALDC      ----------
RECO_SALA4      ----------
RECO_SALPB      ----------
RECO_SALTI      ----------
RECO_SALNS      ----------
RECO_SALCH      ----------
RECO_SALTY      ----------
RECO_SALHS      ----------
RECO_SALPK      ----------
RECO_SALPA      ----------
RECO_SALSV      ----------
RECO_KLEP7      ----------
RECO_KLEP3      ----------
RECO_ENT38      ----------
RECO_CROS8      ----------
RECO_ERWT9      ----------
RECO_YERPB      ----------
RECO_YERPN      ----------
RECO_YERPS      ----------
RECO_YERPA      ----------
RECO_YERPE      ----------
RECO_YERP3      ----------
RECO_YERPG      ----------
RECO_YERPY      ----------
RECO_YERPP      ----------
RECO_YERE8      ----------
RECO_PROMH      ----------
RECO_PHOLL      ----------
RECO_PECAS      ----------
RECO_SERP5      ----------
RECO_SODGM      Q---------
RECO_VIBCH      ----------
RECO_VIBC3      ----------
RECO_VIBVY      ----------
RECO_VIBVU      ----------
RECO_VIBPA      ----------
RECO_ALIF1      ----------
RECO_ALIFM      ----------
RECO_ALISL      ----------
RECO_PHOPR      ----------
RECO_ACTP2      ----------
RECO_ACTPJ      ----------
RECO_ACTP7      ----------
RECO_HAEDU      ----------
RECO_HAEI8      ----------
RECO_HAEIE      ----------
RECO_HAEIG      ----------
RECO_HAEIN      ----------
RECO_MANSM      ----------
RECO_ACTSZ      ----------
RECO_PASMU      ----------
RECO_PSYIN      ----------
RECO_IDILO      ----------
RECO_PSEA6      ----------
RECO_HAHCH      ----------
RECO_MARHV      ----------
RECO_CELJU      ----------
RECO_PSEA8      ----------
RECO_PSEAE      ----------
RECO_PSEAB      ----------
RECO_PSEA7      ----------
RECO_PSEU5      ----------
RECO_PSE14      ----------
RECO_PSEU2      ----------
RECO_PSESM      ----------
RECO_PSEPF      ----------
RECO_PSEF5      ----------
RECO_PSEP1      ----------
RECO_PSEPK      ----------
RECO_PSEPG      ----------
RECO_PSEE4      ----------
RECO_PSEPW      ----------
RECO_CUPMC      ----------
RECO_CUPPJ      ----------
RECO_BURPS      ----------
RECO_BURP1      ----------
RECO_BURMA      ----------
RECO_BURTA      ----------
RECO_BURCA      ----------
RECO_BURL3      ----------
RECO_PARXL      ----------
RECO_NITMU      ----------
RECO_AZOSB      ----------
RECO_AROAE      ----------
RECO_DECAR      ----------
RECO_THIDA      ----------
RECO_POLSJ      ----------
RECO_POLNA      ----------
RECO_RHOFT      ----------
RECO_ACIAC      ----------
RECO_ACISJ      ----------
RECO_VEREI      ----------
RECO_DELAS      ----------
RECO_NEIMB      ----------
RECO_NEIMA      ----------
RECO_NEIG1      ----------
RECO_NEIG2      ----------
RECO_NEIMF      ----------
RECO_CHRVO      ----------
RECO_COXBN      ----------
RECO_COXBU      ----------
RECO_COXB1      ----------
RECO_COXB2      ----------
RECO_COXBR      ----------
RECO_NITOC      ----------
RECO_METCA      ----------
RECO_XYLF2      ----------
RECO_XYLFT      ----------
RECO_XYLFM      ----------
RECO_XYLFA      ----------
RECO_XANCB      ----------
RECO_XANC8      ----------
RECO_XANCP      ----------
RECO_XANOP      ----------
RECO_XANOR      ----------
RECO_XANOM      ----------
RECO_XANC5      ----------
RECO_XANAC      ----------
RECO_STRMK      ----------
RECO_STRM5      ----------
RECO_HALHL      ----------
RECO_ALKEH      ----------
RECO_NITHX      ----------
RECO_NITWN      ----------
RECO_RHOP2      ----------
RECO_RHOPS      ----------
RECO_RHOPB      ----------
RECO_RHOPT      ----------
RECO_RHOPA      ----------
RECO_BRADU      ----------
RECO_RHOP5      ----------
RECO_BRASO      ----------
RECO_BRASB      ----------
RECO_OLICO      ----------
RECO_XANP2      ----------
RECO_CHESB      ----------
RECO_RHILO      ----------
RECO_BRUSU      ----------
RECO_BRUA2      ----------
RECO_BRUAB      ----------
RECO_BRUME      ----------
RECO_RHIME      ----------
RECO_SINMW      ----------
RECO_RHIL3      ----------
RECO_RHILW      ----------
RECO_RHIE6      ----------
RECO_RHIEC      ----------
RECO_AGRFC      ----------
RECO_METEP      ----------
RECO_METPB      ----------
RECO_BEII9      ----------
RECO_BARQU      ----------
RECO_BARHE      ----------
RECO_BART1      ----------
RECO_BARBK      ----------
RECO_RHORT      ----------
RECO_RHOCS      ----------
RECO_CAUVC      ----------
RECO_CAUSK      ----------
RECO_ROSDO      ----------
RECO_RUEPO      ----------
RECO_RUEST      ----------
RECO_RHOS1      ----------
RECO_RHOS4      ----------
RECO_RHOS5      ----------
RECO_JANSC      ----------
RECO_GLUDA      ----------
RECO_GRABC      ----------
RECO_CHLTB      ----------
RECO_CHLT2      ----------
RECO_CHLTR      ----------
RECO_CHLTA      ----------
RECO_CHLMU      ----------
RECO_CHLPN      ----------
RECO_BACSU      ----------
RECO_BACVZ      ----------
RECO_BACLD      ----------
RECO_BACP2      ----------
RECO_BACC7      ----------
RECO_BACCZ      ----------
RECO_BACAN      ----------
RECO_BACC0      ----------
RECO_BACHK      ----------
RECO_BACCR      ----------
RECO_BACC4      ----------
RECO_BACC2      ----------
RECO_BACC1      ----------
RECO_BACMK      ----------
RECO_BACCN      ----------
RECO_BACHD      ----------
RECO_GEOTN      ----------
RECO_GEOKA      ----------
RECO_LISIN      ----------
RECO_LISW6      ----------
RECO_LISMO      ----------
RECO_LISMF      ----------
RECO_BACSK      ----------
RECO_OCEIH      ----------
RECO_EXIS2      ----------
RECO_STAAM      ----------
RECO_STAA1      ----------
RECO_STAAN      ----------
RECO_STAAT      ----------
RECO_STAAE      ----------
RECO_STAAC      ----------
RECO_STAA3      ----------
RECO_STAAB      ----------
RECO_STAAW      ----------
RECO_STAAS      ----------
RECO_STAAR      ----------
RECO_STAEQ      ----------
RECO_STAES      ----------
RECO_STAHJ      ----------
RECO_STAS1      ----------
RECO_STRSV      ----------
RECO_STRGC      ----------
RECO_STRPI      ----------
RECO_STRPN      ----------
RECO_STRPS      ----------
RECO_STRP4      ----------
RECO_STRP2      ----------
RECO_STRR6      ----------
RECO_STRPD      ----------
RECO_STRPG      ----------
RECO_STRP6      ----------
RECO_STRPC      ----------
RECO_STRPB      ----------
RECO_STRP1      ----------
RECO_STRP3      ----------
RECO_STRPZ      ----------
RECO_STRPM      ----------
RECO_STRP8      ----------
RECO_STRPF      ----------
RECO_STREM      ----------
RECO_STRS2      ----------
RECO_STRSY      ----------
RECO_STRMU      ----------
RECO_STRA5      ----------
RECO_STRA3      ----------
RECO_STRA1      ----------
RECO_STRT2      ----------
RECO_STRT1      ----------
RECO_STRTD      ----------
RECO_LACLS      ----------
RECO_LACLM      ----------
RECO_LACLA      ----------
RECO_ENTFA      ----------
RECO_LACBA      ----------
RECO_LACPL      ----------
RECO_LACSS      ----------
RECO_LACRD      ----------
RECO_LACRJ      ----------
RECO_LACF3      ----------
RECO_LACS1      ----------
RECO_PEDPA      ----------
RECO_LEUMM      ----------
RECO_LEUCK      ----------
RECO_OENOB      ----------
RECO_LACAC      ----------
RECO_LACH4      ----------
RECO_LACJO      ----------
RECO_LACGA      ----------
RECO_LACDB      ----------
RECO_LACDA      ----------
RECO_CLOPS      ----------
RECO_CLOP1      ----------
RECO_CLOPE      ----------
RECO_CLONN      ----------
RECO_CLOK5      ----------
RECO_CLOAB      ----------
RECO_ALKMQ      ----------
RECO_ALKOO      ----------
RECO_CLOD6      ----------
RECO_HUNT2      ----------
RECO_CALS8      ----------
RECO_THEPX      ----------
RECO_THEP3      ----------
RECO_CALS4      ----------
RECO_NOSS1      ----------
RECO_TRIV2      ----------
RECO_NOSP7      ----------
RECO_TRIEI      ----------
RECO_GLOC7      ----------
RECO_RIPO1      ----------
RECO_SYNY3      ----------
RECO_ACAM1      ----------
RECO_SYNP6      ----------
RECO_SYNE7      ----------
RECO_THEEB      ----------
RECO_SYNJB      EKWASA----
RECO_SYNJA      ETLGSNLKKL
RECO_GLOVI      ----------
RECO_NOCFA      ----------
RECO_RHOJR      ----------
RECO_MYCSK      Q----LAAGS
RECO_MYCSS      Q----LAAGS
RECO_MYCSJ      Q----LAAGS
RECO_MYCS2      EDLPATASGA
RECO_MYCGI      Q-LPPAASGA
RECO_MYCA9      R----SAAG-
RECO_MYCMM      ----------
RECO_MYCUA      ----------
RECO_MYCTA      ----------
RECO_MYCTU      ----------
RECO_MYCBP      ----------
RECO_MYCBO      ----------
RECO_MYCPA      ----------
RECO_MYCLE      ----------
RECO_SACEN      DG--------
RECO_STRCO      ----------
RECO_STRAW      ----------
RECO_STRGG      ----------
RECO_THEFY      ----------
RECO_NOCSJ      ----------
RECO_FRACC      ----------
RECO_LEIXX      ----------
RECO_CUTAK      ----------
RECO_BIFLO      ----------
RECO_BIFLD      ----------
RECO_BIFAA      ----------
RECO_RUBXD      ----------
RECO_PELTS      ----------
RECO_DESAP      ----------
RECO_DESRM      ----------
RECO_MOOTA      ----------
RECO_SYMTH      ----------
RECO_DESHY      ----------
RECO_HELMI      ----------
RECO_HERA2      ----------
RECO_ROSS1      DPPGAR----
RECO_DEHMC      ----------
RECO_DEHMB      ----------
RECO_DEHM1      ----------
RECO_ANASK      ----------
RECO_ANADE      ----------
RECO_ANADF      ----------
RECO_MYXXD      ----------
RECO_GEOMG      ----------
RECO_GEOSL      ----------
RECO_GEOUR      ----------
RECO_PELPD      ----------
RECO_DESAL      ----------
RECO_DESOH      ----------
RECO_PROA2      ----------
RECO_CHLPB      ----------
RECO_CHLL2      ----------
RECO_CHLPD      ----------
RECO_PELPB      ----------
RECO_CHLP8      ----------
RECO_PELCD      ----------
RECO_SYNWW      ----------
RECO_SYNAS      ----------
RECO_SYNFM      ----------
RECO_CARHZ      ----------
RECO_KORVE      ----------
RECO_RHOBA      ----------
RECO_SALRD      ----------
RECO_SYNSC      ----------