CLUSTAL format seed alignment for MF_00210

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AROA_AERPE       -------------MVWLRAPDRVVVHPSTVEGRVEAPPSKSYTHRMLFLALLARG----R
AROA_PYRAB       -------------MFGPVSVEMIIERVDEVRGKVKAPPSKSYTHRAYFLSLLADS----P
AROA_METJA       ------------------MYLLIVKKTDRLEGIVKAPPSKSYTHRAVIGASLADG----V
AROA_METTH       -------------------MDLTVEKSGNLEGTVKAPPSKSYTHRAVIIAALAEG----V
AROA_ARCFU       -------------------MDVIVRK-GEIRGKAKPPASKSYTHRAFIAASLSPS-----
AROA_CLOPE       -------------------MKKVIITPSKLRGSVKIPPSKSMAHRAIICASLSKG----E
AROA_CLOAB       -------------------MNCVKINPCCLKGDIKIPPSKSLGHRAIICAALSEE----E
AROA_SACS2       --------------------MIVKIYPSKISGIIKAPQSKSLAIRLIFLSLFTR------
AROA_SULTO       --------------------MLVEINPSKIYGKVKAPQSKSFGIRLVLYSLLKE------
AROA_THEVO       --------------------MIVKVSNLGGSGIAEMPSSKSFTQRYVLASAFLNK----S
AROA_THEAC       --------------------MTVKIYGSGGSGTVALPSSKSFTQRYILGSVFLNK----S
AROA_PICTO       --------------------MNVRISGEFRPGVINAPSSKSFSQRYILYSAFSNI----P
AROA_BORBR       ---------------MSGLAYLDLPAARLARGEVALPGSKSISNRVLLLAALAEG----S
AROA_BORPE       ---------------MSGLAYLDLPAARLARGEVALPGSKSISNRVLLLAALAEG----S
AROA_NEIMA       -----------------MTESLRLPAASLKPSTVALPGSKSISNRTLLLAALSDN----A
AROA_BUCAI       -----------------MQNSLDLKPISHVNGTVCLPGSKSISNRVLLLSSIAKG----T
AROA_BUCAP       -----------------MQKFLELKPVSYINGTIYLPGSKSISNRVLLLSAMANG----I
AROA_ECOLI       ------------------MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHG----K
AROA_SHISO       ------------------MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHG----K
AROA_SHIDY       ------------------MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHG----K
AROA_SALGL       ------------------MESLTLQPIARVDGAINLPGSKSVSNRALLLAALACG----K
AROA_SALTY       ------------------MESLTLQPIARVDGAINLPGSKSVSNRALLLAALACG----K
AROA_SALTI       ------------------MESLTLQPIARVDGAINLPGSKSVSNRALLLAALACG----K
AROA_KLEPN       ------------------MESLTLQPIARVDGTVNLPGSKSVSNRALLLAALARG----T
AROA_YERE8       -----------------MLESLTLHPIALINGTVNLPGSKSVSNRALLLAALAEG----T
AROA_YERPE       -----------------MLESLTLQPIALVNGTVNLPGSKSVSNRALLLAALAEG----T
AROA_EDWI9       -----------------MSSALTLQPVRRFSGEINLPGSKSVSNRALLLAAQARG----V
AROA_HISSO       ------------------MEKLTLSPISRIDGEINLPGSKSLSNRALLLAALAKG----T
AROA_MANHA       ------------------MEKLTLTPISRVEGEINLPGSKSLSNRALLLAALATG----T
AROA_HAEIN       ------------------MEKITLAPISAVEGTINLPGSKSLSNRALLLAALAKG----T
AROA_PASMU       --------------MIKDATAITLNPISYIEGEVRLPGSKSLSNRALLLSALAKG----K
AROA_NOSS1       -----------------MDTIAIPALNRPVDATVEIPGSKSITNRALLVAALAQG----D
AROA2_BACHD      MTRFDENARSPWTPLHDVKTVELFPLNQRLDGSITLPGSKSLTNRALIISALANS----D
AROA_MYCLE       ---------------MSIESWTAPVASTPVQANVTIPGSKSQTNRALMLAALAAAQGQGT
AROA_MYCTU       -----------------MKTWPAPTAPTPVRATVTVPGSKSQTNRALVLAALAAAQGRGA
AROA_COREF       ------------------------------MWPQVIPGSKSITNRALILAALAAG----P
AROA_CORGL       -------MVFVSDSSISLPIWDAPRARGPIVSDLAIPGSKSITNRALILAALAST----P
AROA_BURPS       ----------MTTSDRLQPSFVEVKNTSTLSGTIDLPASKSSSTRALLTAALTPG----I
AROA_DEIRA       -----------MSDALPATFDVIVHPARELRGELRAQPSKNYTTRYLLAAALAEG----E
AROA_CHLPN       ---------------MLTYK----VSPSSVYGNAFIPSSKSHTLRAILWASVAEG----K
AROA_CHLTR       ---------------MVSSNQDLLISPSIPYGEIAVPPSKSHSLRAILFASLSKG----T
AROA_HELPY       -----------------------------MIELDINASDKSLSHRAVIFSLLAQK----P
AROA_HELPJ       -----------------------------MIELDINASDKSLSHRAVIFSLLAQK----P
AROA_CAMJE       -------------------MKIYKLQTPVNAILENIAADKSISHRFAIFSLLTQE----E
AROA_LEPIC       ---------------------MIPKKTKLKSREIEVPGDKSLSHRSVLFAALSKG----K
AROA_CHLTE       -------------------------MSTFQGEVTTLPPDKSISHRAALIGALAEG----T
AROA_AGRSC       ------------MSHGASSRPATARKSSGLSGTVRIPGDKSISHRSFMFGGLASG----E
AROA_PSES2       ------------MSHSASPKPATARRSEALTGEIRIPGDKSISHRSFMFGGLASG----E
AROA_DICNO       -----------MMTNIWHTAPVSA-----LSGEITICGDKSMSHRALLLAALAEG----Q
AROA_LACLM       --------------------MKLKINSQGLKGRLKVPGDKSISHRSIMFGSIAKG----K
AROA_STRPN       --------------------MKLKTNIRHLHGSIRVPGDKSISHRSIIFGSLAEG----E
AROA_BACSU       --------------------MKRDK-VQTLHGEIHIPGDKSISHRSVMFGALAAG----T
AROA_SYNY3       ----MALLSLNNHQSHQRLTVNPPAQGVALTGRLRVPGDKSISHRALMLGAIATG----E
AROA_STAA8       -----------------MVNEQIIDISGPLKGEIEVPGDKSMTHRAIMLASLAEG----V
AROA_AQUAE       --------------------MKKIEKIKRVKGELRVPSDKSITHRAFILGALASG----E
AROA_THEMA       --------------------------------MLSVPPDKSITHRALILSALAET----E
                                                       .*.   *  . .          

AROA_AERPE       SVVRRPLVSNDTLATLNAVALLGGKPRL-------------GRGVAEVEGGEVRGGAVVY
AROA_PYRAB       SKVMNPLISEDTIASLDAISKFGAQVNG-------------NKIIPPQE----LTPGKID
AROA_METJA       SRIINPLWGADCLSSVHGCRMLGANIELDKE-KD-------EWIVKG--GELKTPDNIID
AROA_METTH       SEIRDPLIAEDTLSSLNACRAFGIRVD---E-GD-------AWTVHGSGGELETPDDVIY
AROA_ARCFU       ARVVNPLISEDTISTLNACKRIGAAVLK--K-GN-------EWLFSG--VDGVEAEGYFN
AROA_CLOPE       SVISNIDFSEDIIATMEGMKSLGANIKVEK---D-------KLIINGENILKDSNYKFID
AROA_CLOAB       STIENISYSKDIKATCIGMSKLGALIIEDAKDNS-------TLKIKKQKLVS-KEKVYID
AROA_SACS2       VYLHNLVLSEDVIDAIKSVRALGVKVKNNSE----------FIPPEKL----EIKERFIK
AROA_SULTO       SKLDNLIPSDDVNVAINVVKQLGVSVEGT------------YFKREKE----LVTPKFLY
AROA_THEVO       VVLNGITITNDDDVAMRIAESVGSTITINNR----------SIKISSN----FKCPEEIY
AROA_THEAC       VTLNYVTITGDDSIALDIAQRAGANITMNDS----------SIKIRTS----FTCPSDIY
AROA_PICTO       VTLKNVSFSDDERIALEIARACGADIEFND-----------SLTIKPD----FRCPDEIN
AROA_BORBR       TEITGLLDSDDTRVMLAALRQLGVSVGEVADG-C-------VTIEGVA-RFPTEQA-ELF
AROA_BORPE       TEITGLLDSDDTRVMLAALRQLGVSVGEVADG-C-------VTIEGVA-RFPTEQA-ELF
AROA_NEIMA       CEIHSLLKSDDTDRMLEALDKLGVEIEYLAED-R-------LKVHGTGGRFPNRTA-DLF
AROA_BUCAI       TCLTNLLNSHDTQHMLNALKKLGVRYNLSDDKKT-------CHVQGIGGPFHLSEAISLY
AROA_BUCAP       TCLTNLLDSQDTQYMLNALRKIGIKFFLSNNNTT-------CHVHGIGKAFHLSHPISLF
AROA_ECOLI       TVLTNLLDSDDVRHMLNALTALGVSYTLSADRTR-------CEIIGNGGPLHAEGALELF
AROA_SHISO       TVLTNLLDSDDVRHMLNALTALGVSYTLSADRTR-------CEIIGNGGPLHAEGALELF
AROA_SHIDY       TVLTNLLDSDDVRHMLNALAALGVSYTLSADRTR-------CEIIGNGGSLHAEGALELF
AROA_SALGL       TVLTNLLDSDDVRHMLNALSALGINYTLSADRTR-------CDITGNGGPLRAPGALELF
AROA_SALTY       TALTNLLDSDDVRHMLNALSALGINYTLSADRTR-------CDITGNGGALRAPGALELF
AROA_SALTI       TVLTNLLDSDDVRHMLNALSALGINYTLSADRTR-------CDITGNGGPLRASGTLELF
AROA_KLEPN       TVLTNLLDSDDVRHMLNALSALGVHYVLSSDRTR-------CEVTGTGGPLQAGSALELF
AROA_YERE8       TQLNNLLDSDDIRHMLNALQALGVKYRLSADRTR-------CEVDGLGGKLVAEQPLELF
AROA_YERPE       TQLNNVLDSDDIRHMLNALQALGVDFRLSADRTC-------CEVDGLGGKLVAEQPLSLF
AROA_EDWI9       TRLHNLLDSDDVRYMLDALKALGVRYQLSDCRTR-------CEVQGLGGTLSAHGALTLF
AROA_HISSO       TQVTNLLDSDDIRYMLNALKALGVNYQLSDDKTV-------CVVEGIGGAFQWQNGLSLF
AROA_MANHA       TQVTNLLDSDDIRHMLNALKALGVKYELSDDKTV-------CVVEGIGGAFKVQNGLSLF
AROA_HAEIN       TKVTNLLDSDDIRHMLNALKALGVRYQLSDDKTI-------CEVEGLGGTFNIQDNLSLF
AROA_PASMU       TTLTNLLDSDDVRHMLNALKELGVTYQLSEDKSV-------CEIEGLGRAFEWQSGLALF
AROA_NOSS1       STLENALFSEDSEYFAKCVEQLGIPITLHPHLAQ-------IQVSGKGGDIPAKQA-DLF
AROA2_BACHD      SMLTGMLKSDDTYWCIQALKRLGVQINVQGETTS-------IRGIGG----QWKSS-SLY
AROA_MYCLE       STIGGALRSRDTELMISALRTLGLHVDE-----A-------GSVLTVNGRITPGEDAQVD
AROA_MYCTU       STISGALRSRDTELMLDALQTLGLRVDG-----V-------GSELTVSGRIEPGPGARVD
AROA_COREF       STIHGVLRSRDTDLMADALRSMGVTITE-----E-------APDRYHVEPPAELSSGSID
AROA_CORGL       STIIDVLRSRDTDLMTDGLRSLGITITE-----E-------AVDRYRVEP-GQLSAGSVE
AROA_BURPS       STIRNVATGFNSNAMKHNCERLGASFSSEGDTTV-------VKGVDVM---HVDREIVFD
AROA_DEIRA       TRVVGVATSEDAEAMLRCLRDWGAGVELVGDDAV-------IRGFGA----RPQAGVTLN
AROA_CHLPN       SIIYNYLDSPDTEAMICACKQMGASIKKFPQILE-------IVGNPLA---IFPKYTLID
AROA_CHLTR       SIIENCLFSPDSQAMLTACEKMGAHVRRIGDSLH-------IQGNPDP---HHCHPRYFH
AROA_HELPY       CFVRNFLMGEDCLSSLEIAQNLGAKVENTAKNSFK--------ITPP--TTIKEPNKILN
AROA_HELPJ       CFVRNFLMGEDCLSSLEIAQNLGAKVENTAKNSFK--------ITPP--TTIKEPNKILN
AROA_CAMJE       NKAQNYLLAQDTLNTLEIIKNLGAKIEQK-DSCVK--------IIPP--KEILSPNCILD
AROA_LEPIC       SKVTGFLEAEDPLNTMSAFAKLGLKVQKVKPGEYE--------FESPGKNKLVSPNVDLD
AROA_CHLTE       TEISNFSGGYDNQSTLSVLRDAGISIRQEELSAGDGRIERRVVIESNGLWSFREPSVPLM
AROA_AGRSC       TRITGLLEGEDVINTGKAMQAMGARIRKE--GDT-------WIIDGVGNGGLLAPEAPLD
AROA_PSES2       TRITGLLEGEDVINTGRAMQAMGAKIRKE--GDV-------WIINGVGNGCLLQPEAALD
AROA_DICNO       TEIRGFLACADCLATRQALRALGVDIQRE--KEI-------VTIRGVGFLGLQPPKAPLN
AROA_LACLM       TIIHDILRGEDVLSTIEAFRALGVEIEDD--GQV-------ITVHGQGISKLKEPEKALD
AROA_STRPN       TKVYDILRGEDVLSTMQVFRDLGVEIEDK--DGV-------ITIQGVGMAGLKAPQNALN
AROA_BACSU       TTVKNFLPGADCLSTIDCFRKMGVHIEQS--SSD-------VVIHGKGIDALKEPESLLD
AROA_SYNY3       TIIEGLLLGEDPRSTAHCFRAMGAEISEL--NSEK------IIVQGRGLGQLQEPSTVLD
AROA_STAA8       STIYKPLLGEDCRRTMDIFRLLGVEIKED--DEK-------LVVTSPGYQSFNTPHQVLY
AROA_AQUAE       TLVRKPLISGDTLATLEILKAIRTKVREG--KEE-------VLIEGRNY-TFLEPHDVLD
AROA_THEMA       STLYNLLRCLDTERTHDILEKLGTRFEGD--WEK-------MKVFPK---PFAEPIEPLF
                           :                                               . 

AROA_AERPE       AAGSGTTIRIAMGVAA-HSAEA-----TLLYGDESLNRRPVHPLSEALRSMGARVCDT--
AROA_PYRAB       ARESGTTARISLAVAS-LARGT-----SVITGKGRLVERPFKPLVDALRSLKVKISGE--
AROA_METJA       IGNSGTTLRILTSIASQIPKGY-----AILTGDDSIRKRPMQPLLDALKQLNIEAFSSKL
AROA_METTH       LGNSGTTLRLMTSVAG-LAENY-----TVLTGDESLRTRPMQPLLDALRPLGVEALSSRM
AROA_ARCFU       FANSGTTLRIFTGLLS-LSPFR-----SVVDGDESLRKRPNGELVLALSKLGARFKGR--
AROA_CLOPE       CNESGSTLRFLVPISL-IKDNR-----VNFIGRGNLGKRPLKTYYEIFEEQEIKYSYEE-
AROA_CLOAB       CSESGSTVRFLIPISL-IEERN-----VVFDGQGKLSYRPLDSYFNIFDEKEIAYSHPEG
AROA_SACS2       LKGSATTLRMLIPILA-AIGGE-----VTIDADESLRRRPLNRIVQALSNYGISFSSYSL
AROA_SULTO       FGGSATTLRMSIPILS-VLGVD-----TIIDGDETLRKRPLNAIIKALEG-SVSFSSSLL
AROA_THEVO       VGESGTSYRLSIGLLA-ASGCV-----TRIKGEDSLAKRPIEPLLMALGENGVKFERNEA
AROA_THEAC       VGESATSYRIALGLLG-SAGCI-----THVKGDPDLAKRPMDPLVKALEANDVHLKLNED
AROA_PICTO       AGESGTSLRLATGLLA-ARRCK-----TFIHEEASLLKRPLDDLIKTLSEKNVVFNNLDN
AROA_BORBR       LGNAGTAFRPLTAALALMG------GDYRLSGVPRMHERPIGDLVDALRQFGAGIEYLGQ
AROA_BORPE       LGNAGTAFRPLTAALALMG------GDYRLSGVPRMHERPIGDLVDALRQFGAGIEYLGQ
AROA_NEIMA       LGNAGTAFRPLTAALAVLG------GDYRLHGVARMHERPIGDLADALRIAGADVEYLGK
AROA_BUCAI       LGNAGTAIRPLLSVLSLHK------NNILLNGDDRMHERPIGDLVDALIQGGAVIEYKKN
AROA_BUCAP       LGNAGTAMRPLLAALSLYE------NNVVLSGDDRMHERPIAHLVDALKQGGATLEYKKG
AROA_ECOLI       LGNAGTAMRPLAAALCLGS------NDIVLTGEPRMKERPIGHLVDALRLGGAKITYLEQ
AROA_SHISO       LGNAGTAMRPLAAALCLGS------NDIVLTGEPRMKERPIGHLVDALRLGGAKITYLEQ
AROA_SHIDY       LGNAGTAMRPLAAALCLGS------NDIVLTGEPRMKERPIGHLVDALRLGRAKITYLEQ
AROA_SALGL       LGNAGTAMRPLAAALCLGQ------NEIVLTGEPRMKERPIGHLVDSLRQGGANIDYLEQ
AROA_SALTY       LGNAGTAMRPLAAALCLGQ------NEIVLTGEPRMKERPIGHLVDSLRQGGANIDYLEQ
AROA_SALTI       LGNAGTAMRPLAAALCLGQ------NEIVLTGEPRMKERPIGHLVDSLRQGGANIDYLEQ
AROA_KLEPN       LGNAGTAMRPLAAALCLGS------NDIVLTGEPRMKERPIGHLVDALRQGGAQIDYLEQ
AROA_YERE8       LGNAGTAMRPLAAALCLGK------NDIVLTGEPRMKERPIGHLVDALRQGGAQIDYLEQ
AROA_YERPE       LGNAGTAMRPLAAVLCLGN------SDIVLTGEPRMKERPIGHLVDALRQGGAQIDYLEQ
AROA_EDWI9       LGNAGTAMRPLAAALSLGL------RDVILTGEPRMKERPIAHLVTALRQGGAQVDYLES
AROA_HISSO       LGNAGTAMRPLAAALCLKGDTE---SEVILTGEPRMKERPIKHLVDALRQTGANIQYLEN
AROA_MANHA       LGNAGTAMRPLAAALCLKGAET---AQIILTGEPRMKERPIKHLVDALRQVGAEVQYLEN
AROA_HAEIN       LGNAGTAMRPLTAALCLKGKTE---SEIILTGEPRMKERPILHLVDALRQAGADIRYLEN
AROA_PASMU       LGNAGTAMRPLTAALCLSTPNKEGKNEIVLTGEPRMKERPIQHLVDALCQAGAEIQYLEQ
AROA_NOSS1       VGLAGTAARFITALVALG------NGEYRLDGVPRMRERPMGDLVTVLQNSGITINFEGN
AROA2_BACHD      IGAAGTLARFLLGALAISR-----SGNWEIEASQSMSKRPIEPLVGVLRELGATIHYLRR
AROA_MYCLE       CGLAGTVLRFVPPLAALSA------NPVTFDGDEQARARPITPLLDALRGLGVPVDGVG-
AROA_MYCTU       CGLAGTVLRFVPPLAALGS------VPVTFDGDQQARGRPIAPLLDALRELGVAVDGTG-
AROA_COREF       CGLAGTVMRFVPPVAAFAD------GPVHFDGDEQARIRPMTSILDALRTLGVRVENNR-
AROA_CORGL       CGLAGTVMRFLPPVAAFAD------GPVHFDGDPQARVRPMTSILDALRSLGVEVDNNN-
AROA_BURPS       PGNSGVVLRLLMGVAGYLP-----DTRFVTQYRYSLGVRSQAEMVAALRRLNVECEAVGP
AROA_DEIRA       PGNAGAVARFLMGVAALTS-----GTTFVTDYPDSLGKRPQGDLLEALERLGAWVSS--N
AROA_CHLPN       AGNSGIVLRFMTALACVFS------KEITVTGSSQLQRRPMAPLLQALRNFGASFHFSSD
AROA_CHLTR       MGNSGIALRFLTALSTLSP------TPTLITGSHTLKRRPIAPLLSSLKQLGAHIRQKTS
AROA_HELPY       CNNSGTTMRLYSGLLSAQKGL------FVLSGDNSLNARPMKRIIEPLKAFGAKILGRED
AROA_HELPJ       CNNSGTSMRLYSGLLSAQKGL------FVLSGDNSLNARPMKRIIEPLKAFGAKILGRED
AROA_CAMJE       CGNSGTAMRLMIGFLAGISGF------FVLSGDKYLNNRPMRRISKPLTQIGARIYGRNE
AROA_LEPIC       FGNAGTGIRLSAGLICGLPGIN-----ATLTGDNSLKKRPMGRIIKPLSSMGASIVGLGE
AROA_CHLTE       CNNSGSTMRMMAGIMAAQPFR------SELVGDASLMKRPMKRVADPLRQMGAEISLSDA
AROA_AGRSC       FGNAATGCRLTMGLVGVY-DFD-----STFIGDASLTKRPMGRVLNPLREMGVQVKSE-D
AROA_PSES2       FGNAGTGARLTMGLVGTY-DMK-----TSFIGDASLSKRPMGRVLNPLREMGVQVEAA-D
AROA_DICNO       MQNSGTSMRLLAGILAAQ-RFE-----SVLCGDESLEKRPMQRIITPLVQMGAKIVSH-S
AROA_LACLM       MGNSGTSTRLLSGILAGL-PFE-----ATLFGDDSLSKRPMDRVATPLQMMGAEIVGQTD
AROA_STRPN       MGNSGTSIRLISGVLAGA-DFE-----VEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTE
AROA_BACSU       VGNSGTTIRLMLGILAGR-PFY-----SAVAGDESIAKRPMKRVTEPLKKMGAKIDGRAG
AROA_SYNY3       AGNSGTTMRLMLGLLAGQKDCL-----FTVTGDDSLRHRPMSRVIQPLQQMGAKIWARSN
AROA_STAA8       TGNSGTTTRLLAGLLSGL-GIE-----SVLSGDVSIGKRPMDRVLRPLKLMDANIEGI-E
AROA_AQUAE       AKNSGTTARIMSGVLSTQ-PFF-----SVLTGDESLKNRPMLRVVEPLREMGAKIDGREE
AROA_THEMA       CGNSGTTTRLMSGVLASY-EMF-----TVLYGDPSLSRRPMRRVIEPLEMMGARFMARQN
                    :.   *                             *.       :            

AROA_AERPE       --GGNPPVKVSGPLRRASVEVDAAISSQFATSLLIAGSRLG----EFELSAARLSS--RG
AROA_PYRAB       --K-LPIAVEGGNPVGEYVKVDCSLSSQFGTAMLILASKIG-----LTVEMLNPVS--RP
AROA_METJA       D-GTAPIIVKSGKIYGNVVKIRGDISSQFITSLMMLLPFNK----EDTEIILTSPLKSKP
AROA_METTH       N-GLPPIIVRGG-LRGGSTSIRGDVSSQFISSILIAAPLT-----EGVEVMVEGDFISRP
AROA_ARCFU       E-PYTPPFSVQGVIKGGEVEIEAP-SSQFVSSLLFALSLA-----EGDSSLRVEKVKSQP
AROA_CLOPE       ---ENLDLNIEGSLKGGEFKVKGNISSQFISGLLFTLPLLK----DDSKIIITTELESKG
AROA_CLOAB       ---KVLPLQIKGRLKAGMFNLPGNISSQFISGLMFSLPFLE----GDSIINITTNLESVG
AROA_SACS2       ---PLTITGKLSS---NEIKISGDESSQYISGLIYALHIL-----NGGSIEILPPISSKS
AROA_SULTO       ---PTKISGKLKE---NFVRIEGGESSQYISGFIYAFSLV-----GGGEIEIIPPISSKS
AROA_THEVO       ---GFYNVDGRNSQK-KHVEIEG-SSSQFVSSLMLYYAKK-----GGGEFTARNIKSI-G
AROA_THEAC       ---GFYDVDGSESKK-RYIEVDG-VSSQFVSSMIFYYARK-----GGGEFLVKNMRSP-G
AROA_PICTO       ---GIM-IDASNSIP-SDSIIDGGRSSQFVSSMMMYHSLT-----SGS-LKALNIVSN-D
AROA_BORBR       AGYPPLRIGGGSIRVDGPVRVEGSVSSQFLTALLMAAPVLARRSGQDITIEVVGELISKP
AROA_BORPE       AGYPPLRIGGGSIRVDGPVRVEGSVSSQFLTALLMAAPVLARRSGQDITIEVVGELISKP
AROA_NEIMA       EHYPPLHIGERQDNGERVIPIKGNVSSQFLTALLMALPL----TGQAFEIRMVGELISKP
AROA_BUCAI       KGYPPICTKG-GFLGG-SIFLNGNISSQFLTSLLISTPLA----LKDTTIFIKGNLVSKP
AROA_BUCAP       IGYPPVLTKG-GFKGG-SIMLDGSISSQFLTSLLMVAPLA----LQNTNIFIKGNLVSKP
AROA_ECOLI       ENYPPLRLQG-GFTGG-NVDVDGSVSSQFLTALLMTAPLA----PEDTVIRIKGDLVSKP
AROA_SHISO       ENYPPLRLQG-GFTGG-NVDVDGSVSSQFLTALLMNAPLA----PEDTVIRIKGDLVSKP
AROA_SHIDY       ENYPPLRLQG-GFTGG-NVDVDGSVSSQFLTALLMTAPLA----PEDTVIRIKGDLVSKP
AROA_SALGL       ENYPPLRLRG-GFIGG-DIEVDGSVSSQFLTALLMTAPLA----PKDTIIRVKGELVSKP
AROA_SALTY       ENYPPLRLRG-GFTGG-DIEVDGSVSSQFLTALLMTAPLA----PKDTIIRVKGELVSKP
AROA_SALTI       ENYPPLRLRG-GFIGG-DIEVDGSVSSQFLTALLMTAPLA----PEDTIIRVKGELVSKP
AROA_KLEPN       ENYPPLRLRG-GFTGG-DVEVDGSVSSQFLTALLMASPLA----PQDTVIAIKGELVSRP
AROA_YERE8       ENYPPLRIRG-GFRGG-KLTVDGSVSSQFLTALLMTAPLA----EQDTEIQIQGELVSKP
AROA_YERPE       ENYPPLRLRG-GFRGG-ELTVDGRVSSQFLTALLMTAPLA----EQDTTIRIMGDLVSKP
AROA_EDWI9       DGYPPVRLHG-GFNGG-EISVDGSVSSQFLTALLMAAPMA----AEETRITILGELVSKP
AROA_HISSO       DGYPPLAIRNQGIFGG-KVQIDGSISSQFLTALLMAAPLG----EGDMEIEILGELVSKP
AROA_MANHA       EGYPPLAISNSGLQGG-KVQIDGSISSQFLTALLMSAPLA----ESDMEIEIIGDLVSKP
AROA_HAEIN       EGYPPLAIRNKGIKGG-KVKIDGSISSQFLTALLMSAPLA----ENDTEIEIIGELVSKP
AROA_PASMU       EGYPPIAIRNTGLKGG-RIQIDGSVSSQFLTALLMAAPMA----EADTEIEIIGELVSKP
AROA_NOSS1       SGFMPYTIYGQQFAGG-HFRLKANQTSQQLSALLMIAPYA----QQDTTIEVEGTLVSQS
AROA2_BACHD      EGFYPLSIHGNGLAGG-TVRLSGQMSSQYISGLLIAAPYA----DTPVTITVQGSIVQHA
AROA_MYCLE       ---LPFQVQGSGSVAGGTVAIDASASSQFVSGLLLCAASF---TQGVTVQHTGSPVPSAP
AROA_MYCTU       ---LPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAASF---TDGLTVQHTGSSLPSAP
AROA_COREF       ---LPFTVTSDGIPEGGVVEIDASASSQFVSGLLLSAPRF---VNGVTVRHIGGRLPSMP
AROA_CORGL       ---LPFTVNAGEVPEGGVVEIDASGSSQFVSGLLLSAPRF---KNGVTVKHVGGRLPSMP
AROA_BURPS       EARLPISMRSTRALGK-HTEVSCKKSSQFLSGLLYLGAIG----ERDLEIDVVDHITAPS
AROA_DEIRA       DGRLPISV-SGPVRGG-TVEVSAERSSQYASALMFLGPLL----PDGLELRLTGDIKSHA
AROA_CHLPN       KSVLPFTMSGPLRSAY--SDVEGS-DSQFASALAVACSLA-----EGPCSFTIIEPKERP
AROA_CHLTR       -SSIPFTIHGPLSPGH--VTISGQ-DSQYASALAITAALA-----PYPLSFSIENLKERP
AROA_HELPY       NHFAPLVILG-SPLKACHYESPIA-SAQVKSAFILSALQA-----QGASTYKESELSRNH
AROA_HELPJ       NHFAPLAIVG-GPLKACDYESPIA-SAQVKSAFILSALQA-----QGISAYKESELSRNH
AROA_CAMJE       ANLAPLCIEG-QKLKAFNFKSEIS-SAQVKTAMILSAFRA-----DNVCTFSEISLSRNH
AROA_LEPIC       KETAPLKIEG-KKLKGFRYESPIA-SAQVKSCLMLAAISS-----ETDLEYSENILSRDH
AROA_CHLTE       GTAPVVIHGT-KALKTIEYRLPVP-SAQVKSLVAFAALHA-----DGQSKIIEPIRSRDH
AROA_AGRSC       GDRLPVTLRGPKTPTPITYRVPMA-SAQVKSAVLLAGLNT-----PGITTVIEPIMTRDH
AROA_PSES2       GDRMPLTLIGPKTANPITYRVPMA-SAQVKSAVLLAGLNT-----PGVTTVIEPVMTRDH
AROA_DICNO       NFTAPLHISG-RPLTGIDYALPLP-SAQLKSCLILAGLLA-----DGTTRLHTCGISRDH
AROA_LACLM       KVKLPMTIKGSAHLKAIDYILPVA-SAQVKSAVIFAALQA-----EGLTKVVEKEKTRSH
AROA_STRPN       RDLPPLRLKGTKNLRPIHYELPIA-SAQVKSALMFAALQA-----KGESVIIEKEYTRNH
AROA_BACSU       GEFTPLSVSG-ASLKGIDYVSPVA-SAQIKSAVLLAGLQA-----EGTTTVTEPHKSRDH
AROA_SYNY3       GKFAPLAVQG-SQLKPIHYHSPIA-SAQVKSCLLLAGLTT-----EGDTTVTEPALSRDH
AROA_STAA8       DNYTPLIIKP-SVIKGINYQMEVA-SAQVKSAILFASLFS-----KEPTIIKELDVSRNH
AROA_AQUAE       GNKLPIAIRG-GNLKGISYFNKKS-SAQVKSALLLAGLRA-----EGMTEVVEPYLSRDH
AROA_THEMA       -NYLPMAIKG-NHLSGISYKTPVA-SAQVKSAVLLAGLRA-----SGRTIVIEPAKSRDH
                                           :*  : .                           

AROA_AERPE       YVDITLESLSMFGVRVER--EGYRLFRLRGTPKPVD--AAVPGDYSSASFMLAAG-AIAG
AROA_PYRAB       YIEVTLKVMESFGIEFER--NGFKVKVHPGIRGS-K--FHVPGDYSSASFFLAAG-ALYG
AROA_METJA       YIDITLDILNKFGIKIDKT-DNGFLVYGNQKYKPID--YIVEGDYSSASYLIAAGVLINS
AROA_METTH       YVDMTVDVMERFSVPVDYS-EGTFRVE-PAVYRGLD--YTVEGDYSSASYLAGAVAAAGG
AROA_ARCFU       YIDVTLDVLRESGVKVERE-GNFYHIPGSQSFKLRR--YDVPADFSSASYLIAAG-LIAG
AROA_CLOPE       YIDLTLDMIEKFGVTIKNNNYREFLIKGNQSYKPMN--YKVEGDYSQAAFYFSAGALGSE
AROA_CLOAB       YVDMTIDMLKKFGIEIENKAYKSFFIKGNQKCKGTK--YKVEGDFSQAAFWLSAGILNGN
AROA_SACS2       YILLTIDLFKRFGSDVKFY--GSKIHVNPNNLVEFQ--GEVAGDYGLASFYALSALVSGG
AROA_SULTO       YIYLTIELLNSLGGNIKMK--GNKIYVEKGDFKPYI--GKVPGDYALASFYASSSIVSGG
AROA_THEVO       YVYITKRVLYDLGYFANIE--RTITINPTGVWK-TA--IDVEPDYSSMAFFMVLGLLSDS
AROA_THEAC       YVYITKRVLYDLGYFVNIE--KTITINPSGVWK-TA--IDVEPDYSSLAFFLVLGLLSEN
AROA_PICTO       YIKITIKTLNDFGISVYSS--NGFFEFGKTLMKGNK--ICIEGDYSSAAFWIVLGLFKGD
AROA_BORBR       YIEITLNLMARFGVSVRRDGWRAFTIARDAAYRGPG-RMAIEGDASTASYFLALGAIGGG
AROA_BORPE       YIEITLNLMARFGVSVRRDGWRAFTIARDAVYRGPG-RMAIEGDASTASYFLALGAIGGG
AROA_NEIMA       YIDITLKLMAQFGVQVINEGYRVFKIPADAHYHAPE-HLHVEGDASSASYFLAAGLIAAT
AROA_BUCAI       YIDITLNLIKIFGVNIEHDSYNVFYIKGKQQYKTPG-KYTIEGDASSASYFLAAAAIKGG
AROA_BUCAP       YIDITLNLMKSFGVNIVNDCYKSFYIKGNQKYESPG-NYLVEGDASSASYFLAAAAIKGG
AROA_ECOLI       YIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPG-TYLVEGDASSASYFLAAAAIKGG
AROA_SHISO       YIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPG-TYLVEGDASSASYFLAAAAIKGG
AROA_SHIDY       YIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPG-TYLVEGDASSASYFLAAAAIKGG
AROA_SALGL       YIDITLNLMKTFGVEIANHHYQQFVVKGGQQYHSPG-RYLVEGDASSASYFLAAGAIKGG
AROA_SALTY       YIDITLNLMKTFGVEIANHHYQQFVVKGGQQYHSPG-RYLVEGDASSASYFLAAGAIKGG
AROA_SALTI       YIDITLNLMKTFGVEIANHHYQQFVVKGGQQYHSPG-RYLVEGDASSASYFLAAGAIKGG
AROA_KLEPN       YIDITLHLMKTFGVEVENQAYQRFIVRGNQQYQSPG-DYLVEGDASSASYFLAAGAIKGG
AROA_YERE8       YIDITLHLMKAFGVDVVHENYQIFHIKGGQTYRSPG-IYLVEGDASSASYFLAAAAIKGG
AROA_YERPE       YIDITLHLMKAFGIDVGHENYQIFHIKGGQTYRSPG-TYLVEGDASSASYFLAAAAIKGG
AROA_EDWI9       YIAITLAMMRAFGVEVENHAYRHFVVRGGQVYQAPS-DYLVEGDASSASYFLAGAAIAGG
AROA_HISSO       YIDITPAMMKDFGINVDDYNYQRFLIKGKQYYISPQ-TYLVEGDASSASYFLAAAAIKG-
AROA_MANHA       YIDITLSMMNDFGITVENRDYKTFLVKGKQGYVAPQGNYLVEGDASSASYFLASGAIKG-
AROA_HAEIN       YIDITLAMMRDFGVQVENHHYQKFQVKGNQSYISPN-KYLVEGDASSASYFLAAGAIKG-
AROA_PASMU       YIDITLKMMQTFGVEVENQAYQRFLVKGHQQYQSPH-RFLVEGDASSASYFLAAAAIKG-
AROA_NOSS1       YVKMTCRLMADFGVDVTQTDDNQFHIKAGQRYQARH--YTIEPDASNASYFFAAAAVTGG
AROA2_BACHD      YVFLTLHLMKSFGAQVEYDQQLQTIVVHPTPYTCQD--IDLEADASTACYFLALAALTKG
AROA_MYCLE       HIAMTVMMLRQAGVQVDDSVGNRWQVRPGT---VAARHWVVEPDLTNAVAFLAAAAVSGG
AROA_MYCTU       HIAMTAAMLRQAGVDIDDSTPNRWQVRPGP---VAARRWDIEPDLTNAVAFLSAAVVSGG
AROA_COREF       HIEMTVAMLREVGIRVDVT-PNQWTVHPGE---IRGHTWRIEPDLSNATPFLAAAAVTRG
AROA_CORGL       HIEMTVDMLRSAGIEIEES-ENQWVVHPGE---ILGRTWRIEPDLSNATPFLAAAAVTGG
AROA_BURPS       MVHTTINNLAHAGVAVEYDAAFRRFFVPGRDRFKPS-EFTVGADPASTAAILALCGSLAS
AROA_DEIRA       PLRQTLDTLSDFGVRATASDDLRRISIPGGQKYRPG-RVLVPGDYPGSAAILTAAALLPG
AROA_CHLPN       WFDLSLWWLEKLHLPYSCSDTTYSFPGSSH---PQGFSYHVTGDFSSAAFIAAAALLSKS
AROA_CHLTR       WFDLTLDWLHSLNISFLRDQDSLTFPGGQS---LESFSYSVPGDYSSAAFLASFGLLSSS
AROA_HELPY       TEIMLKSLGADIHNQDG----VLKISPLEKPLEAFD--FTIANDPSSAFFFALACAITPK
AROA_HELPJ       TEIMLKSLGANIQNQDG----VLKISPLEKPLESFD--FTIANDPSSAFFLALACAITPK
AROA_CAMJE       SENMLKAMKAPIRVSNDG--LSLEINPLKKPLKAQN--IIIPNDPSSAFYFVLAAIILPK
AROA_LEPIC       TENMFRFLGNKIEQISP----LHFKIKPPYVLNGGE--FRVPGDISSAAFFLVLGVLAKE
AROA_CHLTE       TELMLGLATIDRPDGVR-----EIIIDGRKPIAAKP--FKVPADPSAACFMIALGLLGER
AROA_AGRSC       TEKMLQGFGANLTVETDADGVRTIRLEGRGKLTGQV--IDVPGDPSSTAFPLVAALLVPG
AROA_PSES2       TEKMLQGFGADLTVETDKDGVRHIRITGQGKLVGQT--IDVPGDPSSTAFPLVAALLVEG
AROA_DICNO       TERMLPLFGGALEIKKE-----QIIVTGGQKLHGCV--LDIVGDLSAAAFFMVAALIAPR
AROA_LACLM       TEEMLVQFGGEITVS-----DKTILVPGGQKLLGQE--VTVPGDISSAAFWLVAGLVVEN
AROA_STRPN       TEDMLKQFGGHLSVD-----GKKITVQGPQKLTGQK--VVVPGDISSAAFWLVAGLIAPN
AROA_BACSU       TERMLSAFGVKLSED-----QTSVSIAGGQKLTAAD--IFVPGDISSAAFFLAAGAMVPN
AROA_SYNY3       SERMLQAFGAKLTIDPV---THSVTVHGPAHLTGQR--VVVPGDISSAAFWLVAASILPG
AROA_STAA8       TETMFKHFNIPIEAEGL---SINTTPEAIRYIKPAD--FHVPGDISSAAFFIVAALITPG
AROA_AQUAE       TERMLKLFGAEVITIP-EERGHIVKIKGGQELQGTE--VYCPADPSSAAYFAALATLAPE
AROA_THEMA       TERMLKNLGVPV-----EVEGTRVVLEPAT-FRGFT--MKVPGDISSAAFFVVLGAIHPN
                                                            *                

AROA_AERPE       R--VEVEGLRPVDPQPDRRIVELLRSMGARVRVEGGV----VAVESTG-----PLEPVDV
AROA_PYRAB       K--VKVSNLVKDDPQADARIIDILEEFGADVKVGRKY----VVVERN------EMKPINV
AROA_METJA       N--ITIENLFANSKQGDKAIINIVKEMGADIKVKKDK----VIIEGEY-----SLKGIDV
AROA_METTH       D--VLIENLFRDSRQGDRIILDIISDMGAEVRRGEDH----VRIASTG-----ELSGVSV
AROA_ARCFU       E--VVLEGMFESAQ-GDRKIVDICREMGGSVEWDKKRG---VIRAERS-----ELEGVEV
AROA_CLOPE       ---INCLDLDLSSYQGDKECIEILEGMGARLIESQERS---LSI-IHG-----DLNGTII
AROA_CLOAB       ---INCKDLNISSLQGDKVILDILKKMGGAIDE---KS---FSS-KKS-----HTHGIVI
AROA_SACS2       G-ITITNLWEPKEYFGDHSIVKIFSEMGA-SSEYKDGR---WFVKAKD-----KYSPIKI
AROA_SULTO       E-IVIEDVYELPNFDGDHSIVNFYKMMGA-ESYVKDNK---WIVKSSE-----KLNGIEV
AROA_THEVO       V-DVRFRIKRISRIQPDSVILDLFKNN----ILINGEE---IRV-ISG-----INEPVSV
AROA_THEAC       V-DVRFNIKRMSRIQPDSVLLDMFKDN----IAIDRDT---LRV-LPG-----IRDRITV
AROA_PICTO       I-EIK-NLKSDS-CQPDAAIINIINGISERKIDIYNNK---IVVHKTR-----FLGDLYI
AROA_BORBR       --PVRVTGVGEDSIQGDVAFAATLAAMGADVRYGPG----WIETRGVRVAEGGRLKAFDA
AROA_BORPE       --PVRVTGVGEDSIQGDVAFAATLAAMGADVRYGPG----WIETRGVRVAEGGRLKAFDA
AROA_NEIMA       --PVRVTGIGANSIQGDVAFACELEKIGADVVWGEN----FVEVSRPKER---AVRAFDL
AROA_BUCAI       --SIKVTGVGKKSIQGDIEFANILEKMGATIFWEDY----SITCTR------NKLNAIDL
AROA_BUCAP       --SVKVVGVGKKSVQGDIKFADVLEKMGAIIDWGDS----FIVCRH------NKLEKIDL
AROA_ECOLI       --TVKVTGIGRNSMQGDIRFADVLEKMGATICWGDD----YISCTR------GELNAIDM
AROA_SHISO       --TVKVTGIGRNSMQGDIRFADVLEKMGATICWGDD----YISCTR------GELNAIDM
AROA_SHIDY       --TVKVTGIGRNSMQGDIRFADVLEKMGATICWGDD----YISCTR------GELNAIDM
AROA_SALGL       --TVKVTGIGRKSMQGDIRFADVLEKMGATITWGDD----FIACTR------GELHAIDM
AROA_SALTY       --TVKVTGIGRKSMQGDIRFADVLEKMGATITWGDD----FIACTR------GELHAIDM
AROA_SALTI       --TVKVTGIGRKSMQGDIRFADVLEKMGATITWGDD----FIACTR------GELHAIDM
AROA_KLEPN       --TVKVTGIGRNSVQGDIRFADVLEKMGATVTWGED----YIACTR------GELNAIDM
AROA_YERE8       --TVRVTGIGKQSVQGDTKFADVLEKMGAKISWGDD----YIECSR------GELQGIDM
AROA_YERPE       --TVRVTGIGKKSVQGDTKFADVLEKMGAKVTWGDD----YIECSR------GELQGIDM
AROA_EDWI9       --TVRVTGIGRHSMQGDIHFADVLEKMGAQVEWGND----YIACTR------DSLHGIDM
AROA_HISSO       --KVKVTGIGRNSIQGDRLFADVLAQMGAKVTWGED----FIQVEK------SELKGIDM
AROA_MANHA       --KVKVTGIGKKSIQGDRLFADVLEKMGAKITWGED----FIQAEQ------SPLKGVDM
AROA_HAEIN       --KVKVTGIGKNSIQGDRLFADVLEKMGAKITWGED----FIQAEH------AELNGIDM
AROA_PASMU       --KVKVTGVGKNSIQGDRLFADVLEKMGAHITWGDD----FIQVEK------GNLKGIDM
AROA_NOSS1       --RVRVNHLTKQSCQGDILWLNVLEQMGCQVIEGAD----YTEVIGPE----QLQG-IDI
AROA2_BACHD      --RIRLNNLTASTTQPDLHMLTVFEKMGCTVTRGSS----FIELEGVS----QLKGGFQI
AROA_MYCLE       --TVRITGWPKTSVQPADNILNILFRLNVVVNQTDS----FLEVQGS-----TVYDGFDV
AROA_MYCTU       --TVRITGWPRVSVQPADHILAILRQLNAVVIHADS----SLEVRGP-----TGYDGFDV
AROA_COREF       --TVTVRNWPRDTTQPGDSIRSILEDMGCTVEFISNGATFDLEVTGP-----AELKGIHL
AROA_CORGL       --TIKINHWPIKTTQPGDAIRSILERMGCEVELVAQGEGYDLSVTGP-----VALKGIEI
AROA_BURPS       --DVTLNGFFEEEL-GSGAVIRYLTDTGTLIDELPGN---RIRIRGG-----ASIRAQDF
AROA_DEIRA       --EVRLSNLREHDLQGEKEAVNVLREMGADIVRE-GD---TLTVRGG-----RPLHAVTR
AROA_CHLPN       LQPIRLRNLDILDIQGDKIFFSLMQNLGASIQYDNE----EILVFP------SSFSGGSI
AROA_CHLTR       SKPTILRNLSSQDSQGDKLLFSLLKQLGAHILIGKH----HIEMHP------SSFSGGEI
AROA_HELPY       S---RLLLKNVLLNPTRIEAFEVLKKMGASIEYAIQ-SKDLEMIGDIYVEH-APLKAINI
AROA_HELPJ       S---RLLLKNVLLNPTRIEAFEVLKKMGAHIEYVIQ-SKDLEVIGDIYIEH-APLKAISI
AROA_CAMJE       S---QIILKNILLNPTRIEAYKILQKMGAKLEMTIT-QNDFETIGEIRVES-SKLNGIEV
AROA_LEPIC       G---NLLIKNIGLNPARTGILTALQSMGAKIEIQNKRIECGEPVGDLKTYP-SNLKKSNI
AROA_CHLTE       S---EIVLRNVCLNPTRVAYIDVLQEAGAGLGIENVRSEGGEPVGDIVVRSCSGLKPLRI
AROA_AGRSC       S---DVTILNVLMNPTRTGLILTLQEMGADIEVINPRLAGGEDVADLRVR-SSTLKGVTV
AROA_PSES2       S---DVTIRNVLMNPTRTGLILTLQEMGADIEVLNARLAGGEDVADLRVR-ASKLKGVVV
AROA_DICNO       A---EVVIRNVGINPTRAAIITLLQKMGGRIELHHQRFWGAEPVADIVVY-HSKLRGITV
AROA_LACLM       S---GLILENVGINETRTGILEVIQAMGGQLEILEQDE--VAKAATLKVK-ASQLKGTEI
AROA_STRPN       S---RLVLQNVGINETRTGIIDVIRAMGGKLEITEIDP--VAKSATLIVE-SSDLKGTEI
AROA_BACSU       S---RIVLKNVGLNPTRTGIIDVLQNMGAKLEIKPSADSGAEPYGDLIIE-TSSLKAVEI
AROA_SYNY3       S---ELLVENVGINPTRTGVLEVLAQMGADITPENERLVTGEPVADLRVR-ASHLQGCTF
AROA_STAA8       S---DVTIHNVGINPTRSGIIDIVEKMGGNIQLFNQTT-GAEPTASIRIQYTPMLQPITI
AROA_AQUAE       G---EIRLKEVLLNPTRDGFYRKLIEMGGDISFENYRELSNEPMADLVVRPVDNLKPVKV
AROA_THEMA       A---RITVTDVGLNPTRTGLLEVMKLMGANLEWEITEENL-EPIGTVRVETSPNLKGVVV
                                                                             

AROA_AERPE       DLDG----SPDLAPVAAVLAAYAR--GVSRLRGLERLKYKESDRLSAIAWNLARLGVEAR
AROA_PYRAB       DCSN----FPDLFPILAVLASYAE--GKSVITG-RQLRLKESDRVKAVAVNLRKAGIKVK
AROA_METJA       DVKD----IPDLVPTIAVLGCFAE--GKTEIYNGEHVRLKECDRLRACAVELKKMGADIE
AROA_METTH       NLHD----APDLLPTVAVLGALAT--GRTEIGGVEHARYKETDRISTCAAELRRLGVDVT
AROA_ARCFU       DASD----IPDLVPTIAVLAAVAK--GKTRIYNAEHLRIKEIDRIEGIHQNLKALGVESK
AROA_CLOPE       DASQ----CPDIIPVLTVVAALSK--GETRIINGERLRIKECDRLNAICTELNKLGADIK
AROA_CLOAB       DASQ----CPDLVPILSVVAALSE--GTTKIVNAARLRIKESDRLKAMATELNKLGAEVV
AROA_SACS2       DIDD----APDLAMTIAGLSAIAE--GTSEIIGIERLRIKESDRIESIRKILGLYGVGSE
AROA_SULTO       NVDD----YPDLAPSIASLAPFSS--SPTIIKGIKRLKTKESNRVVTISETLSKFGVKVE
AROA_THEVO       DADM----NPDLCPPLSVIGIFSK--YGVQIRNYERLKTKESNRYEGIIDLAERFGANVE
AROA_THEAC       DADH----NPDLCPPISVIGIFSE--HGVEIDNYARLKTKESNRYEGIIDMASRFGAIVE
AROA_PICTO       DVDK----NPDLAPPLSIIGIFSD--VAVHILNYRRLEIKESNREENIISMARSFGALIE
AROA_BORBR       DFNL----IPDAAMTAATLALYAD--GPCRLRNIGSWRVKETDRIHAMHTELEKLGAGVQ
AROA_BORPE       DFNL----IPDAAMTAATLALYAD--GPCRLRNIGSWRVKETDRIHAMHTELEKLGAGVQ
AROA_NEIMA       DANH----IPDAAMTLAIVALATG--QTCTLRNIGSWRVKETDRIAAMANELRKLGAKVA
AROA_BUCAI       DMNH----IPDAAMTVAILALFSK--GTTIIRNIYNWRVKETDRLSAMTIELRKIGAIVE
AROA_BUCAP       DMNH----IPDAAMTIAIVALFAK--GTSIIKNIYNWRVKETDRLSAMSKELKKVGAIIK
AROA_ECOLI       DMNH----IPDAAMTIATAALFAK--GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
AROA_SHISO       DMNH----IPDAAMTIATAALFAK--GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
AROA_SHIDY       DMNH----IPDAAMTIATAALFAK--GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
AROA_SALGL       DMNH----IPDAAMTIATTALFAK--GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
AROA_SALTY       DMNH----IPDAAMTIATTALFAK--GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
AROA_SALTI       DMNH----IPDAAMTIATTALFAK--GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
AROA_KLEPN       DMNH----IPDAAMTIATAALFAR--GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
AROA_YERE8       DMNH----IPDAAMTIATTALFAD--GPTVIRNIYNWRVKETDRLSAMATELRKVGAEVE
AROA_YERPE       DMNH----IPDAAMTIATTALFAT--GPTTIRNIYNWRVKETDRLTAMATELRKVGAEVE
AROA_EDWI9       DMNA----IPDAAMTIATTALFAK--GPTTLRNIYNWRVKETDRLAAMASELRKVGAVVE
AROA_HISSO       DMNH----IPDAAMTIAITALFAQ--GETVIRNIYNWRVKETDRLTAIATELRKLGAEVE
AROA_MANHA       DMNH----IPDAAMTIATTALFAE--GETVIRNIYNWRVKETDRLTAMATELRKVGAEVE
AROA_HAEIN       DMNH----IPDAAMTIATTALFAN--SETVIRNIYNWRVKETDRLTAMATELRKVGAEVE
AROA_PASMU       DMNH----IPDAAMTIATTALFAE--GETVIRNIYNWRVKETDRLTAMATELRKVGAEVE
AROA_NOSS1       DMND----MSDLVQTLGAIAPYAS--SPVIIRNVEHIRYKETERIRAVVTELRRLGVKVE
AROA2_BACHD      SMNE----MSDQALTLAAIAPFAD--GPITITDVEHIRYHESDRIAVICEALTRLGIQVD
AROA_MYCLE       DLRD----VGELTPSVAALAALATPGSVSQLHGIAHLRGHETDRLAALSTEINRLGGDCQ
AROA_MYCTU       DLRA----VGELTPSVAALAALASPGSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCR
AROA_COREF       DMSD----IGELTPTVAALAALAT--TESRLTGIAHLRGHETNRLEALTAEINRLGGNCT
AROA_CORGL       DMSD----IGELTPTVAALAALAS--TESRLTGIAHLRGHETDRLAALTAEINKLGGKCT
AROA_BURPS       DGSL----APDAVPALAGRAAFAE--GTSTFYNIEHIRYKESDRISDFRRELDKLGVRSE
AROA_DEIRA       DGDS----FTDAVQALTAAAAFAE--GDTTWENVATLRLKECDRISDTRAELERLGLRAR
AROA_CHLPN       DMDG----CIDALPILTVLCCFAD--SPSHLYNARSAKDKESDRILAITEELQKMGACIQ
AROA_CHLTR       DMDP----FIDALPILAVLCCFAK--NPSRLYNALGAKDKESNRIEAIAHELQKMGGSVH
AROA_HELPY       DQN--IASLIDEIPALSIAMLFAK--GKSMVKNAKDLRAKESDRIKAVVSNFKALGIECE
AROA_HELPJ       DQN--IASLIDEIPALSIAMLFAK--GKSMVRNAKDLRAKESDRIKAVVSNFKALGIECE
AROA_CAMJE       KDN--IAWLIDEAPALAIAFALAK--GKSSLINAKELRVKESDRIAVMVENLKLCGVEAR
AROA_LEPIC       PESL-IPSIIDEIPILSVAGFFAE--GGFEIRHAEELRAKESDRIHTMVSNFRELGIEVE
AROA_CHLTE       SDHGVVAGVIDEVPMLAVLSAFAS--GEFELHNAAELRTKESDRIDALVVNLQRLGFECE
AROA_AGRSC       PEDR-APSMIDEYPILAVAAAFAE--GATVMNGLEELRVKESDRLSAVANGLKLNGVDCD
AROA_PSES2       PPER-APSMIDEYPVLAIAASFAE--GETVMDGLDELRVKESDRLAAVARGLEANGVDCT
AROA_DICNO       APEW-IANAIDELPIFFIAAACAE--GTTFVGNLSELRVKESDRLAAMAQNLQTLGVACD
AROA_LACLM       SGDL-IPRLIDELPIIALLATQAE--GKTIIRDAAELKVKETDRIAVVADALNSMGANIE
AROA_STRPN       GGAL-IPRLIDELPIIALLATQAQ--GVTVIKDAEELKVKETDRIQVVADALNSMGADIT
AROA_BACSU       GGDI-IPRLIDEIPIIALLATQAE--GTTVIKDAAELKVKETNRIDTVVSELRKLGAEIE
AROA_SYNY3       GGEI-IPRLIDEIPILAVAAAFAE--GTTRIEDAAELRVKESDRLAAIASELGKMGAKVT
AROA_STAA8       EGEL-VPKAIDELPVIALLCTQAV--GTSTIKDAEELKVKETNRIDTTADMLNLLGFELQ
AROA_AQUAE       SPEE-VPTLIDEIPILAVLMAFAD--GVSEVKGAKELRYKESDRIKAIVTNLRKLGVQVE
AROA_THEMA       PEHL-VPLMIDELPLVALLGVFAE--GETVVRNAEELRKKESDRIRVLVENFKRLGVEIE
                           :           :              . :* :*           *    

AROA_AERPE       VRGGILEIRGG---GVEGG---------VARSWGDHRIAMAMAVAGLGARRPVAVE-GFS
AROA_PYRAB       ELPNGLEIVGG---KPRGF---------TVESFNDHRIVMAMAILGLGAEGKTIIK-DPH
AROA_METJA       EKPDGLIIRGV--KKLKGA---------KLNTYHDHRLVMAFTIAGLKAEGETIIE-GEE
AROA_METTH       ELPDGMIIEG----GASGG---------TVWSHGDHRLAMAFTLIGLR-EGITIRD-AE-
AROA_ARCFU       PLKDGLIIKGG--KGEFRG---------VVDSFGDHRMALAFSLLGLL--GEVKCR-NAE
AROA_CLOPE       ELKDGLIING--VKDLIGG---------EVYSHKDHRIAMSLAIASTRCKKEVIIK-EPD
AROA_CLOAB       ELEDGLLIEG--KEKLKGG---------EVESWNDHRIAMALGIAALRCEESVTIN-GSE
AROA_SACS2       VKYNSILIFGINKGMLNSP---------VTDCLNDHRVAMMSSALALVNGG--VIT-SAE
AROA_SULTO       YDEDKIVIY---PSEVKAG---------HVICPNDHRIAMLASVLSFKSGG--TIE-KAE
AROA_THEVO       DNGQDLFIK---PGSVRFP---------DVISYKDHRMIMAASIASLIGGFPTVIE-NAE
AROA_THEAC       DNGKDLFIK---RGDLKDP---------GTLSYTDHRMIMSAAVAAAASGFEVEIE-NET
AROA_PICTO       KNDNEMVIR---RGKISLP---------ERISFSDHRMIMSSIIAGLISSGDILYE-NIE
AROA_BORBR       SGADWLEVAPPAPGGWRDA---------HIGTWDDHRMAMCFSLAAFG-PAAVRIL-DPG
AROA_BORPE       SGADWLEVAPPEPGGWRDA---------HIGTWDDHRMAMCFSLAAFG-PAAVRIL-DPG
AROA_NEIMA       EEAEAIHITPPETP-TPDA---------VIDTYDDHRMAMCFSLVSLL-DVPVVIN-DPK
AROA_BUCAI       EGRDFLSISPPI--FFQYS---------SIETYNDHRMAMCFSLISLS-GVGVNIL-NPN
AROA_BUCAP       EGRDCLSITPPN--FFKFA---------EIDTYNDHRMAMCFSLICLS-GISVRIL-NPN
AROA_ECOLI       EGHDYIRITPPE--KLNFA---------EIATYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_SHISO       EGHDYIRITPPE--KLNFA---------EIATYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_SHIDY       EGHDYIRITPPE--KLNFA---------EIATYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_SALGL       EGHDYIRITPPA--KLQHA---------DIGTYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_SALTY       EGHDYIRITPPA--KLQHA---------DIGTYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_SALTI       EGHDYIRITPPA--KLQHA---------DIGTYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_KLEPN       EGEDYIRITPPL--TLQFA---------EIGTYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_YERE8       EGQDYIRVVPPA--QLIAA---------EIGTYNDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_YERPE       EGEDYIRVVPPL--QLTAA---------DIGTYDDHRMAMCFSLVALS-DTPVTIL-DPK
AROA_EDWI9       EGTDFLRIEPPA--QLQAA---------QIATYNDHRMAMCFSLVALS-GTPVTIC-DPG
AROA_HISSO       EGEDFIRIQPLALDKFKHA---------EIATYNDHRIAMCFSLIALS-DTSVTIL-DPA
AROA_MANHA       EGEDFIRIQPLALENFQHA---------EIETYNDHRMAMCFSLIALS-NTEVTIL-DPN
AROA_HAEIN       GGEDFIRIQPLPLNQFKHA---------NIETYNDHRMAMCFSLIALS-NTPVTIL-DPK
AROA_PASMU       EGEDFIRIQPLNLAQFQHA---------EIETYNDHRMAMCFALIALS-QTSVTIL-DPS
AROA_NOSS1       EFADGMKIEPTPI-TPA-----------AIETYHDHRMAMAFAVTGLK-TPGIVIQ-DPG
AROA2_BACHD      EFEDGLTVYPGTP-KPTLH---------PLSTYDDHRVAMSLSLIGTK-VKGLRLN-DPG
AROA_MYCLE       ETSDGLIITATP---LRPG---------VWRAYADHRMAMAGAIVGLR-VSGVEVD-DIG
AROA_MYCTU       ETPDGLVITATP---LRPG---------IWRAYADHRMAMAGAIIGLR-VAGVEVD-DIA
AROA_COREF       ELDDGLHITPAP---LHGG---------VWHSYADHRMATAGAIIGLV-IKDVGVE-DIQ
AROA_CORGL       ELKDGLLIEPAS---LHGG---------VWHSYADHRMATAGAIIGLA-VDGVQVE-DIK
AROA_BURPS       EKLDQLIIHGNPRSYRGGA---------VVDGHYDHGLIMALTTIGLHCEHPVLIK-EPH
AROA_DEIRA       ETADSLSVTGSAH-LAGGI---------TADGHGDHRMIMLLTLLGLRADAPLRIT-GAH
AROA_CHLPN       PTHDGLLVNPSP---LYGA---------VLDSHDDHRIAMALTIAALYAS-GDSRIHNTA
AROA_CHLTR       PTRDGLYIEPSR---LHGA---------VVDSHNDHRIAMALAVAGVHASSGQTLLCNTQ
AROA_HELPY       EFEDGFYVEGLEDIS-PLKQRFSRIKPPLIKSFNDHRIAMSFAVLTL-ALPLE--IDNLE
AROA_HELPJ       EFEDGFYIEGLGDAS-QLKQHFSKIKPPIIKSFNDHRIAMSFAVLTL-ALPLE--IDNLE
AROA_CAMJE       ELDDGFEIEGGCELK-SSK----------IKSYGDHRIAMSFAILGL-LCGIE--IDDSD
AROA_LEPIC       EYTDGYSFDGTSKKSSEVWTRLSTVKKIPIQSYMDHRIAMSFLIFKT-LSGLDLQIDETS
AROA_CHLTE       QYADGFVVKGRKTVA---------SEEVEIECFDDHRIAMSFTIAAE-AAGASLRLSDRD
AROA_AGRSC       EGETSLVVRGRPDGKGLGNA-----SGAAVATHLDHRIAMSFLVMGLVSEN-PVTVDDAT
AROA_PSES2       EGEMSLTVRGRPDGKGLG--------GGTVATHLDHRIAMSFLVMGLAAEK-PVTVDDSN
AROA_DICNO       VGADFIHIYGRSDRQFLP---------ARVNSFGDHRIAMSLAVAGVRAAG-ELLIDDGA
AROA_LACLM       PTDDGMIIQGGTKLHAPEN---------AINTLGDHRIGMMVAIAALLVENGEIELERAE
AROA_STRPN       PTADGMIIKGKSALHGAR-----------VNTFGDHRIGMMTAIAALLVADGEVELDRAE
AROA_BACSU       PTADGMKVYGKQTLKGGA----------AVSSHGDHRIGMMLGIASCITEE-PIEIEHTD
AROA_SYNY3       EFDDGLEIQGGSPLQGAE-----------VDSLTDHRIAMALAIAALGSGG-QTIINRAE
AROA_STAA8       PTNDGLIIHPSEFKTNAT-----------VDSLTDHRIGMMLAVASLLSSE-PVKIKQFD
AROA_AQUAE       EFEDGFAIHGTKEIKGGV-----------IETFKDHRIAMAFAVLGLVVEE-EVIIDHPE
AROA_THEMA       EFKDGFKIVGKQSIKGGS-----------VDPEGDHRMAMLFSIAGLVSEE-GVDVKDHE
                        .                          ** :                      

AROA_AERPE       RVPDSYPGFLEDLARLGARVEAVKGGGV----------------
AROA_PYRAB       VVSKSYPSFFLDLRRVLNEG------------------------
AROA_METJA       AVKISFPNFVDVMKSLGANIEVK---------------------
AROA_METTH       VFSVSFPDFPERMMQIGCRMNLS---------------------
AROA_ARCFU       VVSVSFPGYFRVLESLGASVIRL---------------------
AROA_CLOPE       CVKKSYPGFWEDFKSLGGILREE---------------------
AROA_CLOAB       CVSKSYPQFWSDLKQLGGDVHEWSLGE-----------------
AROA_SACS2       CVGKSNPNYWQDLLSLNAKISIE---------------------
AROA_SULTO       CVNKSNPNFWKDLISLNGRIIIR---------------------
AROA_THEVO       KTAKSFPGFFAELSKFANVEELA---------------------
AROA_THEAC       KVSKSFPGFFKELSKFANVSESN---------------------
AROA_PICTO       NINKSYPGFLNDLSNLGYYILK----------------------
AROA_BORBR       CVSKTFPDYFDVYAGLLAARD-----------------------
AROA_BORPE       CVSKTFPDYFDVYAGLLAARD-----------------------
AROA_NEIMA       CTHKTFPTYFDVFSSLTETAE-----------------------
AROA_BUCAI       CISKTFPSYFKDFLSISKI-------------------------
AROA_BUCAP       CISKTFPSYFENFLKISRFD------------------------
AROA_ECOLI       CTAKTFPDYFEQLARISQAA------------------------
AROA_SHISO       CTAKTFPDYFEQLARISQAA------------------------
AROA_SHIDY       CTAKTFPDYFEQLARISQAA------------------------
AROA_SALGL       CTAKTFPDYFEQLARMSTPA------------------------
AROA_SALTY       CTAKTFPDYFEQLARMSTPA------------------------
AROA_SALTI       CTAKTFPDYFEQLARMSTPA------------------------
AROA_KLEPN       CTAKTFPDYFGQLARISTLA------------------------
AROA_YERE8       CTAKTFPDYFEQLARLSQIA------------------------
AROA_YERPE       CTAKTFPDYFEQFARLSQLA------------------------
AROA_EDWI9       CTAKTFPDYFRQFSALCHPR------------------------
AROA_HISSO       CTAKTFPTYFSEFEKISKNQ------------------------
AROA_MANHA       CTAKTFPTYFRELEKLSVR-------------------------
AROA_HAEIN       CTAKTFPTFFNEFEKICLKN------------------------
AROA_PASMU       CTAKTFPTFFDTFLRLTHAES-----------------------
AROA_NOSS1       CTAKTFPDYFTRFFKMID--------------------------
AROA2_BACHD      CVAKTCPSYFQLLEQLGIQVHYQ---------------------
AROA_MYCLE       ATHKTLPQFPQLWANML-----------------KRSTG-----
AROA_MYCTU       ATTKTLPEFPRLWAEMVGPGQGWGYPQPRSGQRARRATGQGSGG
AROA_COREF       TTSKTFPGFETLWEEMVG--------------------------
AROA_CORGL       TTSKTFPGFENVWEEMVG--------------------------
AROA_BURPS       HVGQTYPDYFADIGSIGANVDGLIYPNVAAARA-----------
AROA_DEIRA       HIRKSYPQFFAHLEALGARFEYAEATA-----------------
AROA_CHLPN       CVRKTFPNFVQTLNIMEARIEECHDNYSMWSTHKRKVFARESFG
AROA_CHLTR       CINKSFPYFVIAAQTLHANVRHYQADFPLRSSFCR---------
AROA_HELPY       CANISFPQFKHLLNQFKKGSLNGN--------------------
AROA_HELPJ       CANISFPTFQLWLNLFKKRSLNGN--------------------
AROA_CAMJE       CIKTSFPNFIEILSNLGARIDY----------------------
AROA_LEPIC       WIETSFPGFEKLLESCINE-------------------------
AROA_CHLTE       VAGVSFPNFFALIDSLRQ--------------------------
AROA_AGRSC       MIATSFPEFMDLMAGLGAKIELSDTKAA----------------
AROA_PSES2       MIATSFPEFMDMMPGLGAKIELSIL-------------------
AROA_DICNO       VAAVSMPQFRDFAAAIGMNVGEKDAKNCHD--------------
AROA_LACLM       AIQTSYPSFFDDLEKLSGNL------------------------
AROA_STRPN       AINTSYPSFFDDLESLIHG-------------------------
AROA_BACSU       AIHVSYPTFFEHLNKLSKKS------------------------
AROA_SYNY3       AAAISYPEFFGTLGQVAQG-------------------------
AROA_STAA8       AVNVSFPGFLPKLKLLENEG------------------------
AROA_AQUAE       CVTVSYPEFWEDILKVVEF-------------------------
AROA_THEMA       CVAVSFPNFYELLERVVIS-------------------------
                     : * :