CLUSTAL format seed alignment for MF_00211

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRPD_STAS1       ---------------------------MELQAQLKQYKPLNQQQMNEFIELLIADDISNE
TRPD_STAES       ---------------------------MTLLEKIKQNKSLSKKDMQSFIVTLFDSNIETN
TRPD_STAAC       ---------------------------MTLLTRIKTETILLESDIKELIDILISPSIGTD
TRPD_STAAS       ---------------------------MTLLTRIKTETILLESDIKELIDILISPSIGTD
TRPD_LACLA       --------------------------MKNELEKVMSGRDMTENEMNMLANSIIQGELSEV
TRPD_SYNY3       ------------------MNTTASSPWPPFLQQLLDRQSLTRQQAVQLMEGWLDDDIPPA
TRPGD_THEMA      ----------------------------<ALKKLVEFEDLTFEESRQVMNFIMSGNATDA
TRPD_HALVD       --------------------------MQDYIERVTGGADLTVEEARDAARAVF-EDATEA
TRPD_METJA       -------------------------MITEALKKVIEFKDLDEKEAEAVMKDIMSGNAKPT
TRPD_PSEAE       ------------------------MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGQCTDA
TRPD_PSEPU       ------------------------MDIKSALSRIVGQLDLTTEEMRDVMRQIMTGQCTEA
TRPD_ACIAD       ------------------------MNIQQALNHITKNIHLTQAQMEDVMRSIMQGEATEA
TRPD_AQUAE       -----------------------MELVRELLRKIAEFENLTAEEMYNLMKEVAEGRATDA
TRPD_METTH       ------------------------MKFRRMISEIMDFRNLSEDEAYSLMEMIMAGELDDI
TRPD_METTM       ------------------------MRFEGIMNDIMDFRNLSEDEAHDLMEMIMDGEMGDV
TRPD_BACPU       --------------------------MNHRLSALVNGGFLSENEANKLMHDMMSGFLTDA
TRPD_BACSU       --------------------------MNRFLQLCVDGKTLTAGEAETLMNMMMAAEMTPS
TRPD_GEOSE       -------------------------MLKRLLSKCAEGETLTEAEAYEAMNAVMSGEATDS
TRPD_AZOBR       -------------MSTPSAPHGDLTDMKAILAKVAAGNALNEAEASLAFDIIMSGNATPS
TRPD_BRADU       -----------------------MDDLKSIIGKVATGASLSRDEAASAFDAMMSGEATPS
TRPD_RHOS4       -----------------------MSDRLKPLIGTAATRPLSREEAEFAFECLFEGEATPA
TRPD_MYCLE       MVLSSQPPS-------SRSATGSVLSWPQVLGRLTAGQDLTRGQAAWAMGQVMTGNARPA
TRPD_MYCTU       MALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPA
TRPD1_STRCO      --MSAVTPA--------GGDTTADRSWPALLNGLLDGRDLSADDTAWALDVIMRGEATDV
TRPD2_STRCO      -----------------------------------MQRPLTEAEAADAMRVIMRGEATAA
TRPD_LACCA       -------------------------MIKQAIEKVVNHENLTFEETEAVLDEIMNGEASEV
TRPD_CORGL       ---------------------MTSPATLKVLNAYLDNPTPTLEEAIEVFTPLTVGEYDDV
TRPD_AERPE       ------------------MVNSFEKSRFLLVKKLLEGEPLTPGEAAQLAQAMLDPSFDNS
TRPD_BUCDN       --------------------------MQNILNKIYQSQHLNKEESYRLFKSISSGSITDI
TRPD_BUCAI       --------------------------MRNILLKIYDSKFLNQEESYQLFTLISSGKITDI
TRPD_BUCAP       --------------------------MQNIFNKIYESKSLNQEESYQLFKSIALGKINEI
TRPD_BUCSC       --------------------------MNTILNQIYLGHSLTESETYKLFKLIMTGKINDI
TRPGD_ECOLI      ---------------------------<PILEKLYQAQTLSQQESHQLFSAVVRGELKPE
TRPGD_SALTY      ---------------------------<PILEKLYQAQTLTQQESHQLFSAVVRGELKPE
TRPD_VIBPA       --------------------------MEAIINKLYEQQSLTQEESQQLFDIIIRGELDPI
TRPD_HAEIN       ------------------------MQHNQLLEQLYSGHSLSTSESTALFNAVIQGELSNE
TRPD_HELPY       --------------------------MKEILNALYHQKDLNDEEVKKLFTLIIHEKVSPV
TRPD_HELPJ       --------------------------MKDILNALYHQKDLNDEEVKKLFTLIIDEKVSPA
TRPD_THEVO       ---------------------------MMGIEDIVLGLNVDRESAKRLYEIISKEDCSDV
TRPD_THEAC       -----------------------------MYESFLTGKPMDRATAMDLMQYMASPECSDA
TRPD_PICTO       -----------------------------MLNLDFIYENRNMSESEAELCMINIIDAPDT
TRPCD_ARCFU      ----------------------------<MIEDVLRG--LDFDKAYELAKTLP--ELDEI
TRPD_THEKO       ---------------------------MSLLAKIVDGKNLSFEEAYELFNELK--GSDGV
TRPD_SACS2       ------------------------MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEI
                                                                             

TRPD_STAS1       IKANLLSSFSEKEITQEELTYISKSLIHSMYRQQ--PYYPN---SMCVCGTGGDKSNSFN
TRPD_STAES       VKVELLKAYTNKDMGQYELTYLVEYFIQTNYPNQ--PFYNK---AMCVCGTGGDQSNSFN
TRPD_STAAC       IKYELLSSYSEREIQQQELTYIVRSLINTMYPHQ--PCYEG---AMCVCGTGGDKSNSFN
TRPD_STAAS       IKYELLSSYSEREIQQQELTYIVRSLINTMYPHQ--PCYEG---AMCVCGTGGDKSNSFN
TRPD_LACLA       QIASFLVALKMKGEAASELTGLARALQKAAIPIP--TNLTN---AMDNCGTGGDRSFSFN
TRPD_SYNY3       LSGAILAAIQAKGLDPEELTGMAQVLQEQSQGNQGREMVAP---LVDTCGTGGDGSSTFN
TRPGD_THEMA      QIAGFLVALRMKEETGDELGGMASVMREKSIHIK--APSPR---TVDTCGTGGDGFGTFN
TRPD_HALVD       QIGALLAALRAKGETEAEIAGFAQGMRDAALTIEPDRG-----PLVDTCGTGGDDYNTIN
TRPD_METJA       QIAAILTALRMKGETIEEITAFAKIMREFSLKINPN-----VPKLLDTCGTGGDNLNTFN
TRPD_PSEAE       QIGAFLMGMRMKSETIDEIVGAVAVMRELADGVQLPTL----KHVVDVVGTGGDGANIFN
TRPD_PSEPU       QIGAFLMGMRMKSESIDEIVGAVSVMRELADKVELKSL----DGVVDIVGTGGDGANIFN
TRPD_ACIAD       QIGALMMGLRMKGESIDEITAAARVMRELAIKIDVSDI----QYLVDIVGTGGDGQNLFN
TRPD_AQUAE       QIGALVMGTKMKGETPEEIEGAVKLFREKVVRVPVKDP----EELVDVVGTGGDKSSTFN
TRPD_METTH       KIAAILTALAMKGETVDEITGFARAMRDRSPRVRVSGS----HEVVDSCGTGGDSFRSYN
TRPD_METTM       QIAALLTALAMKGETVDEITGFARAMRERAVKVKIPES----MRVVDACGTGGDRFKSYN
TRPD_BACPU       EVAASLSILAHRGETAEEMTGFVKAMRQNAAPMERAL------DVVDTCGTGGDGLSTFN
TRPD_BACSU       EMGGILSILAHRGETPEELAGFVKAMRAHALTVDGLP------DIVDTCGTGGDGISTFN
TRPD_GEOSE       QIASLVSILRVRGETVDEIAGFVRAMRDRMTTIDAGD------DVIDTCGTGGDGAATFN
TRPD_AZOBR       QMGGFLMALRVRGETVDEITGAARVMRAKAIPVEAPD------GTIDTCGTGGDGSGTYN
TRPD_BRADU       QMGGLLMALRVRGETVDEITGAVAAMRSKMLTVTAPP------DAVDIVGTGGDGSGSVN
TRPD_RHOS4       QMGGLLMALRTRGETVDEYAAAASVMRAKCHKVRAPH------GAIDIVGTGGDGKGTLN
TRPD_MYCLE       QIAAFAVAMKMKVPTAAEVSELADVMLSHARKLPTEAICQDIGETVDIAGTGGDGANTVN
TRPD_MYCTU       QIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDD---AVDVVGTGGDGVNTVN
TRPD1_STRCO      QIAGFAVGLRFKGETVEEISGLVRTMYEHANVIEVPG------KTVDIVGTGGDGAKTVN
TRPD2_STRCO      QIAAFALAVTVRGASADNLAGMARAAQEFATPVPRAG-----GDLLDTCGTGGDGLNTFN
TRPD_LACCA       QTASLLTALTAKNPTIDEIAGAAASMRSHALAFPETK------DVLEIVGTGGDHANTFN
TRPD_CORGL       HIAALLATIRTRGEQFADIAGAAKAFLAAARPFPITG-----AGLLDSAGTGGDGANTIN
TRPD_AERPE       LKAAALAALRVRGEQPGEVVGFARALRDRAVRVEYGG-----EVLLDTAGTGGDGLSTLN
TRPD_BUCDN       TLSSILTAMKIRGESKEEIIGAILAFSECVKYFPKPN-----YVFLDIVGTGGDIKNTIN
TRPD_BUCAI       KLASILTAMKIRGESIEEITGAIKAFLDKMKYFPKPD-----YIFSDIVGTGGDAKNTIN
TRPD_BUCAP       QLSSILTAMQMHGESEKEILGAIYAFSERMKFFPRPN-----YIFSDIVGTGGDSKNTIN
TRPD_BUCSC       QLSSILTAINIRGESENEIIGAVRACLKYSKSFPKQN-----YMFSDIVGTGGDSSNSIN
TRPGD_ECOLI      QLAAALVSMKIRGEHPNEIAGAATALLENAAPFPRPD-----YLFADIVGTGGDGSNSIN
TRPGD_SALTY      QLAAALVSMKIRGEHPNEIAGAATALLENAAPFPRPE-----YLFADIVGTGGDGSNSIN
TRPD_VIBPA       LMASALTALKIKGETPDEIAGAAKALLANANPFPRPD-----YDFADIVGTGGDGHNTIN
TRPD_HAEIN       QIAAMLIALKVRGANTEEISGAVAASLQNAKAFPYPN-----YPFADIVGTGGNGQNTIN
TRPD_HELPY       QLGAILCALKIKGESFKEISVAATTLLEHAPKPFNSG-----LDLIDNCGTGGDGLKTIN
TRPD_HELPJ       QLGAVLCALKIKGESFKEISVAATTLLEHAPKPFNSG-----LDLIDNCGTGGDGLKTIN
TRPD_THEVO       CRAAVLTAFHFKGVTREEFMGFLDAIYKPTVSV----------DATDIVGTGGDKKNTIN
TRPD_THEAC       FRAAVLSVLRVRGVTEDEMMGFYEAMHAPNDVT----------DATDIVGTGGDMAHTIN
TRPD_PICTO       VKAAFLTALYVKGITPDELSGFSRALRKLSSISINID------KLTDIVGTGGDHKNTIN
TRPCD_ARCFU      KIAAVLAALEAKGYGAEVIAGFAKGVAEKS-KIEIG-------KVMDTCGTGGDKTSSIN
TRPD_THEKO       LIGAYLAALQTKGYTGEELAGLARAMRDSAVKLDLG-------KVADTAGTGGDGSSTIN
TRPD_SACS2       LVSAILVALRMKGESKNEIVGFARAMRELAIKIDVP-------NAIDTAGTGGDGLGTVN
                            :                                     ****:     *

TRPD_STAS1       ISTTVSFVIASANIPVIKHGNKSVTSSSGSTDLLEAMGINTS-SVEATPSQLNQVGLAFL
TRPD_STAES       ISTTVAFVVASAGVPVIKHGNKSITSHSGSTDVLHEMNIKTN-KMNEVEQQLNLKGLAFI
TRPD_STAAC       ISTTVAFVVASAGVKVIKHGNKSITSNSGSTDLLNQMNIQTT-TVDDTPNQLNEKDLVFI
TRPD_STAAS       ISTTVAFVVASAGVKVIKHGNKSITSNSGSTDLLNQMNIQTT-TVDDTPNQLNEKDLVFI
TRPD_LACLA       ISTTAAFVLAAGGVNMAKHGNRSITSKSGSADVLEALGINLYLPAEKLAQVFDKVGLVFL
TRPD_SYNY3       ISTAVAFVVAAAGVKVAKHGNRSASSKVGSADVLEALGLNLQAGADQVAAAVSAVGITFL
TRPGD_THEMA      ISTTTAFVVAAAGIPVAKHGNRSVSSKVGSADVLEAGGYKLEKTPEEMERELKETGFSFL
TRPD_HALVD       VSTTSALVAAGAGAAVAKHGNYSVSSSSGSADVLEVAGVNVEAEPESVEACIEDNGVGFM
TRPD_METJA       I-STATAFVVSAYVPVAKHGNKAVSSKSGSADVLEALGVNLNVPIERVKESIEKIGIGFL
TRPD_PSEAE       VSSAASFVVAAAGGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGFM
TRPD_PSEPU       VSTASSFVLAAAGCTVAKHGNRAVSGKSGSADLLEAAGIYLNLTPTQVARCIDSLGIGFM
TRPD_ACIAD       VSTASSFVIAAAGATIAKHGNRGVSSKSGSSDLLEQAGINLDLDMQQTERCIREMGVGFL
TRPD_AQUAE       VSTVTGFVLAGAGVKVAKHGNRSVSSKSGSADFLEALGAKVELLPEKVARLIEEVGFGFM
TRPD_METTH       ISTAAAMIAAAAGVRVAKHGNRAVTGSCGGADILEAAGVNIELDAAAAARSLSDVGISFM
TRPD_METTM       VSTAAAIIAAAAGVKVAKHGNRAVTGSCGGADILEAAGVNIELGPEAACRSLETLGIAFM
TRPD_BACPU       ISTAAAIVRSAAGAKIAKHGNRSVSSKSGSADVLECLGIHIQSTPEETRRQIQEKNMGFL
TRPD_BACSU       ISTASAIVASAAGAKIAKHGNRSVSSKSGSADVLEELEVSIQTTPEKVKSSIETNNMGFL
TRPD_GEOSE       VSTAAAIVVSSLGVKVAKHGNRAVSSKSGSADVLERLGIDIPASPEAAKQALETKGLAFL
TRPD_AZOBR       ISTAAAVVIAACGVPVAKHGNRAMSSKSGAADVLGALGVNLDCDLGLVRKALWDARIGFL
TRPD_BRADU       VSTCASFIVSGAGVPVAKHGNRALSSRSGAADVLASLGVRIDLRPEQVGRCVRECGIGFM
TRPD_RHOS4       ISTATAFVVAGAGVPVAKHGNRNLSSKSGAADALTEMGLNVMIGPEQVEACLLEAGIGFM
TRPD_MYCLE       LSTMAAIVVAAAGVPVVKHGNRASSSLSGGADTLEALGVRIDLGPEQVANSLAEIGIGFC
TRPD_MYCTU       LSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFC
TRPD1_STRCO      ISTMSAIVLAGTGAKVVKHGNRAASSASGASDVLEKLGVNLELTPQRVAEVAEEAGITFC
TRPD2_STRCO      ISTAAAIVAAACGVRVAKHGNRSASSACGSADVLEELGVRIDLGAEEAAACLDRTGITFL
TRPD_LACCA       ISTTSAIVVAATGTRVAKHGNRAASSKSGAADVLEALGLDINETPAVSYESLQENNLAFL
TRPD_CORGL       ITTGASLIAASGGVKLVKHGNRSVSSKSGSADVLEALNIPLGLDVDRAVKWFEASNFTFL
TRPD_AERPE       ASTAAALVAASLGVPTAKHGNRSFSSKSGSADVMEMLGYNINHRADRAVRMLSTLGFTFL
TRPD_BUCDN       ISTASAFVAASCGLKIVKHCNQGVSSTSGSADLLKRFHINLHASSKEHRKTLDKLNICFL
TRPD_BUCAI       ISTMSAFVAATCGLKIIKHCNQRISSKSGSSDILEKFNINLNASPEKSRKTLDQLNICFL
TRPD_BUCAP       VSTSSAFVAASCGFKIIKHCNKGVSSKSGSSDLLNKFKINLNTSLENSKKILDKLNICFL
TRPD_BUCSC       ISTASAFVGATCGLKIVKHCNTSISSMTGSCDLLKEFNIDLHASCEKSQNMLNKLNICFL
TRPGD_ECOLI      ISTASAFVAAACGLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFL
TRPGD_SALTY      ISTASAFVAAACGLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFL
TRPD_VIBPA       ISTTAAFVAAACGLKVAKHGNRSVSSKSGSSDLLDSFGINLAMSAEDTRKAVDDIGVAFL
TRPD_HAEIN       ISTTSAIVAASMGAKIAKHGNRSVSSKSGASDVLTALSVNVNVTPEQARQALDEIGVCFL
TRPD_HELPY       ISTIAALIASSMGLSMAKHGSRSVSSHSGSADLLENLGVNIEMNPTQLENCFKQTHFGFL
TRPD_HELPJ       ISTIAALIASSMGLSMAKHGSRSVSSHSGSADLLENLGVNIEMNPMQLENCFKQSHFGFL
TRPD_THEVO       VSTASAIVAASLGIPVAKFGNRSSTGAYGSADFMADAGYSFPRDVEAALHRLKSNNFVFM
TRPD_THEAC       VSTASAIVAASMGLKIAKFGNRSASGNHGAADFMSETGYAFPKSTGEALRRLSRTNFVFL
TRPD_PICTO       VSTAASILL-SLRIKIAKHGNFGITGSHGSADFMKFIGYKFEMTEYDIIKNLNEKNYVYI
TRPCD_ARCFU      VSTAVAIAL-STVHPVAKHGNRAVSSKSGSADVLEALGVRIEMDEERARKMIAETNFAFL
TRPD_THEKO       VSTASALIL-SAFTRVAKHGNVSITSKSGSANVLEALGLNIRVSPERAREMVESTNFTFI
TRPD_SACS2       VSTASAILL-SLVNPVAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFL
                  .:              *. .   :.  *. : :                        : 

TRPD_STAS1       SATDTYPIMKSIQPIRKMMTNPTIFNITGPIINPFKLDYQVMGVYETSKLEKIAQTLKDL
TRPD_STAES       SATDSYPMMKKLQSIRKSIATPTIFNLIGPLINPFKLTYQVMGVYEASQLENIAQTLKDL
TRPD_STAAC       GATESYPIMKYMQPVRKMIGKPTILNLVGPLINPYHLTYQMVGVFDPTKLKLVAKTIKDL
TRPD_STAAS       GATESYPIMKYMQPVRKMIGKPTILNLVGPLINPYHLTYQMVGVFDPTKLKLVAKTIKDL
TRPD_LACLA       FAQNLHPAMKYFTPVRRQLEIPTIMNLTGPLINPIPLDTQLLGTSRPDLLELTANVLKGL
TRPD_SYNY3       FAPGWHPALKSVAPIRKTLKVRTVFNLLGPLVNPLRPTGQVIGVYSPDFLSVMAIALKNL
TRPGD_THEMA      FAPLLHPAMKHVMPARRQLKIRTAFNLLGPITNPARVKYQVVGVFDLSFASKLATALQRL
TRPD_HALVD       LAPVFHPAMKAVIGPRKELGMRTVFNVLGPLTNPAGADAQVLGVYDADLVPVIAESLSHM
TRPD_METJA       FAPHFHPAMKFATPVRKELGIRTVFNVLGPLTNPANANYQLMGVYDEKLTEKLANVLKNL
TRPD_PSEAE       FAQVHHKAMKYAAGPRRELGLRTLFNMLGPLTNPAGVRHQVVGVFTQELCKPLAEVLKRL
TRPD_PSEPU       FAQSHHSAMKHAAGPRRDLGLRTLFNMLGPLTNPAGVKHQVVGVFAQTLCRPLAEVLQRL
TRPD_ACIAD       FAPNHHKAMKYAVGPRRELGIRSIFNLLGPLTNPAGVKRFVIGVFSDELCRPIAEVMKQL
TRPD_AQUAE       FAPLFHPAMKRVVSPRREVGVRSIFNLIGPLTNPAGVKRYLLGVFSKEYVDKFAKALKNL
TRPD_METTH       FAPLFHRATARVAAVRRSLGFKTVFNILGPLTSPAAAGIQLLGVFDPQLVGPVAEVLRNL
TRPD_METTM       FAPLFHRATARVAPVRRELGFKTVFNILGPLTSPASAEVQLLGVFDPYLVGPVAEVLRNL
TRPD_BACPU       FAPLYHSSMKQVAAVRKQLGFRTVFNLLGPLCHPMQAKKQIIGVYSKEKAKLMAEALAPL
TRPD_BACSU       FAPLYHSSMKHVAGTRKELGFRTVFNLLGPLSNPLQAKRQVIGVYSVEKAGLMASALETF
TRPD_GEOSE       FAPLYHAAMKYAAGPRKEIGFRTIFNLIGPLANPARCKRQVIGVYSTRYAEKLAETMRRL
TRPD_AZOBR       MAPRHHLAMRNVGPTRV--GTRTIFNLLGPLSNPASAKRQLLGVYAKQWVEPLAHVLKRL
TRPD_BRADU       FAPAHHPAMKNVGPTRVELATRTIFNLLGPLSNPAGVKRQMVGVFSRQWVQPLAQVLKNL
TRPD_RHOS4       MAPMHHPAMRHVGPVRAELGTRTIFNILGPLTNPAGVKRQLTGAFSPDLIRPMAEVLSAL
TRPD_MYCLE       FAPLFQPSYRYASAVRHEIGVPTVFNILGPLTNPAWPRAGLIGCAFGNLAEVMAGVFAAR
TRPD_MYCTU       FAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR
TRPD1_STRCO      FAVKFHPALRHVATARGQLGIRTVFNFLGPLTNPARVKAQAVGVAHARMAPIVAGVFAER
TRPD2_STRCO      FAPVFHPAFRHTAGPRRELGARTVFNLLGPLCNPSGARLRTLGVPSRELVEPMTEVLERL
TRPD_LACCA       FAQEYHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTHQLLGVYDETLLEPLANVLKKL
TRPD_CORGL       FAPAYNPAIAHVQPVRQALKFPTIFNTLGPLLSPARPERQIMGVANANHGQLIAEVFREL
TRPD_AERPE       YAPNYHPAMKAVVPVRRKLATRTIFNLVGPLANPAFNNVQVIGVARRSLMPVIASAASLL
TRPD_BUCDN       FAPKYHDSFKYSNNVRKILKTRTIFNLLGPFLNPAIPPLALIGVYKKDLLYSSIEILKSL
TRPD_BUCAI       FAPKYHDGFKYSNNVRTDLKTKTIFNFLGPFLNPATPPLSVIGVYNKNLINIAVNILKNL
TRPD_BUCAP       FAPKYHSVFKYASKTRSILKIKTIFNLLGPFLNPSRPPLTLIGVYKKDLVNPMSRILKKL
TRPD_BUCSC       FAPKYHANFKYISLVRKTLKIRTLFNILGPLINPSKPPLSLVGVYSTKLMVPMANVLKKL
TRPGD_ECOLI      FAPKYHTGFRHAMPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVL
TRPGD_SALTY      FAPKYHTGLRHAMPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVL
TRPD_VIBPA       FAPQYHGGVRHAMPVRQTMKTRTIFNILGPLINPARPNIELMGVYSEELVRPIAETMLQM
TRPD_HAEIN       FAQQYHSGFRHVAPVRAALKTRTIFNILGPLINPARPTYHLLGVYAPELVKTYAETAVAL
TRPD_HELPY       FAPLYHQSFKKSAPLRKELFTKTIFNCLGPLINPLRPKIQLLGVYDKSLCKTMALALKAL
TRPD_HELPJ       FAPLYHQSFKKSAPLRKELFTKTIFNCLGPLINPLRPKIQLLGVYDKSLCKTMALALKAL
TRPD_THEVO       LAPTFIPEFKIFSTVRKRLGFPTLFNYLGPVLNPLAPKKRVIGSASTEMMDVYSYILNEL
TRPD_THEAC       YAPDFLKEFALFAGVRKMLGFPTVLNFLGPILNPLSPIRRVIGTSDPSFMELYAGIARRS
TRPD_PICTO       LAPVYNKTFAKFSNVRKKLGIKTVFNILGPLTNPLNPENLVIGAYDDETAETYASVMLKQ
TRPCD_ARCFU      FAPLYHKSFARVAAVRRNLGIRTIFNVTGPLTNPARPEVQIVGVASEILLVEVAKAMSLL
TRPD_THEKO       FAPAYHPALRPIMPVRKALGIKTVFNVIGPLANPADPAYQVVGVNSPELLEPVAEALEFL
TRPD_SACS2       FAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYEL
                  *             *      : :*  **.  *        *                 

TRPD_STAS1       GRKKAIVVYGANG-----MDEATLSGDNMIYEVNENEATKNYTVNPKDVGLAYAPNEALI
TRPD_STAES       GRKRAILIHGANG-----MDEATLSGENIIYEVSSERALKKYSLKAEEVGLAYANNDTLI
TRPD_STAAC       GRKRAIVLHGANG-----MDEATLSGDNLIYELTEDGEIKNYTLNATDYGLKHAPNSDFK
TRPD_STAAS       GRKRAIVLHGANG-----MDEATLSGDNLIYELTEDGEIKNYTLNATDYGLKHAPNSDFK
TRPD_LACLA       GRKRALVITGEGG-----MDEATPFGLNH-YALLENDKVTLHEFRASEVGISEVQLNDIR
TRPD_SYNY3       GTARAMVLHGREQ-----LDEAGLGAPTDIASFNQ-GEVTPQVLDPQNFGLAPAPLTALK
TRPGD_THEMA      GTERSAVVNG--G-----FTDELTTCGKNNLLLVTQEEIVPMVLDPEELGLKSGDPEELK
TRPD_HALVD       PVERALVVHG-SG-----MDEIALHDATTVAEIDG-DEITEYTLTPADLGLERAPIEAVA
TRPD_METJA       GLKGALVVHGSGM------DEITTIGKTKISELRN-GEIKSYYIEPEDFGIKKAKLEDIR
TRPD_PSEAE       GSEHVLVVHSRDG-----LDEFSLAAATHIAELKD-GEVREYEVRPEDFGIKSQTLMGLE
TRPD_PSEPU       GSKHVLVVHSKDG-----LDEFSLAAPTFVAELKN-GEITEYWVEPEDLGMKSQSLHGLA
TRPD_ACIAD       GAEHVMVVHSKDG-----LDEISLASQTYIAELKN-GEVTEWVLNPEDVNIPSQTLSGLI
TRPD_AQUAE       GVKKAFVVHGEGG-----IDEVSVEGETYVTEVSE-EGIRSFTFSPEELGVKRKSLSEVR
TRPD_METTH       GTRCAMVVHGFDANLNPALDEISTVGPTLVAFLED-DEIRIDRLMPPDFGVEVGELEHLR
TRPD_METTM       GVKRAMVVHGFDGNMNPAMDEISTVGPTLVGFLED-DEIGIKRLMPPDFGVDVGQLQHLK
TRPD_BACPU       EPEHVLFVCGEDG-----LDELTITANSYVIELKK-DVMTEYTLNPEDFGLQKGYLSEIQ
TRPD_BACSU       QPKHVMFVSSRDG-----LDELSITAPTDVIELKD-GERREYTVSPEDFGFTNGRLEDLQ
TRPD_GEOSE       GSEHVVFVTGRDG-----LDECSIAAETDVVELKD-GDIRRFVLTPESVGLRXGGLADVQ
TRPD_AZOBR       GSEAAWIVHGSDG-----LDEITTTGPTTVAQLKD-GEVTVFEIEPEQAGIFRARPELLK
TRPD_BRADU       GSESAWVVHGSDG-----LDEITLTGPTFVSSLHN-GEIRNFEVTPEEAGLPRCEPGALK
TRPD_RHOS4       GSEKAWLVHGGDG-----TDELAISAASKVAALEG-GQIREFELHPEEAGLPVHPFEEIV
TRPD_MYCLE       R-SSVLVVHGDDG-----LDELTTTTTSTIWRVQA-GTVDKLTFDPVEFGFARAHLDDLL
TRPD_MYCTU       R-SSVLVVHGDDG-----LDELTTTTTSTIWRVAA-GSVDKLTFDPAGFGFARAQLDQLA
TRPD1_STRCO      G-HSSLVFRGDDG-----LDELTTTSTSRVWVVRD-GRVTEETFDPRDVGIELVPVEALR
TRPD2_STRCO      GVTRALVFHSADG-----MDELSTAAPAHLVELRD-GRRTTHRFDPAEHGLARSRPGDLA
TRPD_LACCA       GVTNAMVVHGRDG-----LDEMTTADETAVVELQD-DHLTKYTVTPEQFGLKRSQRADLV
TRPD_CORGL       GRTRALVVHG-AG-----TDEIAVHGTTLVWELKEDGTIEHYTIEPEDLGLGRYTLEDLV
TRPD_AERPE       GYDAVLVVHGDPG-----MDEVSVTGETKILEVRR-GRIEEYSITPEDLGLPITGLKELR
TRPD_BUCDN       KYQRAIVLHG-DG-----TDEVTLHNTTHVAELFN-GKIFSYELHPKDFGLKIHDKKIFT
TRPD_BUCAI       QYKRAIVLHS-DN-----TDEVTLYGTTYVSELLN-KKIISYQLQPESFGLKMHPKKILK
TRPD_BUCAP       KYQRGIILHG-DD-----TDEVTLHGTTYISELLN-NKIYSYELEPEDFGIKRHSKSIFV
TRPD_BUCSC       NSYHAIVVHS-DH-----TDEVTLHDSTNVTELKN-NNIISYTLCPDDFGVKYYNKNAIL
TRPGD_ECOLI      GYQRAAVVHS-GG-----MDEVSLHAPTIVAELHD-GEIKSYQLTAEDFGLTPYHQEQLA
TRPGD_SALTY      GYQRAAVVHS-GG-----MDEVSLHAPTIVAELHD-GEIKSYQLTAEDFGLTPYHQDQLA
TRPD_VIBPA       GMKRAAVVHG-SG-----LDEVAIHGTTTVAEIKD-GKITEYTLTPEDFGLESHPLEAIK
TRPD_HAEIN       EHQHSFVVHG-SG-----LDEVALHGETQVAEIKN-GKIEYFTLTPEDFGLKTQSLESLR
TRPD_HELPY       GVKRAMVVNG-GG-----TDEIVLHDITHACELKN-NGILEYDLSAKDFDLPPYDLKELQ
TRPD_HELPJ       GVKRAMVVNG-GG-----TDEIVLHDITHACELKN-NEILEYDLSAKDFDLPPYDLKELQ
TRPD_THEVO       G-YQAIIIRGQDG-----MDEITPFNFTDVIYVDG--SVEKYVVDGRSISNDVRYD-KIS
TRPD_THEAC       G-MRAIILHSADG-----MDEISPFAKARIMHVSD--LVSESYVDASSLTGPLERR-NIA
TRPD_PICTO       N-KRAFIVSST-------MDEISPEAESHVYYVNN--AIRKFDLDPLSITGKRINESNII
TRPCD_ARCFU      G-RRAVVVYG-SG-----MDEVNPNSSTDIAVVNG--GVERLKLEPEDFGIERCRV--LP
TRPD_THEKO       GVERALVVHG-SG-----MDEVSPHRETLVLEVGN--GVERYTLSPEDFGIEPVKP--LP
TRPD_SACS2       DFNKIILVYGEPG-----IDEVSPIGNTFMKIVSK-RGIEEVKLNVTDFGISPIPIEKLI
                       .. .          :           .          .              . 

TRPD_STAS1       G-GTPLENLEITKNILTGVDRSAKR----DVVVFNAGIALYVAEKV-------SSIKQGV
TRPD_STAES       G-GSPQTNKQIALNILSGTDHSSKR----DVVLLNAGIALYVAEQV-------ESIKHGV
TRPD_STAAC       G-GSPEENLAISLNILNGKDQSSRR----DVVLLNAGLSLYVAEKV-------DTIAEGI
TRPD_STAAS       G-GSPEENLAISLNILNGKDQSSRR----DVVLLNAGLSLYVAEKV-------DTIAEGI
TRPD_LACLA       G-GEAPENAEILKNVLEN-QPSAFL----ETTVLNAGLGFYANGKV-------DSIKSGV
TRPD_SYNY3       G-GDLAENVTILSQVLQGKGTQAQI----DAVALNASLALQVGDAVP-----WGDHGQGI
TRPGD_THEMA      GPSDPKEAYRMMESVLKGEASRTQV----ETVALNAGVVFWLVGEC-------DTIKDGV
TRPD_HALVD       GGTP-QENADDLEGILTGDVTGPKR----DLILANAGAAIYVAG-------LADSLEGGV
TRPD_METJA       GGDA-EENAKIIGEIFEGEEVGAKR----DIVVLNAAFALYIAE-------EAKDVEEGI
TRPD_PSEAE       VDSP-QASLELIRDAL-GRRKTEAGQKAAELIVMNAGPALYAAD-------LATSLHEGI
TRPD_PSEPU       VENP-QASLELIRDAL-GRRKTENGQKAAEMIVLNAGAALYAAD-------HAMTLAQGV
TRPD_ACIAD       VEDS-NASLKLIKDAL-GRKKSDIGEKAANMIALNAGAGIYVSG-------LATSYKQGV
TRPD_AQUAE       VNSP-EES---VKVAL-SVLRGEEG-TPRDMVLLNASFGILVSE-------RAGDIKEAF
TRPD_METTH       AGSTTAENLELFMDVLRGREDTPEQKSRLDIALANAGALIYLAG-------LADTLPEGT
TRPD_METTM       AASTVDGNLRMFMDVLAGLDDTPGRKSRLDIALANAGALIYLAE-------MEDTLEGGT
TRPD_BACPU       VQSP-EESAKLIQNILNHQTEGAPL----HITALNAGAALYVAG-------KSESLMAGT
TRPD_BACSU       VQSP-KESAYLIQNIFENKSSSSAL----SITAFNAGAAIYTAG-------ITASLKEGT
TRPD_GEOSE       VRSS-EESAALLEAVMDGTAPASAI----DITALNAGVALYAAG-------KAETIAAGV
TRPD_AZOBR       GGDA-HVNAEAIRALFDG-AQGAYR----DIVLLNAAAALHVAG-------KAGDLKEGD
TRPD_BRADU       GGDA-DANAIALQSVLNG-KPSAYR----DVALMNAAAALVVAG-------RAKDLKEGV
TRPD_RHOS4       GGTP-AENAQAFRALLDG-APGAYR----DAVLLNAAAALVVAD-------RAAHLREGV
TRPD_MYCLE       GGDA-QTNAAKVRAVLAG-AKGPVR----DAVVLNAAGAIVAYAGLSSHAEWSPAWDDGL
TRPD_MYCTU       GGDA-QANAAAVRAVLGG-ARGPVR----DAVVLNAAGAIVAHAGLSSRAEWLPAWEEGL
TRPD1_STRCO      GADA-SYNADVARRLLAG-EKGPVR----DAVLLNSAAALEALE--PGEGALAERLRAGM
TRPD2_STRCO      GGDR-AVNAAVLRRVLAG-GRGPAR----DVVLLNAAAALRVAG-------VAGTWSDGL
TRPD_LACCA       GGTP-EANANITRRILAG-DHGPQR----DIVLLNAGAALHVAH-------PDLSIQAGI
TRPD_CORGL       GGLG-TENAEAMRATFAGTGPDAHR----DALAASAGAMFYLNGDV-------DSLKDGA
TRPD_AERPE       VANA-VESAERVRRALSGRGRRSDE----AFIAANAAAALYVAGFE-------KDLKGAA
TRPD_BUCDN       KTSL-EENYYIINQIMKGKGDKLNE----ELIAANVAILFKIFGY--------EDLKSNT
TRPD_BUCAI       INSL-EENYHIIKEIMKGKGSKLYE----ELIAVNVAMLLKVFGY--------ENLKENT
TRPD_BUCAP       EYSP-EENYHIIKKTMQGKGEKLHE----ELIAVNVALLLKIFGH--------ENLKENT
TRPD_BUCSC       GGTP-KENYEIIKYVLKGKGPHAIS----ETIAVNVALLLKLYGN--------ENLKKNT
TRPGD_ECOLI      GGTP-EENRDILTRLLQGKGDAAHE----AAVAANVAMLMRLHGH--------EDLQANA
TRPGD_SALTY      GGTP-EENRDILTRLLQGKGDAAHE----AAVAANVAMLMRLHGQ--------EDLKANA
TRPD_VIBPA       GGDP-EENKAIITNILTGKGTDAQL----GAVAVNVALLMRLFGH--------EDLKANT
TRPD_HAEIN       GGEP-QENAQYLTALLQGKGKAEHA----NAVAANTALLLKLFGY--------DDLKQNV
TRPD_HELPY       IENA-QESTQACLDILENKGKDSHT----MVVVANVASLLYLSHKA-------KDLKEGV
TRPD_HELPJ       IENA-KESVQACLDILENKGKDSHT----MVVAANVASLLYLSHRA-------KDLKEGV
TRPD_THEVO       SQDP-SLIRKFNFMGLKGEN-EDAAK----FIALNTAPVLILNKKA-------GNYEDAY
TRPD_THEAC       SADP-GAISGLTLSAIRGEN-EDGAR----FVALNTAPVLIINGLA-------SDFQEGY
TRPD_PICTO       EKDP-VKSFNIIIDAFKNKN-RDAAS----FIALNAAPALVLNGIS-------RDITSAY
TRPCD_ARCFU      CSSS-GESAERIRAVFSGKGLKEDRR----LIAINFATALFALGY--------EDLKENV
TRPD_THEKO       CSSP-EESAARIKAVLGGSGRREDRD----FILVNASAALYASGVA-------EDFREGL
TRPD_SACS2       VNSA-EDSAIKIVRAFLGKD-EHVAE----FIKINTAVALFALDRV-------GDFREGY
                                :                  . .  :                    

TRPD_STAS1       IEAQRLIDNGN-----------AIAQYNKMGGMTYDYIG-------
TRPD_STAES       ERAKYLIDTGM-----------AMKQYLKMGG--------------
TRPD_STAAC       ELATTLIDNGE-----------ALEKYHQMRGE-------------
TRPD_STAAS       ELATTLIDNGE-----------ALKKYHQMRGE-------------
TRPD_LACLA       DLAREVISTGA-----------ALTKLHELQAEQIG----------
TRPD_SYNY3       HLAKDILSQGA-----------GWDKLQQLVAFLGS----------
TRPGD_THEMA      GKALDLIRTGE-----------AYKKLREVMDYQKTLGNS------
TRPD_HALVD       EVARDAIDSGA-----------AKAKHDALREA-------------
TRPD_METJA       KLAEKSIDEGK-----------ALKKLEDLIEFYREG---------
TRPD_PSEAE       QLAHDALHTGL-----------AREKMDELVAFTAVYREENAQ---
TRPD_PSEPU       ELAHDVLHTGL-----------AWEKLQELGAFTAVFKVENEA---
TRPD_ACIAD       ALAHDIIYGGQ-----------ALEKMSILSEFTKALKEYANN---
TRPD_AQUAE       EMAKESIDSGK-----------ALEVLEKYVELSNKI---------
TRPD_METTH       ETAKRTVKSGA-----------ALELLEEFVSYTRNLQS-------
TRPD_METTM       EAARETVESGA-----------ALRLMEDFASFTQNL---------
TRPD_BACPU       LKAIETIKNGA-----------AKEQLARLKQKTREEEIYA-----
TRPD_BACSU       ELALETITSGG-----------AAAQLERLKQK--EEEIYA-----
TRPD_GEOSE       AMAKDAILVKT-----------AYEQLQRLRRK---EVVHGA----
TRPD_AZOBR       ERARHAIDSGA-----------ARAVLQHLVSITNSSITNEPVAAP
TRPD_BRADU       ALGAKSLDSGA-----------ANARLKHLIAVSNG----------
TRPD_RHOS4       EIATDSILSGA-----------AKAKVALLARLTNAA---------
TRPD_MYCLE       ARASAAIDSGA-----------AEQLLARWVRFSQQV---------
TRPD_MYCTU       RRASAAIDTGA-----------AEQLLARWVRFGRQI---------
TRPD1_STRCO      DRAAEAIDSGA-----------ARRVLERWVAVSHA----------
TRPD2_STRCO      RLAASAVDGGA-----------AAGLLDRWAHASWQRADLVEVPA-
TRPD_LACCA       DLAAKTIDDAK-----------PLKNSIRLLAFSDKRKDVVA----
TRPD_CORGL       QKALSLLADGT-----------TQAWLAKHEEIDYSEKESSND---
TRPD_AERPE       EAAVQAIREGR-----------PAALLEKAVKASLGM---------
TRPD_BUCDN       KLALNKIRSGD-----------VYKHIINVANMLKED---------
TRPD_BUCAI       KLALNKIRSGD-----------VYKHIRNVANMLKEDNHARHNT--
TRPD_BUCAP       KIALKKIRSGD-----------VYKHIMQVSNMLKED---------
TRPD_BUCSC       KCALKIIQSGK-----------VYEKIIALSKF-------------
TRPGD_ECOLI      QTVLEVLRSGS-----------AYDRVTALAARG------------
TRPGD_SALTY      QTVLDVLRNGT-----------AYDRVTALAARG------------
TRPD_VIBPA       QQAIEAMNSGK-----------AYQLVQQLAAHA------------
TRPD_HAEIN       QNVLAHLVSGK-----------AFETLQKLTTY-------------
TRPD_HELPY       SMTLEHLKTKA-----------PYAHLQKIIRLSHA----------
TRPD_HELPJ       SMTLEHLKTKA-----------PYAHLQKIIRLSHA----------
TRPD_THEVO       RLALEAIKSGQ-----------AYEKLEAIMHENKGLRHN------
TRPD_THEAC       EAALEHIMSGG-----------PAEFLKVIAGDR------------
TRPD_PICTO       DLCINDIESGA-----------AYERLRRISNED------------
TRPCD_ARCFU      EIFEEKVQSGE-----------LARKLEEIACKSTSM---------
TRPD_THEKO       EMAREALGQG------------MLEKLEEIACLSKS----------
TRPD_SACS2       EYADHLIEKSLDKLNEIISMNGDVTKLKTIVVKSSG----------
                       :