CLUSTAL format seed alignment for MF_00211

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRPD_PICTO        ---------------------------MLNLDFIYENRNMSESEAELCMINII--DAPDT
S0ASN7_FERAC      --------------------------MNNDINYAATGNEVLK--ARDTMMELV--DSPDS
TRPD_THEVO        ---------------------------MMGIEDIVLGLNVDRESAKRLYEIISKEDCSDV
TRPD_THEAC        -----------------------------MYESFLTGKPMDRATAMDLMQYMASPECSDA
S7U1M4_DESML      -----------------MTSEIELRQFGRQICRVAAGECLSREETREIYRQIILNEQPEL
G7WNC4_METH6      -------------------MKDSMEEFGSKLNRLIAGESLTRKEAKGMFSSVLSDEQTDA
R9T7Q5_METII      -------------------MDDKLRAFGKNIDLLINKNNLSREESREMFRQILMNEQPDL
A6L9K1_PARD8      --------------------------MKQILYRLFEHQYLGREEARNILQNIAEGRYNDS
A8Z5Y5_SULMW      --------------------------MKDILNYLFEHKTLSKEDAQNVLISLYQDKFNHN
K9U0J3_CHRTP      -----------------------------------MQTPRSREQARQVMEYLLSGEAEFN
TRPD_STAAC        ---------------------------MTLLTRIKTETILLESDIKELIDILISPSIGTD
TRPD_STAAS        ---------------------------MTLLTRIKTETILLESDIKELIDILISPSIGTD
TRPD_STAES        ---------------------------MTLLEKIKQNKSLSKKDMQSFIVTLFDSNIETN
TRPD_STAS1        ---------------------------MELQAQLKQYKPLNQQQMNEFIELLIADDISNE
TRPD_CORGL        ---------------------MTSPATLKVLNAYLDNPTPTLEEAIEVFTPLTVGEYDDV
TRPD_HELPY        --------------------------MKEILNALYHQKDLNDEEVKKLFTLIIHEKVSPV
TRPD_HELPJ        --------------------------MKDILNALYHQKDLNDEEVKKLFTLIIDEKVSPA
TRPD_BUCSC        --------------------------MNTILNQIYLGHSLTESETYKLFKLIMTGKINDI
TRPD_BUCAP        --------------------------MQNIFNKIYESKSLNQEESYQLFKSIALGKINEI
TRPD_BUCDN        --------------------------MQNILNKIYQSQHLNKEESYRLFKSISSGSITDI
TRPD_BUCAI        --------------------------MRNILLKIYDSKFLNQEESYQLFTLISSGKITDI
TRPD_HAEIN        ------------------------MQHNQLLEQLYSGHSLSTSESTALFNAVIQGELSNE
TRPGD_ECOLI       ---------------------------<PILEKLYQAQTLSQQESHQLFSAVVRGELKPE
TRPD_VIBPA        --------------------------MEAIINKLYEQQSLTQEESQQLFDIIIRGELDPI
TRPD_SYNY3        ------------------MNTTASSPWPPFLQQLLDRQSLTRQQAVQLMEGWLDDDIPPA
TRPD_LACLA        --------------------------MKNELEKVMSGRDMTENEMNMLANSIIQGELSEV
TRPD_ACIAD        ------------------------MNIQQALNHITKNIHLTQAQMEDVMRSIMQGEATEA
TRPD_PSEAE        ------------------------MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGQCTDA
TRPD_PSEPU        ------------------------MDIKSALSRIVGQLDLTTEEMRDVMRQIMTGQCTEA
TRPD_METTH        ------------------------MKFRRMISEIMDFRNLSEDEAYSLMEMIMAGELDDI
TRPD_METTM        ------------------------MRFEGIMNDIMDFRNLSEDEAHDLMEMIMDGEMGDV
TRPD_AQUAE        -----------------------MELVRELLRKIAEFENLTAEEMYNLMKEVAEGRATDA
TRPGD_THEMA       ----------------------------<ALKKLVEFEDLTFEESRQVMNFIMSGNATDA
TRPD_AERPE        ------------------MVNSFEKSRFLLVKKLLEGEPLTPGEAAQLAQAMLDPSFDNS
TRPD_GEOSE        -------------------------MLKRLLSKCAEGETLTEAEAYEAMNAVMSGEATDS
TRPD_BACPU        --------------------------MNHRLSALVNGGFLSENEANKLMHDMMSGFLTDA
TRPD_BACSU        --------------------------MNRFLQLCVDGKTLTAGEAETLMNMMMAAEMTPS
TRPCD_ARCFU       ----------------------------<MIEDVLRG--LDFDKAYELAKTL--PELDEI
TRPD_THEKO        ---------------------------MSLLAKIVDGKNLSFEEAYELFNEL--KGSDGV
TRPD2_STRCO       -----------------------------------MQRPLTEAEAADAMRVIMRGEATAA
TRPD1_STRCO       --MSAVTPAGGDTT--------ADRSWPALLNGLLDGRDLSADDTAWALDVIMRGEATDV
TRPD_MYCLE        -------MVLSSQPPSSRSATGSVLSWPQVLGRLTAGQDLTRGQAAWAMGQVMTGNARPA
TRPD_MYCTU        MALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPA
TRPD_SACS2        ------------------------MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEI
TRPD_HALVD        --------------------------MQDYIERVTGGADLTVEEARDAARAVFE-DATEA
TRPD_LACCA        -------------------------MIKQAIEKVVNHENLTFEETEAVLDEIMNGEASEV
TRPD_METJA        -------------------------MITEALKKVIEFKDLDEKEAEAVMKDIMSGNAKPT
TRPD_CERS4        -----------------------MSDRLKPLIGTAATRPLSREEAEFAFECLFEGEATPA
TRPD_AZOBR        -------------MSTPSAPHGDLTDMKAILAKVAAGNALNEAEASLAFDIIMSGNATPS
TRPD_BRADU        -----------------------MDDLKSIIGKVATGASLSRDEAASAFDAMMSGEATPS
                                                                              

TRPD_PICTO        VKAAFLTALYVKGITPDELSGFSRALRKLSSI----SINIDK---LTDIVGTGGDHKNTI
S0ASN7_FERAC      AKISFLTEIHNRGETPAEIAGFAMALRELSSL----NLNYPE---LTDVVGTGGDGKNTV
TRPD_THEVO        CRAAVLTAFHFKGVTREEFMGFLDAIYK--------PTVSVD---ATDIVGTGGDKKNTI
TRPD_THEAC        FRAAVLSVLRVRGVTEDEMMGFYEAMHA--------PNDVTD---ATDIVGTGGDMAHTI
S7U1M4_DESML      QQGAFLMAHIARGPTIEELSGAWDALDRYDTAKIEVSVDGP----IVDIVGTGSDAVKTV
G7WNC4_METH6      HQGAFLAAITAKGPSPEEIAGGWEAIYDLDTVKVD-PQVSGE---LFENCGTGMDGVDTF
R9T7Q5_METII      QQGAFLAAITAKGATPQEIAGGWEVIFDLDTVKVS-PKISVP---VVENCGTGMDSFKTF
A6L9K1_PARD8      QIASLITVFLMRSISVEELTGFREALLEMRVPV---DLSEYK---PIDIVGTGGDGKNTF
A8Z5Y5_SULMW      QIAAISAIYNMRFPTLEEIKGFSQALIELSIKL---NLKEYN---AIDIVGTGGDNKNTF
K9U0J3_CHRTP      EIVSFLQTRPVVDAQTQELLGYRDVLWDRRRRA---NFGHVD----LDIVGTGGVRRPRY
TRPD_STAAC        IKYELLSSYSEREIQQQELTYIVRSLINTMYPH---QPCYEG---AMCVCGTGGDKSNSF
TRPD_STAAS        IKYELLSSYSEREIQQQELTYIVRSLINTMYPH---QPCYEG---AMCVCGTGGDKSNSF
TRPD_STAES        VKVELLKAYTNKDMGQYELTYLVEYFIQTNYPN---QPFYNK---AMCVCGTGGDQSNSF
TRPD_STAS1        IKANLLSSFSEKEITQEELTYISKSLIHSMYRQ---QPYYPN---SMCVCGTGGDKSNSF
TRPD_CORGL        HIAALLATIRTRGEQFADIAGAAKAFLAAARPF---PITGAG---LLDSAGTGGDGANTI
TRPD_HELPY        QLGAILCALKIKGESFKEISVAATTLLEHA------PKPFNSGLDLIDNCGTGGDGLKTI
TRPD_HELPJ        QLGAVLCALKIKGESFKEISVAATTLLEHA------PKPFNSGLDLIDNCGTGGDGLKTI
TRPD_BUCSC        QLSSILTAINIRGESENEIIGAVRACLKYSKSF---PKQNYM---FSDIVGTGGDSSNSI
TRPD_BUCAP        QLSSILTAMQMHGESEKEILGAIYAFSERMKFF---PRPNYI---FSDIVGTGGDSKNTI
TRPD_BUCDN        TLSSILTAMKIRGESKEEIIGAILAFSECVKYF---PKPNYV---FLDIVGTGGDIKNTI
TRPD_BUCAI        KLASILTAMKIRGESIEEITGAIKAFLDKMKYF---PKPDYI---FSDIVGTGGDAKNTI
TRPD_HAEIN        QIAAMLIALKVRGANTEEISGAVAASLQNAKAF---PYPNYP---FADIVGTGGNGQNTI
TRPGD_ECOLI       QLAAALVSMKIRGEHPNEIAGAATALLENAAPF---PRPDYL---FADIVGTGGDGSNSI
TRPD_VIBPA        LMASALTALKIKGETPDEIAGAAKALLANANPF---PRPDYD---FADIVGTGGDGHNTI
TRPD_SYNY3        LSGAILAAIQAKGLDPEELTGMAQVLQEQSQGNQGREMVAP----LVDTCGTGGDGSSTF
TRPD_LACLA        QIASFLVALKMKGEAASELTGLARALQKAAIPI---PTNLTN---AMDNCGTGGDRSFSF
TRPD_ACIAD        QIGALMMGLRMKGESIDEITAAARVMRELAIKI---DVSDIQ--YLVDIVGTGGDGQNLF
TRPD_PSEAE        QIGAFLMGMRMKSETIDEIVGAVAVMRELADGV---QLPTLK--HVVDVVGTGGDGANIF
TRPD_PSEPU        QIGAFLMGMRMKSESIDEIVGAVSVMRELADKV---ELKSLD--GVVDIVGTGGDGANIF
TRPD_METTH        KIAAILTALAMKGETVDEITGFARAMRDRSPRV---RVSGSH--EVVDSCGTGGDSFRSY
TRPD_METTM        QIAALLTALAMKGETVDEITGFARAMRERAVKV---KIPESM--RVVDACGTGGDRFKSY
TRPD_AQUAE        QIGALVMGTKMKGETPEEIEGAVKLFREKVVRV---PVKDPE--ELVDVVGTGGDKSSTF
TRPGD_THEMA       QIAGFLVALRMKEETGDELGGMASVMREKSIHI---KAPSPR---TVDTCGTGGDGFGTF
TRPD_AERPE        LKAAALAALRVRGEQPGEVVGFARALRDRAVRV---EYGGEV---LLDTAGTGGDGLSTL
TRPD_GEOSE        QIASLVSILRVRGETVDEIAGFVRAMRDRMTTI---DAG-DD---VIDTCGTGGDGAATF
TRPD_BACPU        EVAASLSILAHRGETAEEMTGFVKAMRQNAAPM---ERA-LD---VVDTCGTGGDGLSTF
TRPD_BACSU        EMGGILSILAHRGETPEELAGFVKAMRAHALTV---DGL-PD---IVDTCGTGGDGISTF
TRPCD_ARCFU       KIAAVLAALEAKGYGAEVIAGFAKGVAEKS------KIEIGK---VMDTCGTGGDKTSSI
TRPD_THEKO        LIGAYLAALQTKGYTGEELAGLARAMRDSAVKL---DL--GK---VADTAGTGGDGSSTI
TRPD2_STRCO       QIAAFALAVTVRGASADNLAGMARAAQEFATPV---PRAGGD---LLDTCGTGGDGLNTF
TRPD1_STRCO       QIAGFAVGLRFKGETVEEISGLVRTMYEHANVI---EVP-GK---TVDIVGTGGDGAKTV
TRPD_MYCLE        QIAAFAVAMKMKVPTAAEVSELADVMLSHARKLPT-EAICQDIGETVDIAGTGGDGANTV
TRPD_MYCTU        QIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVP-DD---AVDVVGTGGDGVNTV
TRPD_SACS2        LVSAILVALRMKGESKNEIVGFARAMRELAIKI---DVP--N---AIDTAGTGGDGLGTV
TRPD_HALVD        QIGALLAALRAKGETEAEIAGFAQGMRDAALTI---EPDRGP---LVDTCGTGGDDYNTI
TRPD_LACCA        QTASLLTALTAKNPTIDEIAGAAASMRSHALAF---PET-KD---VLEIVGTGGDHANTF
TRPD_METJA        QIAAILTALRMKGETIEEITAFAKIMREFSLKI---NPNVPK---LLDTCGTGGDNLNTF
TRPD_CERS4        QMGGLLMALRTRGETVDEYAAAASVMRAKCHKV---RAPHG----AIDIVGTGGDGKGTL
TRPD_AZOBR        QMGGFLMALRVRGETVDEITGAARVMRAKAIPV---EAP-DG---TIDTCGTGGDGSGTY
TRPD_BRADU        QMGGLLMALRVRGETVDEITGAVAAMRSKMLTV---TAP-PD---AVDIVGTGGDGSGSV
                                                                    ***       

TRPD_PICTO        NVSTAASILL-SLRIKIAKHGNFGITGSHGSADFMKFIGYKFEMTEYDIIKNLNEKNYVY
S0ASN7_FERAC      NVSTGVSILLASMGIKTAKHGNFGVTGHHGSADFMKYMNYNFKMDKNTIIENISRKNYVY
TRPD_THEVO        NVSTASAIVAASLGIPVAKFGNRSSTGAYGSADFMADAGYSFPRDVEAALHRLKSNNFVF
TRPD_THEAC        NVSTASAIVAASMGLKIAKFGNRSASGNHGAADFMSETGYAFPKSTGEALRRLSRTNFVF
S7U1M4_DESML      NCSTPAAVIAAGCGLAVAKKGARLVTGVSGASDILEILGIDLNTPLMKAQQCLERHGICY
G7WNC4_METH6      NISTAASIVAAAAGVPMAKHGARAITSRCGTIDILEALGVEVEAGPLLVKRSIERAGIGI
R9T7Q5_METII      NISTAASIIAAADGVPMAKHGARAITSKCGTIDLLESIGIDVECDASIVKKSIEDANIGM
A6L9K1_PARD8      NISTCSCFVVAGAGYNVVKHGNYGATSVSGASNVMEQHGVKFTNDIDKLRTSMDTCHIAY
A8Z5Y5_SULMW      NISTLSCFIVASLGEKVIKHGSYSSSSVTGSSNLFEILQYKFTSKEEKLKKQLEKVGICY
K9U0J3_CHRTP      NVSTTAAFIVAALGIRVAKHGNRGSVKPNGSCDLLEVLGISLTAMTARAVESLATTGLSF
TRPD_STAAC        NISTTVAFVVASAGVKVIKHGNKSITSNSGSTDLLNQMNIQ-TTTVDDTPNQLNEKDLVF
TRPD_STAAS        NISTTVAFVVASAGVKVIKHGNKSITSNSGSTDLLNQMNIQ-TTTVDDTPNQLNEKDLVF
TRPD_STAES        NISTTVAFVVASAGVPVIKHGNKSITSHSGSTDVLHEMNIK-TNKMNEVEQQLNLKGLAF
TRPD_STAS1        NISTTVSFVIASANIPVIKHGNKSVTSSSGSTDLLEAMGIN-TSSVEATPSQLNQVGLAF
TRPD_CORGL        NITTGASLIAASGGVKLVKHGNRSVSSKSGSADVLEALNIPLGLDVDRAVKWFEASNFTF
TRPD_HELPY        NISTIAALIASSMGLSMAKHGSRSVSSHSGSADLLENLGVNIEMNPTQLENCFKQTHFGF
TRPD_HELPJ        NISTIAALIASSMGLSMAKHGSRSVSSHSGSADLLENLGVNIEMNPMQLENCFKQSHFGF
TRPD_BUCSC        NISTASAFVGATCGLKIVKHCNTSISSMTGSCDLLKEFNIDLHASCEKSQNMLNKLNICF
TRPD_BUCAP        NVSTSSAFVAASCGFKIIKHCNKGVSSKSGSSDLLNKFKINLNTSLENSKKILDKLNICF
TRPD_BUCDN        NISTASAFVAASCGLKIVKHCNQGVSSTSGSADLLKRFHINLHASSKEHRKTLDKLNICF
TRPD_BUCAI        NISTMSAFVAATCGLKIIKHCNQRISSKSGSSDILEKFNINLNASPEKSRKTLDQLNICF
TRPD_HAEIN        NISTTSAIVAASMGAKIAKHGNRSVSSKSGASDVLTALSVNVNVTPEQARQALDEIGVCF
TRPGD_ECOLI       NISTASAFVAAACGLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCF
TRPD_VIBPA        NISTTAAFVAAACGLKVAKHGNRSVSSKSGSSDLLDSFGINLAMSAEDTRKAVDDIGVAF
TRPD_SYNY3        NISTAVAFVVAAAGVKVAKHGNRSASSKVGSADVLEALGLNLQAGADQVAAAVSAVGITF
TRPD_LACLA        NISTTAAFVLAAGGVNMAKHGNRSITSKSGSADVLEALGINLYLPAEKLAQVFDKVGLVF
TRPD_ACIAD        NVSTASSFVIAAAGATIAKHGNRGVSSKSGSSDLLEQAGINLDLDMQQTERCIREMGVGF
TRPD_PSEAE        NVSSAASFVVAAAGGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGF
TRPD_PSEPU        NVSTASSFVLAAAGCTVAKHGNRAVSGKSGSADLLEAAGIYLNLTPTQVARCIDSLGIGF
TRPD_METTH        NISTAAAMIAAAAGVRVAKHGNRAVTGSCGGADILEAAGVNIELDAAAAARSLSDVGISF
TRPD_METTM        NVSTAAAIIAAAAGVKVAKHGNRAVTGSCGGADILEAAGVNIELGPEAACRSLETLGIAF
TRPD_AQUAE        NVSTVTGFVLAGAGVKVAKHGNRSVSSKSGSADFLEALGAKVELLPEKVARLIEEVGFGF
TRPGD_THEMA       NISTTTAFVVAAAGIPVAKHGNRSVSSKVGSADVLEAGGYKLEKTPEEMERELKETGFSF
TRPD_AERPE        NASTAAALVAASLGVPTAKHGNRSFSSKSGSADVMEMLGYNINHRADRAVRMLSTLGFTF
TRPD_GEOSE        NVSTAAAIVVSSLGVKVAKHGNRAVSSKSGSADVLERLGIDIPASPEAAKQALETKGLAF
TRPD_BACPU        NISTAAAIVRSAAGAKIAKHGNRSVSSKSGSADVLECLGIHIQSTPEETRRQIQEKNMGF
TRPD_BACSU        NISTASAIVASAAGAKIAKHGNRSVSSKSGSADVLEELEVSIQTTPEKVKSSIETNNMGF
TRPCD_ARCFU       NVSTAVAIALSTV-HPVAKHGNRAVSSKSGSADVLEALGVRIEMDEERARKMIAETNFAF
TRPD_THEKO        NVSTASALILSAF-TRVAKHGNVSITSKSGSANVLEALGLNIRVSPERAREMVESTNFTF
TRPD2_STRCO       NISTAAAIVAAACGVRVAKHGNRSASSACGSADVLEELGVRIDLGAEEAAACLDRTGITF
TRPD1_STRCO       NISTMSAIVLAGTGAKVVKHGNRAASSASGASDVLEKLGVNLELTPQRVAEVAEEAGITF
TRPD_MYCLE        NLSTMAAIVVAAAGVPVVKHGNRASSSLSGGADTLEALGVRIDLGPEQVANSLAEIGIGF
TRPD_MYCTU        NLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGF
TRPD_SACS2        NVSTASAILLSLVN-PVAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVF
TRPD_HALVD        NVSTTSALVAAGAGAAVAKHGNYSVSSSSGSADVLEVAGVNVEAEPESVEACIEDNGVGF
TRPD_LACCA        NISTTSAIVVAATGTRVAKHGNRAASSKSGAADVLEALGLDINETPAVSYESLQENNLAF
TRPD_METJA        NISTATAFVVSAY-VPVAKHGNKAVSSKSGSADVLEALGVNLNVPIERVKESIEKIGIGF
TRPD_CERS4        NISTATAFVVAGAGVPVAKHGNRNLSSKSGAADALTEMGLNVMIGPEQVEACLLEAGIGF
TRPD_AZOBR        NISTAAAVVIAACGVPVAKHGNRAMSSKSGAADVLGALGVNLDCDLGLVRKALWDARIGF
TRPD_BRADU        NVSTCASFIVSGAGVPVAKHGNRALSSRSGAADVLASLGVRIDLRPEQVGRCVRECGIGF
                  * ::   .          *          *  : :                         

TRPD_PICTO        I--LAPVYNKTFAKFSNVRKKLGIKTVFNILGPLTNPLNPENLVI-GAYDDETAETYASV
S0ASN7_FERAC      I--LAPEYNKSFAKFSAARKQISFRTVFNILGPLTNPLNPARVVL-GTYSEDLAELYAKV
TRPD_THEVO        M--LAPTFIPEFKIFSTVRKRLGFPTLFNYLGPVLNPLAPKKRVI-GSASTEMMDVYSYI
TRPD_THEAC        L--YAPDFLKEFALFAGVRKMLGFPTVLNFLGPILNPLSPIRRVI-GTSDPSFMELYAGI
S7U1M4_DESML      L--SGEAFLKS--GWARLIRSMRFTSVFNIIGPLTRPCGQTRAIVIGAYSPAVCDQLIAV
G7WNC4_METH6      FNGMSPLVHPL--GLGRILSKIRFGTVLNIAGSLANPAMPRLGLR-GVYSKELVVPTAEA
R9T7Q5_METII      FNGMSSKVHPC--ALGRILSQIRFGTILNIAASLANPASPTIGVR-GVYNEKMIMPTLET
A6L9K1_PARD8      L--HAPLFNPALKAVAPVRKSLGVRSFFNMLGPLVNPIIPTYQLL-GVYNLPLLRLYNYT
A8Z5Y5_SULMW      L--HSHLFHPTLKKVTDVRKQLGIKTFFNMLGPLLNTSNTKNQLL-GVSDLELARLYYYL
K9U0J3_CHRTP      L--FARDWHPAFKAIAAARAEVGYPTVFNLLGPLLNPSQPKHQLV-GCGDPAVAQIIAET
TRPD_STAAC        I--GATESYPIMKYMQPVRKMIGKPTILNLVGPLINPYHLTYQMV-GVFDPTKLKLVAKT
TRPD_STAAS        I--GATESYPIMKYMQPVRKMIGKPTILNLVGPLINPYHLTYQMV-GVFDPTKLKLVAKT
TRPD_STAES        I--SATDSYPMMKKLQSIRKSIATPTIFNLIGPLINPFKLTYQVM-GVYEASQLENIAQT
TRPD_STAS1        L--SATDTYPIMKSIQPIRKMMTNPTIFNITGPIINPFKLDYQVM-GVYETSKLEKIAQT
TRPD_CORGL        L--FAPAYNPAIAHVQPVRQALKFPTIFNTLGPLLSPARPERQIM-GVANANHGQLIAEV
TRPD_HELPY        L--FAPLYHQSFKKSAPLRKELFTKTIFNCLGPLINPLRPKIQLL-GVYDKSLCKTMALA
TRPD_HELPJ        L--FAPLYHQSFKKSAPLRKELFTKTIFNCLGPLINPLRPKIQLL-GVYDKSLCKTMALA
TRPD_BUCSC        L--FAPKYHANFKYISLVRKTLKIRTLFNILGPLINPSKPPLSLV-GVYSTKLMVPMANV
TRPD_BUCAP        L--FAPKYHSVFKYASKTRSILKIKTIFNLLGPFLNPSRPPLTLI-GVYKKDLVNPMSRI
TRPD_BUCDN        L--FAPKYHDSFKYSNNVRKILKTRTIFNLLGPFLNPAIPPLALI-GVYKKDLLYSSIEI
TRPD_BUCAI        L--FAPKYHDGFKYSNNVRTDLKTKTIFNFLGPFLNPATPPLSVI-GVYNKNLINIAVNI
TRPD_HAEIN        L--FAQQYHSGFRHVAPVRAALKTRTIFNILGPLINPARPTYHLL-GVYAPELVKTYAET
TRPGD_ECOLI       L--FAPKYHTGFRHAMPVRQQLKTRTLFNVLGPLINPAHPPLALI-GVYSPELVLPIAET
TRPD_VIBPA        L--FAPQYHGGVRHAMPVRQTMKTRTIFNILGPLINPARPNIELM-GVYSEELVRPIAET
TRPD_SYNY3        L--FAPGWHPALKSVAPIRKTLKVRTVFNLLGPLVNPLRPTGQVI-GVYSPDFLSVMAIA
TRPD_LACLA        L--FAQNLHPAMKYFTPVRRQLEIPTIMNLTGPLINPIPLDTQLL-GTSRPDLLELTANV
TRPD_ACIAD        L--FAPNHHKAMKYAVGPRRELGIRSIFNLLGPLTNPAGVKRFVI-GVFSDELCRPIAEV
TRPD_PSEAE        M--FAQVHHKAMKYAAGPRRELGLRTLFNMLGPLTNPAGVRHQVV-GVFTQELCKPLAEV
TRPD_PSEPU        M--FAQSHHSAMKHAAGPRRDLGLRTLFNMLGPLTNPAGVKHQVV-GVFAQTLCRPLAEV
TRPD_METTH        M--FAPLFHRATARVAAVRRSLGFKTVFNILGPLTSPAAAGIQLL-GVFDPQLVGPVAEV
TRPD_METTM        M--FAPLFHRATARVAPVRRELGFKTVFNILGPLTSPASAEVQLL-GVFDPYLVGPVAEV
TRPD_AQUAE        M--FAPLFHPAMKRVVSPRREVGVRSIFNLIGPLTNPAGVKRYLL-GVFSKEYVDKFAKA
TRPGD_THEMA       L--FAPLLHPAMKHVMPARRQLKIRTAFNLLGPITNPARVKYQVV-GVFDLSFASKLATA
TRPD_AERPE        L--YAPNYHPAMKAVVPVRRKLATRTIFNLVGPLANPAFNNVQVI-GVARRSLMPVIASA
TRPD_GEOSE        L--FAPLYHAAMKYAAGPRKEIGFRTIFNLIGPLANPARCKRQVI-GVYSTRYAEKLAET
TRPD_BACPU        L--FAPLYHSSMKQVAAVRKQLGFRTVFNLLGPLCHPMQAKKQII-GVYSKEKAKLMAEA
TRPD_BACSU        L--FAPLYHSSMKHVAGTRKELGFRTVFNLLGPLSNPLQAKRQVI-GVYSVEKAGLMASA
TRPCD_ARCFU       L--FAPLYHKSFARVAAVRRNLGIRTIFNVTGPLTNPARPEVQIV-GVASEILLVEVAKA
TRPD_THEKO        I--FAPAYHPALRPIMPVRKALGIKTVFNVIGPLANPADPAYQVV-GVNSPELLEPVAEA
TRPD2_STRCO       L--FAPVFHPAFRHTAGPRRELGARTVFNLLGPLCNPSGARLRTL-GVPSRELVEPMTEV
TRPD1_STRCO       C--FAVKFHPALRHVATARGQLGIRTVFNFLGPLTNPARVKAQAV-GVAHARMAPIVAGV
TRPD_MYCLE        C--FAPLFQPSYRYASAVRHEIGVPTVFNILGPLTNPAWPRAGLI-GCAFGNLAEVMAGV
TRPD_MYCTU        C--FAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLI-GCAFADLAEVMAGV
TRPD_SACS2        L--FAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLM-GVFSKDHLDLLSKS
TRPD_HALVD        M--LAPVFHPAMKAVIGPRKELGMRTVFNVLGPLTNPAGADAQVL-GVYDADLVPVIAES
TRPD_LACCA        L--FAQEYHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTHQLL-GVYDETLLEPLANV
TRPD_METJA        L--FAPHFHPAMKFATPVRKELGIRTVFNVLGPLTNPANANYQLM-GVYDEKLTEKLANV
TRPD_CERS4        M--MAPMHHPAMRHVGPVRAELGTRTIFNILGPLTNPAGVKRQLT-GAFSPDLIRPMAEV
TRPD_AZOBR        L--MAPRHHLAMRNVGPTR--VGTRTIFNLLGPLSNPASAKRQLL-GVYAKQWVEPLAHV
TRPD_BRADU        M--FAPAHHPAMKNVGPTRVELATRTIFNLLGPLSNPAGVKRQMV-GVFSRQWVQPLAQV
                      .                :   : :*  ...  .         *             

TRPD_PICTO        MLKQN-KRAFIV----SST-----MDEISPEAESHVYYV--NNAIRKFDLDPLSITGKRI
S0ASN7_FERAC      IKEEK-KTGFIVHG--SDG-----MDEISPSSKSTLYRV--DGHLDKITIDPEKLIGHSI
TRPD_THEVO        LNELGYQ-AIIIRG--QDG-----MDEITPFNFTDVIYV--DGSVEKYVVDGRSIS-NDV
TRPD_THEAC        ARRSG-MRAIILHS--ADG-----MDEISPFAKARIMHV--SDLVSESYVDASSLT-GPL
S7U1M4_DESML      LREIGMQSALAPFGMAEGNSRERGMDEFSLSGATRVVELK-NGAVEVYEVTPEDFGLRQV
G7WNC4_METH6      MRMIGYSRAMVVCGLSADG--RRGMDEVSPSGRTLVAELRGDGRIATFDLLPRDFGADPV
R9T7Q5_METII      MKEIGFKKAMVFHGKNSNG--KCGMDEISTSGLTFVAEMKSDGTITEYTIDPSSLDIRCD
A6L9K1_PARD8      YQESG-TRFAVVHS--LDG-----YDEISLTADFKVAMPE-KEKLYT----PEMLGFKRC
A8Z5Y5_SULMW      YQDTD-KNYSIVHS--LDG-----YDEISLTSDLKCYDPQ-----GEHIFSPEYFGIKKI
K9U0J3_CHRTP      LMELGIE-ALVVTG--SDG-----LDEITLAGASQVIEVR-GDRISTKQIVPEDFGMETV
TRPD_STAAC        IKDLGRKRAIVLHG--ANG-----MDEATLSGDNLIYELTEDGEIKNYTLNATDYGLKHA
TRPD_STAAS        IKDLGRKRAIVLHG--ANG-----MDEATLSGDNLIYELTEDGEIKNYTLNATDYGLKHA
TRPD_STAES        LKDLGRKRAILIHG--ANG-----MDEATLSGENIIYEVSSERALKKYSLKAEEVGLAYA
TRPD_STAS1        LKDLGRKKAIVVYG--ANG-----MDEATLSGDNMIYEVNENEATKNYTVNPKDVGLAYA
TRPD_CORGL        FRELGRTRALVVHG---AG-----TDEIAVHGTTLVWELKEDGTIEHYTIEPEDLGLGRY
TRPD_HELPY        LKALGVKRAMVVNG---GG-----TDEIVLHDITHACELK-NNGILEYDLSAKDFDLPPY
TRPD_HELPJ        LKALGVKRAMVVNG---GG-----TDEIVLHDITHACELK-NNEILEYDLSAKDFDLPPY
TRPD_BUCSC        LKKLNSYHAIVVHS---DH-----TDEVTLHDSTNVTELK-NNNIISYTLCPDDFGVKYY
TRPD_BUCAP        LKKLKYQRGIILHG---DD-----TDEVTLHGTTYISELL-NNKIYSYELEPEDFGIKRH
TRPD_BUCDN        LKSLKYQRAIVLHG---DG-----TDEVTLHNTTHVAELF-NGKIFSYELHPKDFGLKIH
TRPD_BUCAI        LKNLQYKRAIVLHS---DN-----TDEVTLYGTTYVSELL-NKKIISYQLQPESFGLKMH
TRPD_HAEIN        AVALEHQHSFVVHG---SG-----LDEVALHGETQVAEIK-NGKIEYFTLTPEDFGLKTQ
TRPGD_ECOLI       LRVLGYQRAAVVHS---GG-----MDEVSLHAPTIVAELH-DGEIKSYQLTAEDFGLTPY
TRPD_VIBPA        MLQMGMKRAAVVHG---SG-----LDEVAIHGTTTVAEIK-DGKITEYTLTPEDFGLESH
TRPD_SYNY3        LKNLGTARAMVLHG--REQ-----LDEAGLGAPTDIASFN-QGEVTPQVLDPQNFGLAPA
TRPD_LACLA        LKGLGRKRALVITG--EGG-----MDEATPFGLNHYALLE-NDKVTLHEFRASEVGISEV
TRPD_ACIAD        MKQLGAEHVMVVHS--KDG-----LDEISLASQTYIAELK-NGEVTEWVLNPEDVNIPSQ
TRPD_PSEAE        LKRLGSEHVLVVHS--RDG-----LDEFSLAAATHIAELK-DGEVREYEVRPEDFGIKSQ
TRPD_PSEPU        LQRLGSKHVLVVHS--KDG-----LDEFSLAAPTFVAELK-NGEITEYWVEPEDLGMKSQ
TRPD_METTH        LRNLGTRCAMVVHG--FDANLNPALDEISTVGPTLVAFLE-DDEIRIDRLMPPDFGVEVG
TRPD_METTM        LRNLGVKRAMVVHG--FDGNMNPAMDEISTVGPTLVGFLE-DDEIGIKRLMPPDFGVDVG
TRPD_AQUAE        LKNLGVKKAFVVHG--EGG-----IDEVSVEGETYVTEVS-EEGIRSFTFSPEELGVKRK
TRPGD_THEMA       LQRLGTERSAVVNG---GF-----TDELTTCGKNNLLLVT-QEEIVPMVLDPEELGLKSG
TRPD_AERPE        ASLLGYDAVLVVHG--DPG-----MDEVSVTGETKILEVR-RGRIEEYSITPEDLGLPIT
TRPD_GEOSE        MRRLGSEHVVFVTG--RDG-----LDECSIAAETDVVELK-DGDIRRFVLTPESVGLRXG
TRPD_BACPU        LAPLEPEHVLFVCG--EDG-----LDELTITANSYVIELK-KDVMTEYTLNPEDFGLQKG
TRPD_BACSU        LETFQPKHVMFVSS--RDG-----LDELSITAPTDVIELK-DGERREYTVSPEDFGFTNG
TRPCD_ARCFU       MSLLG-RRAVVVYG---SG-----MDEVNPNSSTDIAVV--NGGVERLKLEPEDFGIERC
TRPD_THEKO        LEFLGVERALVVHG---SG-----MDEVSPHRETLVLEV--GNGVERYTLSPEDFGIE--
TRPD2_STRCO       LERLGVTRALVFHS--ADG-----MDELSTAAPAHLVELR-DGRRTTHRFDPAEHGLARS
TRPD1_STRCO       FAERG-HSSLVFRG--DDG-----LDELTTTSTSRVWVVR-DGRVTEETFDPRDVGIELV
TRPD_MYCLE        FAARR-SSVLVVHG--DDG-----LDELTTTTTSTIWRVQ-AGTVDKLTFDPVEFGFARA
TRPD_MYCTU        FAARR-SSVLVVHG--DDG-----LDELTTTTTSTIWRVA-AGSVDKLTFDPAGFGFARA
TRPD_SACS2        AYELDFNKIILVYG--EPG-----IDEVSPIGNTFMKIVS-KRGIEEVKLNVTDFGISPI
TRPD_HALVD        LSHMPVERALVVHG---SG-----MDEIALHDATTVAEID-GDEITEYTLTPADLGLERA
TRPD_LACCA        LKKLGVTNAMVVHG--RDG-----LDEMTTADETAVVELQ-DDHLTKYTVTPEQFGLKRS
TRPD_METJA        LKNLGLKGALVVHG---SG-----MDEITTIGKTKISELR-NGEIKSYYIEPEDFGIKKA
TRPD_CERS4        LSALGSEKAWLVHG--GDG-----TDELAISAASKVAALE-GGQIREFELHPEEAGLPVH
TRPD_AZOBR        LKRLGSEAAWIVHG--SDG-----LDEITTTGPTTVAQLK-DGEVTVFEIEPEQAGIFRA
TRPD_BRADU        LKNLGSESAWVVHG--SDG-----LDEITLTGPTFVSSLH-NGEIRNFEVTPEEAGLPRC
                                           **                                 

TRPD_PICTO        NESNIIE-KDPVKSFNIIIDAFKNKNRDAA-----SFIALNAAPALVL-NGISR------
S0ASN7_FERAC      NPEDIST-TDSIKSFEMLLNGLSGKNKDVM-----EFIAINALPAVIL-NQKAE------
TRPD_THEVO        RYDKISS-QDPSLIRKFNFMGLKGENEDAAK-----FIALNTAPVLIL-NKKAG------
TRPD_THEAC        ERRNIAS-ADPGAISGLTLSAIRGENEDGAR-----FVALNTAPVLII-NGLAS------
S7U1M4_DESML      PISAIASSRTAYENARRIQAVLQGAYDTPEA----DFFCMNAAAALYI-AGAAE------
G7WNC4_METH6      DERDLLPREDITEEATVLLRVLAGREGGPRE----AAICINSAPILLL-SGKAD------
R9T7Q5_METII      NENDILA-SERSNESIRFLRLLEGKESRDRE----DIVCLNAAAILYV-SDRVK------
A6L9K1_PARD8      TEADLDGGETPEEAARIFDAVLGNRATEAQK----SCVIANSAFAIQV-ICPEK------
A8Z5Y5_SULMW      NPLELKGGKNNIENTRIFLDIISGNGTVYQN----DVVSINASFALSL-LNEC-------
K9U0J3_CHRTP      PESELAG-GNATDNAAEFLAILSGQGRKALV----DLVTLNAAFALYL-VDKSY------
TRPD_STAAC        PNSDFKG-GSPEENLAISLNILNGKDQSSRR----DVVLLNAGLSLYV-AEKVD------
TRPD_STAAS        PNSDFKG-GSPEENLAISLNILNGKDQSSRR----DVVLLNAGLSLYV-AEKVD------
TRPD_STAES        NNDTLIG-GSPQTNKQIALNILSGTDHSSKR----DVVLLNAGIALYV-AEQVE------
TRPD_STAS1        PNEALIG-GTPLENLEITKNILTGVDRSAKR----DVVVFNAGIALYV-AEKVS------
TRPD_CORGL        TLEDLVG-GLGTENAEAMRATFAGTGPDAHR----DALAASAGAMFYL-NGDVD------
TRPD_HELPY        DLKELQI-ENAQESTQACLDILENKGKDSHT----MVVVANVASLLYL-SHKAK------
TRPD_HELPJ        DLKELQI-ENAKESVQACLDILENKGKDSHT----MVVAANVASLLYL-SHRAK------
TRPD_BUCSC        NKNAILG-GTPKENYEIIKYVLKGKGPHAIS----ETIAVNVALLLKL-YGNE-------
TRPD_BUCAP        SKSIFVE-YSPEENYHIIKKTMQGKGEKLHE----ELIAVNVALLLKI-FGHE-------
TRPD_BUCDN        DKKIFTK-TSLEENYYIINQIMKGKGDKLNE----ELIAANVAILFKI-FGYE-------
TRPD_BUCAI        PKKILKI-NSLEENYHIIKEIMKGKGSKLYE----ELIAVNVAMLLKV-FGYE-------
TRPD_HAEIN        SLESLRG-GEPQENAQYLTALLQGKGKAEHA----NAVAANTALLLKL-FGYD-------
TRPGD_ECOLI       HQEQLAG-GTPEENRDILTRLLQGKGDAAHE----AAVAANVAMLMRL-HGHE-------
TRPD_VIBPA        PLEAIKG-GDPEENKAIITNILTGKGTDAQL----GAVAVNVALLMRL-FGHE-------
TRPD_SYNY3        PLTALKG-GDLAENVTILSQVLQGKGTQAQI----DAVALNASLALQV-GDAVPWG----
TRPD_LACLA        QLNDIRG-GEAPENAEILKNVLENQP-SAFL----ETTVLNAGLGFYA-NGKVD------
TRPD_ACIAD        TLSGLIV-EDSNASLKLIKDALGRKKSDIGEKAA-NMIALNAGAGIYV-SGLAT------
TRPD_PSEAE        TLMGLEV-DSPQASLELIRDALGRRKTEAGQKAA-ELIVMNAGPALYA-ADLAT------
TRPD_PSEPU        SLHGLAV-ENPQASLELIRDALGRRKTENGQKAA-EMIVLNAGAALYA-ADHAM------
TRPD_METTH        ELEHLRAGSTTAENLELFMDVLRGREDTPEQKSRLDIALANAGALIYL-AGLAD------
TRPD_METTM        QLQHLKAASTVDGNLRMFMDVLAGLDDTPGRKSRLDIALANAGALIYL-AEMED------
TRPD_AQUAE        SLSEVRV-NSPEESVKVALSVLRGEE-GTPR----DMVLLNASFGILV-SERAG------
TRPGD_THEMA       DPEELKGPSDPKEAYRMMESVLKGEASRTQV----ETVALNAGVVFWL-VGECD------
TRPD_AERPE        GLKELRV-ANAVESAERVRRALSGRGRRSDE----AFIAANAAAALYV-AGFEK------
TRPD_GEOSE        GLADVQV-RSSEESAALLEAVMDGTAPASAI----DITALNAGVALYA-AGKAE------
TRPD_BACPU        YLSEIQV-QSPEESAKLIQNILNHQTEGAPL----HITALNAGAALYV-AGKSE------
TRPD_BACSU        RLEDLQV-QSPKESAYLIQNIFENKSSSSAL----SITAFNAGAAIYT-AGITA------
TRPCD_ARCFU       RV--LPC-SSSGESAERIRAVFSGKGLKEDR----RLIAINFATALFA-LGYE-------
TRPD_THEKO        PVKPLPC-SSPEESAARIKAVLGGSGRREDR----DFILVNASAALYA-SGVAE------
TRPD2_STRCO       RPGDLAG-GDRAVNAAVLRRVLAG-GRGPAR----DVVLLNAAAALRV-AGVAG------
TRPD1_STRCO       PVEALRG-ADASYNADVARRLLAGEK-GPVR----DAVLLNSAAALEA-LEPGEGALAE-
TRPD_MYCLE        HLDDLLG-GDAQTNAAKVRAVLAGAK-GPVR----DAVVLNAAGAIVAYAGLSSHAEWSP
TRPD_MYCTU        QLDQLAG-GDAQANAAAVRAVLGGAR-GPVR----DAVVLNAAGAIVAHAGLSSRAEWLP
TRPD_SACS2        PIEKLIV-NSAEDSAIKIVRAFLGKD-EHVA----EFIKINTAVALFA-LDRVG------
TRPD_HALVD        PIEAVAG-GTPQENADDLEGILTGDVTGPKR----DLILANAGAAIYV-AGLAD------
TRPD_LACCA        QRADLVG-GTPEANANITRRILAGDH-GPQR----DIVLLNAGAALHV-AHPDL------
TRPD_METJA        KLEDIRG-GDAEENAKIIGEIFEGEEVGAKR----DIVVLNAAFALYI-AEEAK------
TRPD_CERS4        PFEEIVG-GTPAENAQAFRALLDGAP-GAYR----DAVLLNAAAALVV-ADRAA------
TRPD_AZOBR        RPELLKG-GDAHVNAEAIRALFDGAQ-GAYR----DIVLLNAAAALHV-AGKAG------
TRPD_BRADU        EPGALKG-GDADANAIALQSVLNGKP-SAYR----DVALMNAAAALVV-AGRAK------
                      .                :                  .    .              

TRPD_PICTO        DITSAYDLCINDIESGAAYERLRRISNED--------------------
S0ASN7_FERAC      SFEEAYDLSVDFIQSGKAIEKLKEVCR----------------------
TRPD_THEVO        NYEDAYRLALEAIKSGQAYEKLEAIMHENKGLRHN--------------
TRPD_THEAC        DFQEGYEAALEHIMSGGPAEFLKVIAGDR--------------------
S7U1M4_DESML      SYRQGTEMARQALAEGKARDKMERLIAYQQG------------------
G7WNC4_METH6      SLPEGYSISKEILRSGDALKKLGEWISAQNSDPLAGAEILNALLDRVGN
R9T7Q5_METII      DIESGFERAKSIVASGRAASKIKEWVSIQNSEPDLGLEKLDALLCHC--
A6L9K1_PARD8      KIETCIAEARESLESGKALATFRKFISLNQR------------------
A8Z5Y5_SULMW      SITTNYYKAQEALKSGKVKKILKLFLET---------------------
K9U0J3_CHRTP      DIESAICTSRHSLIDGTAKTYFLQFREFIMTDNLVSVYDN---------
TRPD_STAAC        TIAEGIELATTLIDNGEALEKYHQMRGE---------------------
TRPD_STAAS        TIAEGIELATTLIDNGEALKKYHQMRGE---------------------
TRPD_STAES        SIKHGVERAKYLIDTGMAMKQYLKMGG----------------------
TRPD_STAS1        SIKQGVIEAQRLIDNGNAIAQYNKMGGMTYDYIG---------------
TRPD_CORGL        SLKDGAQKALSLLADGTTQAWLAKHEEIDYSEKESSND-----------
TRPD_HELPY        DLKEGVSMTLEHLKTKAPYAHLQKIIRLSHA------------------
TRPD_HELPJ        DLKEGVSMTLEHLKTKAPYAHLQKIIRLSHA------------------
TRPD_BUCSC        NLKKNTKCALKIIQSGKVYEKIIALSKF---------------------
TRPD_BUCAP        NLKENTKIALKKIRSGDVYKHIMQVSNMLKED-----------------
TRPD_BUCDN        DLKSNTKLALNKIRSGDVYKHIINVANMLKED-----------------
TRPD_BUCAI        NLKENTKLALNKIRSGDVYKHIRNVANMLKEDNHARHNT----------
TRPD_HAEIN        DLKQNVQNVLAHLVSGKAFETLQKLTTY---------------------
TRPGD_ECOLI       DLQANAQTVLEVLRSGSAYDRVTALAARG--------------------
TRPD_VIBPA        DLKANTQQAIEAMNSGKAYQLVQQLAAHA--------------------
TRPD_SYNY3        DHGQGIHLAKDILSQGAGWDKLQQLVAFLGS------------------
TRPD_LACLA        SIKSGVDLAREVISTGAALTKLHELQAEQIG------------------
TRPD_ACIAD        SYKQGVALAHDIIYGGQALEKMSILSEFTKALKEYANN-----------
TRPD_PSEAE        SLHEGIQLAHDALHTGLAREKMDELVAFTAVYREENAQ-----------
TRPD_PSEPU        TLAQGVELAHDVLHTGLAWEKLQELGAFTAVFKVENEA-----------
TRPD_METTH        TLPEGTETAKRTVKSGAALELLEEFVSYTRNLQS---------------
TRPD_METTM        TLEGGTEAARETVESGAALRLMEDFASFTQNL-----------------
TRPD_AQUAE        DIKEAFEMAKESIDSGKALEVLEKYVELSNKI-----------------
TRPGD_THEMA       TIKDGVGKALDLIRTGEAYKKLREVMDYQKTLGNS--------------
TRPD_AERPE        DLKGAAEAAVQAIREGRPAALLEKAVKASLGM-----------------
TRPD_GEOSE        TIAAGVAMAKDAILVKTAYEQLQRLRRKEVVHGA---------------
TRPD_BACPU        SLMAGTLKAIETIKNGAAKEQLARLKQKTREEEIYA-------------
TRPD_BACSU        SLKEGTELALETITSGGAAAQLERLKQKEEEIYA---------------
TRPCD_ARCFU       DLKENVEIFEEKVQSGELARKLEEIACKSTSM-----------------
TRPD_THEKO        DFREGLEMAREALGQG-MLEKLEEIACLSKS------------------
TRPD2_STRCO       TWSDGLRLAASAVDGGAAAGLLDRWAHASWQRADLVEVPA---------
TRPD1_STRCO       RLRAGMDRAAEAIDSGAARRVLERWVAVSHA------------------
TRPD_MYCLE        AWDDGLARASAAIDSGAAEQLLARWVRFSQQV-----------------
TRPD_MYCTU        AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI-----------------
TRPD_SACS2        DFREGYEYADHLIE--KSLDKLNEIISMNGDVTKLKTIVVKSSG-----
TRPD_HALVD        SLEGGVEVARDAIDSGAAKAKHDALREA---------------------
TRPD_LACCA        SIQAGIDLAAKTIDDAKPLKNSIRLLAFSDKRKDVVA------------
TRPD_METJA        DVEEGIKLAEKSIDEGKALKKLEDLIEFYREG-----------------
TRPD_CERS4        HLREGVEIATDSILSGAAKAKVALLARLTNAA-----------------
TRPD_AZOBR        DLKEGDERARHAIDSGAARAVLQHLVSITNSSITNEPVAAP--------
TRPD_BRADU        DLKEGVALGAKSLDSGAANARLKHLIAVSNG------------------
                              :