CLUSTAL format seed alignment for MF_00212

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MQO_AGRFC       -----------------------------------MAAKKVDVLLIGGGIMSATLGVWLR
MQO_RALSO       ------------------------MVCLAAFSAQAAETKKVDVLLVGGGIMSSTLGVWLH
MQO1_PSEAE      --------------MKKILLMLLCVSVLGCSKNSVESEKPVDVLLIGGGIMSATLGTYLN
MQO_ECOLI       ---------MKKVTAMLFSMAVGLNAVSMAAKAKASEEQETDVLLIGGGIMSATLGTYLR
MQO_ECO57       ---------MKKVTAMLFSMAVGLNAVSMAAKAKASEEQETDVLLIGGGIMSATLGTYLR
MQO_NEIMA       ------------------------------------MAEATDVVLVGGGIMSATLGVLLK
MQO_NEIMB       ------------------------------------MAEATDVVLVGGGIMSATLGVLLK
MQO2_STAAM      ----------------------------------MAKSNSKDIVLIGAGVLSTTFGSMLK
MQO2_STAAW      ----------------------------------MAKSNSKDIVLIGAGVLSTTFGSMLK
MQO_CORGL       --------------------------MSDSPKNAPRITDEADVVLIGAGIMSSTLGAMLR
MQO_MYCTU       ----------------------------------MSDLARTDVVLIGAGIMSATLGVLLR
MQO_BACHD       ---------------------------------MSSIQNKTDVILIGAGIMSATLGSLLK
MQO1_STAAM      ---------------------------------MTTQHSKTDVILIGGGIMSATLGTLLK
MQO2_PSEAE      --------------------------------MAQNDHETVDMLLVGAGIMSATLAVLLK
MQO_XYLFA       MKKSLKDLTGLIVAFALATLLFLYWPLYQRSVPKANNDTPVDVVLIGGGIMSVTLGTYLQ
MQO_CAMJE       -----------------------------------MSQQEFDVLVIGAGISGAALFYELA
MQO_HELPY       ------------------------------------MSMEFDAVIIGGGVSGCATFYTLS
MQO_HELPJ       ------------------------------------MSMEFDAVIIGGGVSGCATFYTLS
                                                         * :::*.*: . :    * 

MQO_AGRFC       ELEPTWSMQMLERLDGVALESSNGWNNAGTGHSALAELNYTPEDDNGNIKITQAVNINES
MQO_RALSO       ELEPDWSMMMVERLDGVAQESSNGWNNAGTGHSALAELNYTPEKSNGKIDISKAVEINEG
MQO1_PSEAE      ELEPGWTIEMVERLDKVAEESSNGWNNAGTGHSAFCELNYTSEAADGSMDISKAVAINEN
MQO_ECOLI       ELEPEWSMTMVERLEGVAQESSNGWNNAGTGHSALMELNYTPQNADGSISIEKAVAINEA
MQO_ECO57       ELEPEWSMTMVERLEGVAQESSNGWNNAGTGHSALMELNYTPQNADGSISIEKAVAINEA
MQO_NEIMA       ELEPSWEITLIERLEDVALESSNAWNNAGTGHSALCELNYAPLGANGIIDPARALNIAEQ
MQO_NEIMB       ELEPSWEITLIERLEDVALESSNAWNNAGTGHSALCELNYAPLGANGIIDPARALNIAEQ
MQO2_STAAM      EIEPDWNIHVYERLDRPAIESSNERNNAGTGHAALCELNYTVLQPDGSIDIEKAKVINEE
MQO2_STAAW      EIEPDWNIHVYERLDRPAIESSNERNNAGTGHAALCELNYTVLQPDGSIDIEKAKVINEE
MQO_CORGL       QLEPSWTQIVFERLDGPAQESSSPWNNAGTGHSALCELNYTPE-VKGKVEIAKAVGINEK
MQO_MYCTU       RLEPNWSITLIERLDAVAAESSGPWNNAGTGHSALCEMNYTPEMPDGSIDITKAVRVNEQ
MQO_BACHD       ELKPEWEIKVFEKLANAGEESSNEWNNAGTGHAALCELNYTAEKSDGTIDISKAVKINEQ
MQO1_STAAM      ELSPEKNIKVFEKLAQPGEESSNVWNNAGTGHSALCELNYTKEGKDGTVDCSKAIKINEQ
MQO2_PSEAE      ELDPNLKMEVVELQESGAIESSNPWNNAGTGHAGLCELNYTPQSADGSIDIKKAVGINTM
MQO_XYLFA       ELQPDWKIELFERLNGIAQESSDGWNNAGTGHSAFAELNYTPELQDGTIEIKRAIKIAEQ
MQO_CAMJE       RYTNIKNIALIEKYNTAATLNSKGTSNSQTIHCGDIETNYTLE---------KARKVKRT
MQO_HELPY       EYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSIETNYTPE---------KAKKVRLS
MQO_HELPJ       EYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSIETNYTPE---------KAKKVRLS
                .        : *     .  .*    *: * * .  * **:           :*  :   

MQO_AGRFC       FQISRQFWAWQVRNGVLKNPRSFINHTPHMSFVWGDENVAYLEKRYQALKASPLFAGMEF
MQO_RALSO       FQVTRQFWTYQVKTGVLKNPRSFINSTPHMSFVWGEDNVRYLKKRYEALQASPLFRGMQF
MQO1_PSEAE      FEISKQFWAYQVDRKVLNDPKSFINNVPHMSFVWGDDNVAFLKKRHAALQHSSLFRGMEY
MQO_ECOLI       FQISRQFWAHQVERGVLRTPRSFINTVPHMSFVWGEDNVNFLRARYAALQQSSLFRGMRY
MQO_ECO57       FQISRQFWAHQVERGVLRTPRSFINTVPHMSFVWGEDNVNFLRARYAALQQSSLFRGMRY
MQO_NEIMA       FHVSRQFWATLVAEGKLED-NSFINAVPHMSLVMNEDHCSYLQKRYDAFKTQKLFENMEF
MQO_NEIMB       FHVSRQFWATLVAEGKLED-NSFINAVPHMSLVMNEDHCSYLQKRYDAFKTQKLFENMEF
MQO2_STAAM      FEISKQFWGHLVKSGSIENPREFINPLPHISYVRGKNNVKFLKDRYEAMKAFPMFDNIEY
MQO2_STAAW      FEISKQFWGHLVKSGSIENPRGFINPLPHISYVRGKNNVKFLKDRYEAMKAFPMFDNIEY
MQO_CORGL       FQVSRQFWSHLVEEGVLSDPKEFINPVPHVSFGQGADQVAYIKARYEALKDHPLFQGMTY
MQO_MYCTU       FQVTRQFWAYAAENGILTDVRSFLNPVPHVSFVHGSRGVEYLRRRQKALAGNPLFAGTEF
MQO_BACHD       FQISRQFWAYLVSQNLISNPQDFIMPIPHMSLVQGEDNVAYLKKRFKALSNIPLFEGMEF
MQO1_STAAM      YQISKQFWAYLVKTGQLDNPDRFIQAVPHMSFVIGEDNVAFIKSRVATLKKSVLFEKMKL
MQO2_PSEAE      FEVSKQFWSHLVAKGTFGSPKTFINPVPHLSFVRGSEGIAYLKKRFESLTKHHAFETMVY
MQO_XYLFA       FEISREFWSHQVRHGRLPAPTEFINATPHMSFVWGEDRIEYLRKRHNALIKNPLFYGMQF
MQO_CAMJE       ADMIVKY--GLMQNAQ----NNFMFSHQKMALAVGDIECDYMKKRYEEFKE--LYPYIKF
MQO_HELPY       AYKTRQY---ALNKGL---QNEVIFETQKMAIGVGDEECEFMKKRYESFKE--IFVGLE-
MQO_HELPJ       AYKTRQY---ALNKGL---QNEVIFETQKMAIGVGDEECEFMKKRYESFKE--IFVGLE-
                     ::               .:    :::   .     ::. *   :     :     

MQO_AGRFC       STDPEQIKKWVPLMMEGRDPS----QKL-GATWSPL---GTDMEFGEITRQFVSH-LQSD
MQO_RALSO       SDDYDQISKWVPLMMEGRDRS----QKV-AATWMPV---GTDVNFGEITRQFVGY-LQSQ
MQO1_PSEAE      SEDPEQIKQWVPLVMEGREPG----QKI-AATRMSI---GTDVNFGEITRQLVGS-LSAK
MQO_ECOLI       SEDHAQIKEWAPLVMEGRDPQ----QKV-AATRTEI---GTDVNYGEITRQLIAS-LQKK
MQO_ECO57       SEDHAQIKEWAPLVMEGRDPQ----QKV-AATRTEI---GTDVNYGEITRQLIAS-LQKK
MQO_NEIMA       STDRNKISDWAPLMMRGRDEN----QPV-AANYSAE---GTDVDFGRLTRQMVKY-LQGK
MQO_NEIMB       STDRNKISDWAPLMMRGRDEN----QPV-AANYSAE---GTDVDFGRLTRQMVKY-LQGK
MQO2_STAAM      TEDIEVMKKWIPLMMKGREDN----PGIMAASKIDE---GTDVNFGELTRKMAKS-IEAH
MQO2_STAAW      TEDIEVMKKWIPLMMKGREDN----PGIMAASKIDE---GTDVNFGELTRKMAKS-IEAH
MQO_CORGL       ADDEATFTEKLPLMAKGRDFS----DPV-AISWIDE---GTDINYGAQTKQYLDA-AEVE
MQO_MYCTU       IESPDEFARRLPFMAAKRAFS----EPV-ALNWAAD---GTDVDFGALAKQLIGY-CVQN
MQO_BACHD       SNDPEKLKEWIPLVMEGRTSN----EPI-AATKIDS---GTDVNFGALTRMLFEH-LKEQ
MQO1_STAAM      SQDEEEMKSWVPLMIEGRKSD----EPI-ALTYDET---GTDVNFGALTAKLFEN-LEQR
MQO2_PSEAE      SEDKATLAEWMPLMMPGRPAD----EAI-AATRVEG---GTDVNFGALTNQLLQH-LAQQ
MQO_XYLFA       STDPAVIQQWAPLLMEGRTQD----QKI-AATYMPL---GTDVNFGVITRDLAKH-LQYS
MQO_CAMJE       F-DKAKIKQIEPKVVLGEDCNQDRPENICAMG-VESGEVFTTVDFGKMSINLIEQAQKQN
MQO_HELPY       EFDKQKIKELEPNVILG-ANGIDRHENIIGHGYRKD---WSTMNFAKLSENFVEEALKLK
MQO_HELPJ       EFDKQKIKELEPNVILG-ANGIDRHENIIGHGYRKD---WSTMNFAKLSENFVEEALKLK
                  .   :    * :             : .          : :::.  :           

MQO_AGRFC       QNFDLQVNSEVSDIQRNADGSWRVTYTNTKTDAEQ-VVDAKFVFIGAGGGALHLLQMSGV
MQO_RALSO       PQFTLSLSSEVRDIKRNDDGTWRVSYVNLKSGDRQ-DVDTKFLFIGAGGGALRLLQASGI
MQO1_PSEAE      DTFKLRLQHEVRDLKRNDDNTWTVTMADLANGDKETSVKARFVFIGAGGGALKLLQMSGI
MQO_ECOLI       SNFSLQLSSEVRALKRNDDNTWTVTVADLKNGTAQ-NIRAKFVFIGAGGAALKLLQESGI
MQO_ECO57       SNFSLQLSSEVRALKRNDDNTWTVTVADLKNGTAQ-NIRAKFVFIGAGGAALKLLQESGI
MQO_NEIMA       GV-KTEFNRHVEDIKRESDGAWVLKTADTRNPDGQLTLRTRFLFLGAGGGALTLLQKSGI
MQO_NEIMB       GV-KTEFNRHVEDIKRESDGAWVLKTADTRNPDGQLTLRTRFLFLGAGGGALTLLQKSGI
MQO2_STAAM      PNATVQFNHEVVDFEQLSNGQWEVTVKNRLTGEKF-KQVTDYVFIGAGGGAIPLLQKTGI
MQO2_STAAW      PNATVQFNHEVVDFEQLSNGQWEVTVKNRLTGEKF-KQVTDYVFIGAGGGAIPLLQKTGI
MQO_CORGL       -GTEIRYGHEVKSIKA-DGAKWIVTVKNVHTGDTK-TIKANFVFVGAGGYALDLLRSAGI
MQO_MYCTU       -GTTALFGHEVRNLSRQSDGSWTVTMCNRRTGEKR-KLNTKFVFVGAGGDTLPVLQKSGI
MQO_BACHD       -NVEVHYKHSVKDIKRTSDGSWSVKVQEIESGTIE-YHTANFVFIGGGGGSLPLLQKTGI
MQO1_STAAM      -GVGIQYKQNVLDIKKQKSGAWLVKVKDLETNETT-TYESDFVFIGAGGASLPLLQKTGI
MQO2_PSEAE      PGAQIRYNQKVTHLRR-ADNGWRVTVKDTRNGGDR-EIQARFVFLGAGGGALPLLQLSGI
MQO_XYLFA       QNFALHLDHEVTALRQNPDKTWNVTVKNLNNGQER-SIKSRFVFIGAGGAALKLLQLSGI
MQO_CAMJE       KNTFVAFNQEIIHIEKKDD-IFILKTSNHQ------EYHAKSVVVNAGAHSLYLAHKMNL
MQO_HELPY       PNNQVFLNFKVKKIEKRND-TYAVISEDAE------EVYAKFVLVNAGSYALPLAQSMGY
MQO_HELPJ       PNNQVFLNFKVKKIEKRND-TYAVISEDAE------EVYAKFVLVNAGSYALPLAQSMGY
                          :  :    .  : :   :           :  :.:..*. :: : :  . 

MQO_AGRFC       PEADDYAGFPVGGSFLINENPDVTMQHLAKAYGKASVGSPPMSVPHLDTRVLGGKRVILF
MQO_RALSO       PEARDFAAFPVGGSFLVTENPEVVNRHLAKAYGKASVGSPPMSVPHLDTRVIDGKRIILF
MQO1_PSEAE      PEAEGYAGFPVGGSFLATTNPDVVKRHLAKVYGKASVGSPPMSVPHLDTRMIDGKPVLLF
MQO_ECOLI       PEAKDYAGFPVGGQFLVSENPDVVNHHLAKVYGKASVGAPPMSVPHIDTRVLDGKRVVLF
MQO_ECO57       PEAKDYAGFPVGGQFLVSENPDVVNHHLAKVYGKASVGAPPMSVPHIDTRVLDGKRVVLF
MQO_NEIMA       PEGKGYGGFPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHLDTRNVDGKRHLMF
MQO_NEIMB       PEGKGYGGFPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHLDTRNVDGKRHLMF
MQO2_STAAM      PESKHLGGFPISGQFLACTNPQVIEQHDAKVYGKEPPGTPPMTVPHLDTRYIDGQRTLLF
MQO2_STAAW      PESKHLGGFPISGQFLACTNPQVIEQHDAKVYGKEPPGTPPMTVPHLDTRYIDGQRTLLF
MQO_CORGL       PQVKGFAGFPVSGLWLRCTNEELIEQHAAKVYGKASVGAPPMSVPHLDTRVIEGEKGLLF
MQO_MYCTU       KEVKGFAGFPIGGRFLRAGNPALTASHRAKVYGFPAPGAPPLGALHLDLRFVNGKSWLVF
MQO_BACHD       PESKNIGGFPVSGLFMVCNNPEVVEQHHAKVYGKAKVGAPPMSVPHLDTRYIDNKKSLLF
MQO1_STAAM      KQSKHIGGFPVSGLFLRCTNQEVIDRHHAKVYGKAAVGAPPMSVPHLDTRFVDGKRSLLF
MQO2_PSEAE      PEGKGFGGFPVSGQWLRCDNPEIVKQHQAKVYSQAEVGSPPMSVPHLDTRVVDGKKSLLF
MQO_XYLFA       PESKDYAGFPVGGQFLSFENTAITKRHNVKAYGMAESGSPPMSVPHLDARKLDGKSIVLF
MQO_CAMJE       --GMDKSCWPVAGSFYLTKQKLL----NGKVYMVQNPKLP-FAALHGDPDLL-ADMNTRF
MQO_HELPY       --GLDLGCLPVAGSFYFV--PDLL---RGKVYTVQNPKLPFAAVHGDPDAVIKGKTRI--
MQO_HELPJ       --GLDLGCLPVAGSFYFV--PDLL---RGKVYTVQNPKLPFAAVHGDPDAVIKGKTRI--
                      .  *:.* :              *.*       *   .       :  .     

MQO_AGRFC       GPFATFSTKFLKEGS-----YFDLVS-----SVTTSNAWPMVRVGIDEYPLVEYLAGQLM
MQO_RALSO       GPFATFSTKFLKNGS-----YMDLFG-----STTSHNVMPMLHVGVDEFPLVQYLAGQLM
MQO1_PSEAE      GPFATFSTKFLKNGS-----LWDLPG-----SVTSGNIGPMFNAGIDNFDLSQYLIGQLM
MQO_ECOLI       GPFATFSTKFLKNGS-----LWDLMS-----STTTSNVMPMMHVGLDNFDLVKYLVSQVM
MQO_ECO57       GPFATFSTKFLKNGS-----LWDLMS-----STTTSNVMPMMHVGLDNFDLVKYLVSQVM
MQO_NEIMA       GPYAGFRSNFLKQGS-----LMDLPL-----SIHMDNLYPMLRAGWANMPLTKYLLGELR
MQO_NEIMB       GPYAGFRSNFLKQGS-----LMDLPL-----SIHMDNLYPMLCAGWANMPLTKYLLGELR
MQO2_STAAM      GPFANVGPKFLKNGS-----NLDLFK-----SVKTYNITTLLAAAVKNLPLIKYSFDQVI
MQO2_STAAW      GPFANVGPKFLKNGS-----NLDLFK-----SVKTYNITTLLAAAVKNLPLIKYSFDQVI
MQO_CORGL       GPYGGWTPKFLKEGS-----YLDLFK-----SIRPDNIPSYLGVAAQEFDLTKYLVTEVL
MQO_MYCTU       GPYAGWSPKFLKHGQ-----ISDLPR-----SIRPDNLLSVLGVGLTERRLLNYLISQLR
MQO_BACHD       GPFAGFSPKFLKTGS-----NFDLIG-----SVKPYNVFTMLAAGAKEMSLTKYLIQQVM
MQO1_STAAM      GPFAGFSPKFLKTGS-----HMDLIK-----SVKPNNIVTMLSAGIKEMSLTKYLVSQLM
MQO2_PSEAE      GPYAGFSTKFLRHGS-----FLDLPL-----SVRPGNILPMLSVARDNMDLTRYLIGQVM
MQO_XYLFA       GPFALYSTKFLKKGS-----WFDLYS-----SVNHHNAAGMLSVGKNNIDLVKYLMKQAT
MQO_CAMJE       GPTALVIPKLERYHGLKSVPEF-FEALKLDKTVLKVTFNMFKDATIRNYIFYNYLFELPF
MQO_HELPY       GPTALTMPKLERNKCWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPI
MQO_HELPJ       GPTALTMPKLERNKCWLKGISLELLKMDLNRDVFKIAFDLMSDKEIRNYVFKNMVFELPI
                ** .   .:: :           :                       :  : .       

MQO_AGRFC       MSDDDRFAALKEYFPNAKQGEWRLWQ--AGQRVQIIKRDE-EKG-GVLRLGTEVVAAKDG
MQO_RALSO       LSDEDRFNALKEYFPLAKKEDWRLWQ--AGQRVQIIQRDE-AKG-GILKLGTQIVKSKDG
MQO1_PSEAE      LSQDDRMASLREYFPEARDEDWKLVQ--AGQRVQIIKKDA-EKG-GVLQFGTEVVTAADG
MQO_ECOLI       LSEEDRFEALKEYYPQAKKEDWRLWQ--AGQRVQIIKRDA-EKG-GVLRLGTEVVSDQQG
MQO_ECO57       LSEEDRFEALKEYYPQAKKEDWRLWQ--AGQRVQIIKRDA-DKG-GVLRLGTEVVSDQQG
MQO_NEIMA       KTKEERFASLLEYYPEANPDDWELIT--AGQRVQIIKKDS-EKG-GVLQFGTEIVAHADG
MQO_NEIMB       KTKEERFASLLEYYPEANPDDWELIT--AGQRVQIIKKDS-EKG-GVLQFGTEIVAHADG
MQO2_STAAM      MTKEGCMNHLRTFYPEARNEDWQLYT--AGKRVQVIKDTP-EHGKGFIQFGTEVVNSQDH
MQO2_STAAW      MTKEGCMNHLRTFYPEARNEDWQLYT--AGKRVQVIKDTP-EHGKGFIQFGTEVVNSQDH
MQO_CORGL       KDQDKRMDALREYMPEAQNGDWETIV--AGQRVQVIKPAGFPKF-GSLEFGTTLINNSEG
MQO_MYCTU       LSEPERVSALREFAPSAIDSDWELTI--AGQRVQVIRRDE-RNG-GVLEFGTTVIGDADG
MQO_BACHD       LSKEKRMAELREFMPNAKSEDWDIVV--AGQRVQVIKDTE-AGGKGTLQFGTEVVSSADG
MQO1_STAAM      LSNDERMDDLRVFFPNAKNEDWEVIT--AGQRVQVIKDTE-DSK-GNLQFGTEVITSDDG
MQO2_PSEAE      QSPEQRLEALRKFYPEARAEDWRLEV--AGQRVQIIKKDP-KKG-GILQFGTELVAAHDG
MQO_XYLFA       LTDADRHAELLKYFPNAKPTDWTLVT--AGQRVQIIKRDP-EKG-MILQFGTEIVMDKDH
MQO_CAMJE       VDKSLFVKDAKKIVPSLKASDIYYAKGFGGVRPQVIDKT-----KGELMLGEASITETPG
MQO_HELPY       IGKRKFLKDAQKIIPSLSLEDLEYAHGFGEVRPQVLDRT-----KRKLELGEKKICTHKG
MQO_HELPJ       IGKRKFLKDAQKIIPTLSLEDLEYAHGFGEVRPQVLDRT-----KRKLELGEKKICTHKG
                              *     :       .  * *::           : :*   :     

MQO_AGRFC       SIAGLLGASPGASTAAPIMLSVLEKVFKDKVATPEWQAKLRQIVPSYGTKLNDDPEKVRE
MQO_RALSO       TIAGLLGASPGASTAAPIMLGVLETVFKDKLATPAWQQKVRQMIPTYGIKLNDNPAKVYE
MQO1_PSEAE      SVAALLGASPGASTAAPIMLSVLEKAFKDKVATPEWQARLKEIVPSYGRKLNNDIELTNS
MQO_ECOLI       TIAALLGASPGASTAAPIMLNLLEKVFGDRVSSPQWQATLKAIVPSYGRKLNGDVAATER
MQO_ECO57       TIAALLGASPGASTAAPIMLNLLEKVFGDRVSSPQWQATLKAIVPSYGRKLNGDVAATER
MQO_NEIMA       SLAALLGASPGASTAVPLMIRLMHQCFPER--TPSWEGRLKELVPGYGIKLNENPERADE
MQO_NEIMB       SLAALLGASPGASTAVPLMIRLMHQCFPER--APSWEDRLKELVPGYGIKLNENPERADE
MQO2_STAAM      TVIALLGESPGASTSVSVALEVLERNFPEY--KTEWAPKIKKMIPSYGESLIEDEKLMRK
MQO2_STAAW      TVIALLGESPGASTSVSVALEVLERNFPEY--KTEWAPKIKKMIPSYGESLIEDEKLMRK
MQO_CORGL       TIAGLLGASPGASIAPSAMIELLERCFGDRMI--EWGDKLKDMIPSYGKKLASEPALFEQ
MQO_MYCTU       SIAGLLGGSPGASTAVAIMLDVLQKCFANRYQ--SWLPTLKEMVPSLGVQLSNEPALFDE
MQO_BACHD       SIAALLGASPGASTAVHVMLEVLEKCFPHHML--EWQPKIKEMIPSYGVSLAENRELFQE
MQO1_STAAM      TLAALLGASPGASTAVDIMFDVLQRCYRDEFK--GWEPKIKEMVPSFGYRLTDHEDLYHK
MQO2_PSEAE      SIAALLGASPGASVTVSIMLGLIERCFPEQARSPEWSAKLKEIFPAREKELESDAELYRS
MQO_XYLFA       TLATLLGASPGASTSPSIMLDLLAKAFPQQMKN-GWETQLKKIIPSYGQHINDSPALTNK
MQO_CAMJE       IIFNMT-PSPGATSC----LGNAER-------------DAKLVCNYLGMEFNED------
MQO_HELPY       -ITFNMTPSPGATSC-------LQNALVDSQEIAAY--------------LGESFELERF
MQO_HELPJ       -ITFNMTPSPGATSC-------LQNALVDSQEIAAY--------------LGESFELERF
                 :      ****:                                     :         

MQO_AGRFC       EWAYTAEHLQLPTPPQIDLEALKGAGAAPAGAPVKKVPDIAL-------
MQO_RALSO       EWVATAEALQLSPPPRIDLRVTPAAPAAKPAAGAAQQAKPAKATADIAL
MQO1_PSEAE      TRAWSSERLQLIHVPVQPEA-----------------------------
MQO_ECOLI       ELQYTSEVLGLNYDKPQAADSTPKPQLKPQPVQKEVADIAL--------
MQO_ECO57       ELQYTSEVLGLKYDKPQAADSTPKPQLKPQPVQKEVADIAL--------
MQO_NEIMA       IIAYTAKVLDI--------------------------------------
MQO_NEIMB       IIAYTAKVLDI--------------------------------------
MQO2_STAAM      IRKQTSKDLELGYYEN---------------------------------
MQO2_STAAW      IRKQTSKDLELGYYEN---------------------------------
MQO_CORGL       QWARTQKTLKLEEA-----------------------------------
MQO_MYCTU       VWSWSTKALKLGAA-----------------------------------
MQO_BACHD       IHQSTAEALGLSEKELVHS------------------------------
MQO1_STAAM      INEEVTKYLQVK-------------------------------------
MQO2_PSEAE      VSSRCSEVLELTAKNDVQAPVNAE-------------------------
MQO_XYLFA       IRRMTSETLSLPYLEVPDKSATPPDPTIAPKHQHSPTHNANSEMQAL--
MQO_CAMJE       --KFSSELL----------------------------------------
MQO_HELPY       YKDLSPEELEN--------------------------------------
MQO_HELPJ       YKDLSPEELEN--------------------------------------
                      : *