CLUSTAL format seed alignment for MF_00218

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DCUP_RICCN      ------------------------MKQIINPLKG-NNNKVPIWFMRQAGRYLPEYKKVRE
DCUP_RICPR      ------------------------MKQILNPLK--NSNKIPIWFMRQAGRYLPEYKKVRE
DCUP_ORITB      ------------------------MSKIIQAFHSSNKNYTPIWFMRQAGRYLPEYQVLKR
DCUP_NEOSM      ------------------------MSLL--------DKKISTWFMRQAGRYLPEYLKISK
DCUP_BRUME      -----------------------MNLKVLKVIDGETVFPPPIWMMRQAGRYLPEYRETRK
DCUP_BRUSU      -----------------------MNRKVLKVIDGETVFPPPIWMMRQAGRYLPEYRETRK
DCUP_RHILO      ---------------------MPKSRIMLDVLKGEAHFPPPLWMMRQAGRYLPEYRETRR
DCUP_AGRFC      ----------------------MSERKVMTVLNGKTVTPPPIWLMRQAGRYLPEYRETRK
DCUP_BRADU      -------------------MPQSATKPFIDVLSGQRQAIPPMWMMRQAGRYLPEYREVRA
DCUP_CAUVC      --------------MTSSSPILKQTPKFLSALEGQSHANPPVWFMRQAGRYLPEYRAVRA
DCUP_RHOCA      ----------------------MTDKTILRALKGEVLPTPPVWLMRQAGRYLPEYRATRA
DCUP_HELPY      -------------------------MIFIDACFRKETPYTPIWMMRQAGRYLSEYQESRK
DCUP_HELPJ      -------------------------MIFIDACFRKETPYTPIWMMRQAGRYLSEYQESRK
DCUP_CAMJE      -------------------------MIFIDACFKKPTPYTPIWMMRQAGRYLPEYMEVRK
DCUP_ECOLI      -------------------MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRA
DCUP_ECO57      -------------------MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRA
DCUP_ECOL6      -------------------MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRA
DCUP_SALTI      -------------------MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRA
DCUP_SALTY      -------------------MTELKNDRYLRALLRQPVDVTPVWMMRRAGRYLPEYKATRA
DCUP_YERPE      -------------------MNELKNDRYLRALLRQPVDMTPVWMMRQAGRYLPEYKATRA
DCUP_VIBPA      -------------------MTELKNDRYLRALLKEPVDYTPVWMMRQAGRYLPEYKATRA
DCUP_VIBVU      -------------------MTELKNDRYLRALLKEPVDCTPVWMMRQAGRYLPEYKATRA
DCUP_VIBCH      -------------------MTELKNDRYLRALLKQPVDYTPVWMMRQAGRYLPEYRATRA
DCUP_PASMU      -------------------MTALKNDRYLKALLREPVDMTPVWMMRQAGRYLPEYRATRA
DCUP_SHEON      -------------------MAELKNDRYLRALLKQPVDMTPVWMMRQAGRYLPEYKATRA
DCUP_PSEPK      -------------------MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRASRA
DCUP_PSESM      -------------------MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRASRA
DCUP_PSEAE      -------------------MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRATRA
DCUP_NEIMA      -------------------MTLLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRA
DCUP_NEIMB      -------------------MISLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRA
DCUP_NITEU      -------------------MTKLENDTFIRALLRQPVDYTPVWMMRQAGRYLPEYNQTRA
DCUP_RALSO      ------------------MSAPLANDTFLRALRRQPTEYTPLWLMRQAGRYLPEYNATRA
DCUP_XANAC      ---------------------MLKNDRLLRALNRQPVDRTPVWLMRQAGRYLPEYRATRA
DCUP_XANCP      ---------------------MLKNDRLLRALRRQPVDRTPVWLMRQAGRYLPEYRATRA
DCUP_XYLFA      ---------------------MLKNDRLLRALQRDTVDRTPIWLMRQAGRYLPEYRAVRQ
DCUP_XYLFT      ---------------------MLKNDRLLRALRRDTVDRTPIWLMRQAGRYLPEYRAARQ
DCUP_COXBU      -------------------MLRLKNDRFIRALLRQPVDRTPVWIMRQAGRYLPEYRQLRE
DCUP_WIGBR      -------------------MQFFENDSYLRSALRKSVKRTPIWIMRQSGRYLKEYQSIKK
DCUP_CHLTE      ---------------------MLKNDLFIRALKRQATPRTPIWVMRQAGRYLPEYRAVRE
DCUP_SYNE7      ------------------MVASSSLPRLLRAARGEVLDRPPVWMMRQAGRYMKVYRDLRD
DCUP_SYNY3      ------------------MTEANDLPYLLRVARGEVVKRPPVWMMRQAGRYMKVYRDLRD
DCUP_NOSS1      ------------------MGVTSTAPHLLRAARGEIVDRPPVWMMRQAGRYMKAYRDLRE
DCUP_THEEB      ----------------------MTTPLLLRAARGESVERPPIWLMRQAGRYMKVYRDLRD
DCUP_BACAN      --------MVR-----------TINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKE
DCUP_BACCR      --------MVR-----------TINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKE
DCUP_BACHD      --------MSN-----------SFNDTFLKACKGEVHDHVPVWYMRQAGRSQPEYRKIKE
DCUP_BACSU      --------MSKR---------ETFNETFLKAARGEKADHTPVWYMRQAGRSQPEYRKLKE
DCUP_STAAM      --------MVH-----------NKNNTILKMIKGEETSHTPVWFMRQAGRSQPEYRKLKE
DCUP_STAES      MIQLWGDSRLR-----------SKNDTILKAIKGESTSHTPVWFMRQAGRSQPEYRKLKE
DCUP_OCEIH      --------MSI-----------IKNDTIIKAYQGEETDYTPAWFMRQAGRSQPEYRALKE
DCUP_LISIN      --------MTK-----------ITNDLFLKAARKEQVDRIPVWYMRQAGRSQPEYRKLKE
DCUP_LISMO      --------MTK-----------ITNDLFLKAARKEQVDRIPVWYMRQAGRSQPEYRKLKE
DCUP_DEIRA      ----------------------MRDSAFLKTARGEQAPYTPVWFMRQAGRYMPEYRALRA
DCUP_COREF      --------MSSQLIPATRR--VLNNAPLLDAAHGKTPTRTPVWFMRQAGRSLPEYLKVRE
DCUP_CORGL      --------MSALTIPAARR--TLNNAPIIDAANGKTPTRTPVWFMRQAGRSLPEYKKVRE
DCUP_MYCLE      --------MSTRRELL--------ESPYLAAVSGRKPCRVPVWFMRQAGRSLPEYRALRE
DCUP_MYCTU      --------MSTRRDLP--------QSPYLAAVTGRKPSRVPVWFMRQAGRSLPEYRALRE
DCUP_STRAW      --------MSANDRPATGQPTATYESAFLKACRREPVPHTPVWFMRQAGRSLPEYLKVRE
DCUP_STRCO      --------MSANQSPAGQPPTATYDSAFLKACRREPVPHTPVWFMRQAGRSLPEYLKVRE
DCUP_PICTO      ------------------------MNSFISMIRNGYSDTIPVWFMRQAGRYLKEYNE-KK
DCUP_THEAC      ------------------------MDPFRKAIKGYDHDRIPVWFMRQAGRYLPSYMK-YR
DCUP_AQUAE      ---------------------MPKNDLLLRSLRGEPIGRFPVWLMRQAGRYMPEYRKIRN
DCUP_CHLMU      ------------------------MAGFYDIISPSNQHRPPVWLLRQVGRYMPQYQELKT
DCUP_CHLTR      ----------------------MPMTGFYETISPRDQQRPPIWFLRQVGRYIPQYQELKR
DCUP_CHLCV      ------------------------MSGFYDVIKPKTA-RPPVWFLRQVGRYMPQYKELKG
DCUP_CHLPN      ------------------------MSAFFDLLKSQTASHPPIWLLRQVGRYMPPYQELKG
                                                        . * :*: **    *     

DCUP_RICCN      TTKNFLDFCYDVSKATEVTLQPIKRYG-FDAAIIFSDILVLPHALGWEVDFKENIGPILK
DCUP_RICPR      TTKNFLDFCYDVNKATEVTLQPIRRYG-LDAAIIFSDILVLPNALGWEVDFKENIGPVLK
DCUP_ORITB      TTNSFFELCYNPIKAAEATLQPIARFD-FDAAIIFSDILVLPDSLGINIRFINNLCPTAE
DCUP_NEOSM      EM-TFFQMCESPEIASEITLQPIKRFD-LDAAIVFSDILVLPRALGCNIDIKKSTGPVIE
DCUP_BRUME      KAGSFLDLCYSPDLAVEVTLQPIRRFG-FDAAILFSDILVVPHALGRDLRFEEGKGPLMT
DCUP_BRUSU      KAGSFLDLCYSPDLAVEVTLQPIRRFG-FDAAILFSDILVVPHALGRDLRFEEGKGPLMT
DCUP_RHILO      RAGSFLDLCYDPDLAVEVTLQPIERFG-FDASILFSDILVVPHALGRDVRFEEGRGPLLT
DCUP_AGRFC      SAGSFLDLCYNPELASEVTLQPIRRFG-LDAAILFSDILVIPDALHRNVSFSEGKGPAMD
DCUP_BRADU      KAGGFLDLCFNPELAAEVTLQPIRRFG-FDAAIIFSDILVIPYALGRSVRFEVGEGPRLE
DCUP_CAUVC      TAPDFISFCFDPEKAAEVTLQPMRRFP-FDASIVFADILLIPGALGQKVWFEAGEGPKLG
DCUP_RHOCA      QAGDFLSLCYTPDLAAEVTLQPIRRYG-FDAAILFADILLLPQALGLDLWFETGEGPRMS
DCUP_HELPY      KAGSFLELCKNSDLATEVTLQPVEILG-VDAAILFSDILVVPLEMGLNLEFIPKKGPHFL
DCUP_HELPJ      KAGSFLELCKNSDLATEVTLQPVEILG-VDAAILFSDILVVPLEMGLNLEFIPKKGPHFL
DCUP_CAMJE      QAGDFLSLCKDYKKASEVSLQPIDILD-VDAAIIFSDILVVPLEMGMNLRFEKGEGPVFG
DCUP_ECOLI      QAGDFMSLCKNAELACEVTLQPLRRYP-LDAAILFSDILTVPDAMGLGLYFEAGEGPRFT
DCUP_ECO57      QAGDFMSLCKNAELACEVTLQPLRRYP-LDAAILFSDILTVPDAMGLGLYFEAGEGPRFT
DCUP_ECOL6      QAGDFMSLCKNAELACEVTLQPLRRYP-LDAAILFSDILTVPDAMGLGLYFEAGEGPRFT
DCUP_SALTI      QAGDFMSLCKNAELACEVTLQPLRRYP-LDAAILFSDILTIPDAMGLGLYFEAGEGPRFT
DCUP_SALTY      QAGDFMSLCKNAELACEVTLQPLRRYP-LDAAILFSDILTIPDAMGLGLYFEAGEGPRFT
DCUP_YERPE      IAGDFMSLCKNAELACEVTMQPLRRYP-LDAAILFSDILTIPDAMGLGLYFETGEGPRFQ
DCUP_VIBPA      QAGDFMSLCKNAELASEVTLQPLRRFP-LDAAILFSDILTIPDAMGLGLRFAAGEGPVFD
DCUP_VIBVU      QAGDFMSLCKNAELASEVTLQPLRRFP-LDAAILFSDILTIPDAMGLGLRFSTGEGPIFD
DCUP_VIBCH      QAGDFMALCKNAELASEVTLQPLRRFP-LDAAILFSDILTIPDAMGLGLRFAAGEGPVFE
DCUP_PASMU      VAGDFMSLCRNAELACEVTLQPLRRYP-LDAAILFSDILTIPDAMGLGLSFGVGEGPKFA
DCUP_SHEON      QAGDFMSLCKNHELACEVTLQPLRRYE-LDAAILFSDILTVPDAMGLGLYFEAGEGPRFE
DCUP_PSEPK      KAGDFMSLCMNPQFACEVTLQPLDRYP-LDAAILFSDILTIPDAMGLGLYFETGEGPRFK
DCUP_PSESM      SAGDFMSLCKNPQFACEVTLQPLDRYP-LDAAILFSDILTIPDAMGLGLYFETGEGPRFK
DCUP_PSEAE      KAGDFMSLCMNPELACEVTLQPLDRYPQLDAAILFSDILTIPDAMGQGLYFETGEGPRFR
DCUP_NEIMA      KAGSFLDLCKNTELATEVTIQPLERFD-LDAAILFSDILTVPDAMGLGLYFAEGEGPKFK
DCUP_NEIMB      KAGSFLDLCKNTELATEVTIQPLERFD-LDAAILFSDILTVPDAMGLGLYFAEGEGPKFK
DCUP_NITEU      RAGSFLSLCKNPDFATEVTLQPLARFS-LDAAILFSDILTIPDAMGLGLYFADGEGPRFE
DCUP_RALSO      RAGSFLGLAKSPAYATEVTLQPLDRYP-LDAAILFSDILTVPDAMGLGLSFEQGEGPRFA
DCUP_XANAC      RAGSFLGMAKNPDIACEVTLQPLQRFP-LDAAILFSDILTIPDAMGLELYFVEGEGPKFR
DCUP_XANCP      RAGSFLGMAKNPDIACEVTLQPLERFP-LDAAILFSDILTIPDAMGLELYFVEGEGPKFR
DCUP_XYLFA      HAGSFLKMAKTPELACEITLQPLHRFP-LDAAILFSDILMIPDAMGLELHFIEGEGPRLG
DCUP_XYLFT      HAGSFLKMAKTPELACEITLQPLRRFP-LDAAILFSDILMIPDAMGLELHFIEGEGPRLG
DCUP_COXBU      KVPNFMAFCKTPELACEATLQPLRRFP-LDAAIIFSDILTIPDAMGVDLHIAPTVGPVIR
DCUP_WIGBR      QAKDFLSLCKTPDLSSKAALIPIKKFS-LDAAIIFSDILILPYAMGMDVNFYENLGPSFL
DCUP_CHLTE      KT-DFLTLCKTPELACEVTIQPVDLMG-VDAAIIFSDILVVNEAMGMNVEIIETKGIKLT
DCUP_SYNE7      KYPGFRERSETPELAIEISLQPFRAFK-PDGVILFSDILTPLPGMGIPFDIIESKGPILE
DCUP_SYNY3      KYPSFRERSENPDLAIEISLQPWQAFQ-PDGVIMFSDILTPLPGIGIPFDIIESKGPIID
DCUP_NOSS1      KYPSFRDRSEIPEVAIEVSLQPWKAFQ-PDGVILFSDIVTPLPGLGIEMDIAEGKGPIIH
DCUP_THEEB      RYPSFRQRSEIPELAIEISLQPFRAFA-PDGVILFSDILTPLPGIGIPFDIVESKGPIID
DCUP_BACAN      KY-SLFEITHNPELCAYVTKLPVDQYN-VDAAILYKDIMSPLPAIGVDVEIKSGIGPVID
DCUP_BACCR      KY-SLFEITHNPELCAYVTKLPVDQYN-VDAAILYKDIMSPLPAIGVDVEIKSGIGPVID
DCUP_BACHD      KY-SLFEITKQPELCAYVTKLPVDQYN-NDAAILYKDIMTPLPFIGVDVEIKTGKGPVID
DCUP_BACSU      KY-GLFEITHQPELCAYVTRLPVEQYG-VDAAILYKDIMTPLPSIGVDVEIKNGIGPVID
DCUP_STAAM      KY-SLFDITHQPELCAYVTHLPVDNYH-TDAAILYKDIMTPLKPIGVDVEIKSGIGPVIH
DCUP_STAES      KY-SLFEITHQPELCAYVTHLPVDNYQ-TDAAVLYKDIMTPLKPIGVDVEIKSGIGPVIS
DCUP_OCEIH      KY-SLFEITHQPELCAYVTRLPVENYG-TDAAILYKDIMSPLPYIGVDVEIKSGIGPVIH
DCUP_LISIN      KY-SLFEITHQPEICAYVTKLPVDQYG-VDAAILYKDIMTPLPGMGVDVEIKSGIGPVIH
DCUP_LISMO      KY-SLFEITHQPEICAYVTKLPVDQYG-VDAAILYKDIMTPLPGMGVDVEIKSGIGPVIH
DCUP_DEIRA      GK-TMLECIRTPDLAAEITLQPIKAMP-LDAAILFNDILTPLPTMGLSLDFVGGVGPVIH
DCUP_COREF      GI-SMLDSCFMPELLAEITMQPVRRHD-VDAAILFSDIVVPLRAAGVGVEIVPGRGPVMD
DCUP_CORGL      GI-SMLDSCFMPELLAEITLQPVRRHD-VDAAILFSDIVVPLRAAGVGVEIVAGRGPVLD
DCUP_MYCLE      RY-SMLAACFEPEVACEITLQPLRRYD-VDAAILFSDIVVPLCAAGIDLDIVPDVGPVIG
DCUP_MYCTU      RY-SMLAACFEPDVACEITLQPIRRYD-VDAAILFSDIVVPLRAAGVDLDIVADVGPVIA
DCUP_STRAW      GI-PMLESCMRPELVAEITLQPVRRHN-VDAAIYFSDIVVPLKAIGIDLDIKPGVGPVVE
DCUP_STRCO      GI-PMLESCMRPELVAEITLQPVRRHG-VDAAVYFSDIVVPLKAIGIDLDIKPGVGPVIA
DCUP_PICTO      GRMTIKEICMDPELIAGISYDPVRILN-VDAAIIFSDITIPLEALGYKIEFLPGGPRIIN
DCUP_THEAC      QRMGIEEMMSSPDVIVDVTHDPVDRIG-VDAAIIFADITTPLSGMGLRVRFLDSVGPVVE
DCUP_AQUAE      RVKNFLELCKNVDLATEISLLPLKILG-VDAIIIFSDILVPLEPLGVKVEFVEGEGP---
DCUP_CHLMU      NR-PLKELFLDTESIIEATLLGPSLLG-VDAAIVFTDILSILEGFAIEYRFAP------G
DCUP_CHLTR      NR-SLKDFFLDTESIVEATLLGPSLLG-VDAAIVFADILSILEGFSVDYRFAP------G
DCUP_CHLCV      SQ-TLKAFFHNTEAITEATLLGPSLLK-VDAAILFADILSLLDGFNISYDFSP------G
DCUP_CHLPN      SQ-SLKTFFHNTEAIVEATLLGPSLLH-VDAAILFADILSILDGFAVTYDFAP------G
                    :             :          *. : : **            :         

DCUP_RICCN      QFKSQEDFKYLQ--INPNYKLEKVYEIIKKVKKELPS----PISLIGFAGSPWTVMSYML
DCUP_RICPR      QFKSQKDFQYLQ--RDSNNKLEKVYKIIKKVKEKLPS----NTSLIGFAGSPWTVMSYML
DCUP_ORITB      KIPNLLDLQKSK--IQ-NTKISKVYEAIDIVRKKLNK----KKSLIGFCGGPWTVLTYIL
DCUP_NEOSM      RINNPNWLTYDA--FE--EKISPTLNTIAITRKSLPQ----NKSLIGFAGGPWTVALYII
DCUP_BRUME      PID-ADEIFWLE-TEGVAKRLEPVYETVRLVREQLPD----ETTLLGFCGAPWTVATYMI
DCUP_BRUSU      PID-ADEIFWLE-TEGVAKRLEPVYETVRLVREQLPD----ETTLLGFCGAPWTVATYMI
DCUP_RHILO      PIS-VAEIMALE-SDVFHVNLEPVYETVRRLRAKLPD----ETTLIGFCGAPWTVATYMI
DCUP_AGRFC      PID-ISGIEKLD-ASDVMAHLSPVFETVSRLRTSLPD----ETTLLGFCGAPWTVATYMI
DCUP_BRADU      PLDDPAKVATLA-PRADFGKLAPVFDALKIVRGALDP----KTALIGFCGAPWTVATYMV
DCUP_CAUVC      DMP-SVESMAEK-AGEAGKALSLVGETLTRVRSALDP----DKALIGFAGAPWTVATYMI
DCUP_RHOCA      TVTSMEGVKGLKGKDDIHDKLAPVYETCKILSRELPK----ETTFIGFAGMPWTVATYMI
DCUP_HELPY      ETITDLKSVESLK-VGAYKQLNYVYDTISQTRQKLSR----EKALIGFCGSPWTLATYMI
DCUP_HELPJ      ETITDLKSVESLK-VGVYKQLNYVYDTISQTRQKLSK----EKALIGFCGSPWTLATYMI
DCUP_CAMJE      NPISTLEDLEKLDDQNAHKKLNYVYDALKLTREKLSQ----NKALIGFCGSPWTIATYMI
DCUP_ECOLI      SPVTCKADVDKLPIPDPEDELGYVMNAVRTIRRELKG----EVPLIGFSGSPWTLATYMV
DCUP_ECO57      SPVTCKADVDKLPIPDPEDELGYVMNAVRTIRRELKG----EVPLIGFSGSPWTLATYMV
DCUP_ECOL6      SPVTCKADVDKLPIPDPEDELGYVMNAVRTIRRELKG----EVPLIGFSGSPWTLATYMV
DCUP_SALTI      APVTCKADVDKLPIPDPEDELGYVMNAVRTIRRELKG----EVPLIGFSGSPWTLATYMV
DCUP_SALTY      APVTCKADVEKLPIPDPEGELGYVMNAVRTIRRELKG----EVPLIGFSGSPWTLATYMV
DCUP_YERPE      SPITCRADVEKLPIPDPEQELGYVMNAVRTIRRELAG----SVPLIGFSGSPWTLATYMV
DCUP_VIBPA      NPITCKADVEKIGLPDPEGELQYVMNAVRQIRKDLNG----DVPLIGFSGSPWTLATYMV
DCUP_VIBVU      NPITCKADVEKIGVPDPEGELQYVMNAVRQIRKDLNG----DVPLIGFSGSPWTLATYMV
DCUP_VIBCH      RPITCKADVDKIGIPDPEGELQYVMNAVRQIRKDLQG----EVPLIGFSGSPWTLATYMV
DCUP_PASMU      HPIETQRAVQNLPIPDPEGELQYVMNAVRTIRRELKG----EVPLIGFSGSPWTLATYMV
DCUP_SHEON      RPTDTIDAIKKLSIPDPEDELGYVMKAVSTIRRELNG----QVPLIGFSGSPWTLATYMV
DCUP_PSEPK      KVISTPADIEALPVPDPQKDLGYVMDAVSTIRRELNG----RVPLIGFSGSPWTLATYMV
DCUP_PSESM      KTVSTLADIEALPIPDAQQDLGYVMDAVSTIRRELNG----RVPLIGFAGSPWTLATYMV
DCUP_PSEAE      KVVSSLADIEALPVPDPEQDLGYVMDAVRTIRRELNG----RVPLIGFSGSPWTLATYMV
DCUP_NEIMA      RALQHEDDIAKLHVPDM-EKLQYVFDAVTSIRKALDG----RVPLIGFSGSPFTLACYMV
DCUP_NEIMB      RALQHEADIAKLHVPDM-EKLQYVFDAVTSIRKALDG----RVPLIGFSGSPFTLACYMV
DCUP_NITEU      RPLREEREIRSLIVPDPDTHLRYVTDAVRQIRTALNN----RVPLIGFSGSPFTLACYMV
DCUP_RALSO      RPVRSEADVAALSVPDM-ASLQYVFDAVSEIRRALVQDGRQRVPLIGFSGSPWTLACYMV
DCUP_XANAC      HPVRDAAAIHRLGVPDMETELRYVMDAVRVIRRELDG----SVPLIGFSGSPWTLACYMI
DCUP_XANCP      HPVRDADAIHRLGVPDMETELRYVMDAVRLIRRELDG----AVPLIGFSGSPWTLACYMI
DCUP_XYLFA      KPIRDAAAITQLAVPDMETELRYVMDAVRLIRKELDN----SVPLIGFSGSPWTLACYMI
DCUP_XYLFT      KPIRDAAAITQLAVPDMETELRYVMDAVRLIRKELDN----SVPLIGFSGSPWTLACYMI
DCUP_COXBU      NPVRSAQDVNRLQMPAVEEALSYLFDAIRLTVKALDH----RVPLIGFAGSPWTLACYMT
DCUP_WIGBR      NPISSISDMKNLNVPDPEKNLKYVLDSIKIICKELDK----KIPLIGFSGSPWTLACYMI
DCUP_CHLTE      PPIRSQADIDKLIDPDIDEKLGYVLDAIRLAKKELND----RVPLIGFSGAAWTLFTYAV
DCUP_SYNE7      PPIRTAEQVAAVHDLDPEEATPFIRPILETLRQEVGN----EAAVLGFAGAPWTLAAYAI
DCUP_SYNY3      PPIRTQAQVDQLHALDPESSLPFIKTILGTLRKEVGN----QSTVLGFVGAPWTLAAYAI
DCUP_NOSS1      APIRTQAQIEQLRPLEPEAALPFIKTILQALRQEVGN----QSTVLGFVGAPWTLAAYAV
DCUP_THEEB      PPIRTLEQVQHLHPLEPEAACPFIRPILATLRQEVGD----RAAVLGFAGAPWTLAAYAI
DCUP_BACAN      NPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLD-----VPLIGFSGAPFTLASYMI
DCUP_BACCR      NPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLD-----VPLIGFSGAPFTLASYMI
DCUP_BACHD      NPIQSYADVERLGTIQPEEDVPYVLDTIKLL-REQLT-----VPLISFAGAPFTLASYMI
DCUP_BACSU      QPIRSLADIEKLGQIDPEQDVPYVLETIKLLVNEQLN-----VPLIGFSGAPFTLASYMI
DCUP_STAAM      NPIKTIQDVEKLSQIDPERDVPYVLDTIKLLTEEKLN-----VPLIGFTGAPFTLASYMI
DCUP_STAES      NPIQTVKDVERLSQIDPKRDVPYVLDTIKLLTEEKLN-----VPLIGFTGAPFTLASYMI
DCUP_OCEIH      NPIRNLQDVEKLGVINPVSDVPYVLDTIRLLTEEQLE-----VPLIGFSGAPFTLASYMI
DCUP_LISIN      NPIRTFQDVEKLTIFKPEIEVPYVLDTIKLLADDMLD-----VPLIGFAGAPFTLASYMI
DCUP_LISMO      NPIRSFQDVEKLTIFKPEIEVPYVLDTIKLLADDMLD-----VPLIGFAGAPFTLASYMI
DCUP_DEIRA      NPINTPKDVDVLGVPATAETMPYTAESIRLLMPELNSR-G--IPLIGFVGAPFTLASYAI
DCUP_COREF      QPVRTRADIDNLPILD--HEVTEVSKGISIILDELTDTQ----ALIGFAGAPFTLASYLV
DCUP_CORGL      APVRSRGDVLNLPILE--GNVPEVEQGIGIILDELSDSQ----ALIGFAGAPFTLASYLV
DCUP_MYCLE      DPVRTATDIHAMKPLEP-QAIQPIFQAISLLVAALGDV-----PLIGFAGAPFTLASYLV
DCUP_MYCTU      DPVRTAADVAAMKPLDP-QAIQPVLVAASLLVAELGDV-----PLIGFAGAPFTLASYLV
DCUP_STRAW      KPIRTRADLAQLRDLTP-EDVSYVTEAIKLLTAELGET-----PLIGFAGAPFTLASYLV
DCUP_STRCO      EPIRTRADLARLRDLTP-EDVAYVTEAFGLLTRELGAT-----PLIGFAGAPFTLASYLV
DCUP_PICTO      GYIKNHD-MKDIIYFEESNFKYKIYDAIKIFKEKYHF------PLIGFSGGLITVLSYII
DCUP_THEAC      NNIEKSG-ISAVEEFDPSSFSHPVLKAISKYRERYAD------PLIGFAGGPVTLLSYII
DCUP_AQUAE      -KLSWSGKVSDLKKYDP-SQNAYVYEIIKRVKEAQDE-----VPVIGFAGAPFTLLSYLI
DCUP_CHLMU      PEIIYSPHQPFVFTEDPFSTFSFLIEAIQKLTKRLTV------PLIAFAASPFTLASYLI
DCUP_CHLTR      PEVSYSPHEPLIFTKDPQETFSFLLEAIQQLTKRLTV------PLIAFAASPFTLASYLI
DCUP_CHLCV      PQISFSPYEELIFTKDPQETFSYLLQAIKNLVKALDV------PLIAFAASPFTMASYLL
DCUP_CHLPN      PRIQFSPEQPFTFTSDPQTIFSYLLDAIRTLKQKLPV------PLIVFAASPFTLACYLI
                                                           ..: * .   *:  *  

DCUP_RICCN      EGKGKQDFKTSKKFIYENKILAEELLNFITEKTADHLINQAKSGADVLKLFDSWSGVLAE
DCUP_RICPR      EGKGKRDFRTSKKFIYENKILAKDLLNFITEKTSDYLINQVKSGVDLLKIFDSWSGVLAE
DCUP_ORITB      GYNSRNTPKFHEIKSNNKHELIVDSINILTKHTIDHLANQILAGADIVQIFDSWAGILPY
DCUP_NEOSM      EGGWDKTFLRTKEFINKRYHEFKEIISILTDATIQYLNKQLKHGADFIQIFESFAWAASS
DCUP_BRUME      AGHGTPDQAPARLFAYRFPEAFEKLLNDLADVSAEYLIEQLGAGADAVQIFDSWSGVLDE
DCUP_BRUSU      AGHGTPDQAPARLFAYRFPEAFEKLLNDLADVSAEYLIEQLGAGADAVQIFDSWSGVLDE
DCUP_RHILO      AGHGTPDQAPARLFAYREPAAFQHLLKVLADHSAAYLIRQIEAGADVVQIFDSWSGVLDD
DCUP_AGRFC      AGHGTPDQAPARLFGYQEPAAMEKLLALLAEVSADYLVAQIDAGADAVQIFDSWAGVLGE
DCUP_BRADU      AGHGTPDQAPARMMAYRHPDAFAKIIDVLVDNSIEYLLAQLAAGANALQIFDTWAGVLPP
DCUP_CAUVC      E-KGSSDRSGARTFAYQNPETLDALIQVLVDATIDYLAMQVDAGAQALKLFESWAEGLSE
DCUP_RHOCA      AGRGSKDQAAAHKFKDTDRAAFSALIDAVTVATIEYLSKQVEAGCEVVKLFDSWAGSLKG
DCUP_HELPY      EGEGSKSYAKSKKMLYSEPEVLKALLEKLSLELIEYLSLQIQAGVNAVMIFDSWASALEK
DCUP_HELPJ      EGEGSKSYAKSKKMLYSEPEVLKALLEKLSLELIEYLSLQIQAGVNAVMIFDSWASALEK
DCUP_CAMJE      EGSGSKNYAKCKKMLYQNPELLHKILNKLTQVLKLYLEEQIKAGANAIQIFDSWASALEY
DCUP_ECOLI      EGGSSKAFTVIKKMMYADPQALHALLDKLAKSVTLYLNAQIKAGAQAVMIFDTWGGVLTG
DCUP_ECO57      EGGSSKAFTVIKKMMYADPQALHALLDKLAKSVALYLNAQIKAGAQAVMIFDTWGGVLTG
DCUP_ECOL6      EGGSSKAFTVIKKMMYADPQALHALLDKLAKSVTLYLNAQIKAGAQAVMIFDTWGGVLTG
DCUP_SALTI      EGGSSKAFTVIKKMMYADPQALHLLLDKLAKSVTLYLNAQIKAGAQSVMIFDTWGGVLTG
DCUP_SALTY      EGGSSKAFTVIKKMMYADPQALHLLLDKLAKSVTLYLNAQIKAGAQSVMIFDTWGGVLTG
DCUP_YERPE      EGGSSKAFTKLKKMMYAEPQTLHLLLDKLADSVILYLNAQIKAGAQSVMIFDTWGGVLTG
DCUP_VIBPA      EGGSSKAFTKIKKMMYAEPQTLHLLLDKLADSVIDYLNAQIKAGAQSVMVFDTWGGVLTP
DCUP_VIBVU      EGGSSKAFTKIKKMMYAEPQTLHLLLDKLADSVIEYLNAQIKAGAQSVMVFDTWGGVLTP
DCUP_VIBCH      EGGSSKAFTKIKKMMYSEPTVLHALLDKLADSVISYLNAQIKAGAQAVMVFDTWGGVLTP
DCUP_PASMU      EGGSSKAFTKIKKMLYADPQLLHQLLDKLADAVILYLNAQIKAGAQSVMIFDTWGGVLGH
DCUP_SHEON      EGGSSKTFEKIKKMAYAEPAALHMLLDKLADSVTLYLNAQVANGAQSLMIFDSWGGALSH
DCUP_PSEPK      EGGSSKDFRKTKAMAYDNPQALHLLLDKLAQSVTSYLNGQILAGAQAVQIFDTWGGNLSA
DCUP_PSESM      EGGSSKDFRKSKAMLYDNPQAMHLLLDKLAQSVTSYLNGQILAGAQAVQIFDSWGGSLSS
DCUP_PSEAE      EGGSSKDFRKSKAMLYDNPKAMHALLDKLAQSVTSYLNGQIHAGAQAVQIFDSWGGSLSA
DCUP_NEIMA      EGGSSKEFRTIKTMMYSRPDLLHKILDTNAQAVTAYLNAQIDAGAQAVQIFDTWGGVLSD
DCUP_NEIMB      EGGGSKEFRTIKTMMYSRPDLLHKILDTNAQAVTAYLNAQIDAGAQAVQIFDTWGGVLSD
DCUP_NITEU      EGAGSSEFRQIKTMLYARPDLLHHILGVTAQAVTAYLNAQIEAGAQAVMIFDSWGGALSH
DCUP_RALSO      EGGGSDDFRTVKSMLYARPDLMHRILEINAAAVIDYLNAQIDAGAQAVMVFDTWGGALAD
DCUP_XANAC      EGGGSKEYARIKAMAFNAPELLHHLLNTVTDAVIAYLAAQRAAGAQALQVFDTWGGVLSP
DCUP_XANCP      EGGGSKEYARIKAMAFNAPQLLHHLLSTVTDAVIAYLSAQRAAGAQALQVFDTWGGVLSP
DCUP_XYLFA      EGGSSKEYAHIKAMAFNAPDVLHQLLNTVTNAVISYLAAQRAAGAQALQVFDTWGGILSP
DCUP_XYLFT      EGGSSKEYARIKAMAFNAPDVLHQLLNTVTDAVISYLAAQRAAGAQALQVFDTWGGILSP
DCUP_COXBU      EGQSSKTFLTARAMLYQQPDVFHTLLQKLTTLTIAYLNAQIKAGADVVMLFDTWGGLLTP
DCUP_WIGBR      EGKCNKIFSKIKKMIYQNSKELHFLLKKITNSIILYLNSQIIYGVNAIIIFDTWGGILTE
DCUP_CHLTE      EGGGSKNYTWAKKMMYREPKMAHQLLQKISDCISAYLVKQVEAGADAIQIFDSWASALSE
DCUP_SYNE7      EGKSSKTYANIKHLAFSEPTILHELLGKLADNIAIYLCHQIDCGAQVVQLFDSWAGQLSP
DCUP_SYNY3      EGKSSKDYKVIKQMAFSEPAILHSFLDKIAEAIAVYVRYQIDCGAQVVQLFDSWAGQLSP
DCUP_NOSS1      EGKGSKTYSIIKNMAFSDPTILHQLLSKLADAIAIYARYQIDSGAQVVQMFDSWAGQLSP
DCUP_THEEB      EGKSSKDYIQIKTMAYREPDLLHKFLNHLATAIADYLCYQIDCGAQVVQLFDSWAGQLSR
DCUP_BACAN      EGGPSRNYHNTKAFMYAEPKAWFALIDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNV
DCUP_BACCR      EGGPSRNYHNTKAFMYAEPKAWFALMDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNV
DCUP_BACHD      EGGPSKSYNKTKAFMYAEPKAWHLLMDKLGEMTITYVKAQIAAGAQAIQIFDSWVGTLNV
DCUP_BACSU      EGGPSKNYNKTKAFMYSMPDAWNLLMSKLADMIIVYVKAQIEAGAKAIQIFDSWVGALNQ
DCUP_STAAM      EGGPSKNYNFTKAMMYRDEATWFALMNHLVDVSVKYVTAQVEAGAELIQIFDSWVGALNV
DCUP_STAES      EGGPSKNYNFTKAMMYRDEETWFALMNHLVDISIDYVVAQVEAGAEIIQIFDSWVGALNV
DCUP_OCEIH      EGGPSKNYSKTKALMYREPETWFALMDKLSDMIISYVDAQVEAGAKAIQIFDSWVGSLNA
DCUP_LISIN      EGGPSKNYHQTKSFMYREPEVWAILMEKLGRMTANYLIAQINAGASAVQLFDSWVGALSR
DCUP_LISMO      EGGPSKNYHQTKSFMYREPEVWAILMEKLGRMTANYLIAQINAGASAVQLFDSWVGALSR
DCUP_DEIRA      EGKGSRNYEKTKRFMYAEPAAWARLMGKFESVLADYLTEQVKAGASAVQIFDSWVGALSV
DCUP_COREF      EGGPSKNHERTKAMIHAEPETWHALMERLVPTVVNFLKTQIDAGIDAMQLFDSWAGFLTE
DCUP_CORGL      EGGPSKNHEKTKAMMHGDPETWHALMARLVPTIVNSLKSQIDAGIDAVQLFDSWAGFLTE
DCUP_MYCLE      EGGPSRNHPRTKAMMLAEPASWHTLMDKLTDLTLGFLLGQIDAGVDAIQVFDSWAGTLSL
DCUP_MYCTU      EGGPSRHHAHVKAMMLAEPASWHALMAKLTDLTIAFLVGQIDAGVDAIQVFDSWAGALSP
DCUP_STRAW      EGGPSKNHEHTKALMYGDPQLWADLLDRLAEITSAFLKVQIEAGASAVQLFDSWVGALAP
DCUP_STRCO      EGGPSRNHEHTKALMYGDPQLWADLLDRLAGITAAFLKVQIEAGASAVQLFDSWVGALSP
DCUP_PICTO      AGGPDSNLNLTKRSMLSDDK-FNDYINIIKDMIIKYIRLQVRAGVDAIQIFDSWLGYLSP
DCUP_THEAC      SDGVDRDLFRVKRMMITEEKAYQAVMTRLTDMIIEFARMQISAGVDAFQIFDSWAGYLSP
DCUP_AQUAE      EGGASKDFKSTKLFMWENPKEYKRLMDILTETVLAYLKEQIKAGADVVQIFDSWVNNLSL
DCUP_CHLMU      EGGASKDCSKTIAFLYQYPDKFEALLNEIIKGTAIYLQLQVQAGASAVQLFESSSLRLPP
DCUP_CHLTR      EGGASRDYPKTIAFLYQYPDRFKALLDEITLGTATYLQMQVQAGAAAIQLFESSSLRLPP
DCUP_CHLCV      DGGASKDFPKTMAFLYQYPDKFDALLKKLTEGTVIYLKEQIHAGAAAIQLFESSSLRLPS
DCUP_CHLPN      DGGASKDFSKTMSFLYVYPEKFDQLISTIIEGTAIYLKTQMDAGAAAVQLFESSSLRLPS
                                         :             *   *   . :*::       

DCUP_RICCN      EEFTEFVIEPTKKIILKVKEVF--PKTPIIAFPKGAGLLYEKFIKEVPID-------VLA
DCUP_RICPR      DDFTEFVIEPTKKIILKVKEVF--VKTPIITFPKGAGLLYEKFIEEVPID-------ILA
DCUP_ORITB      QEFSEYVIKPTSNIVKTLKEKF--PHIKIIGFPKGAGKLYHKYTKETNVD-------GIS
DCUP_NEOSM      NEFKEFIVEPTRRIVSSI-------DVPVIGFPKGAGVSYLQYVKETSVD-------VIS
DCUP_BRUME      DCFERFCIRPVARIVQKVRAVY--PQARIIGFPKGAGMLYAGYREKTGVD-------MLG
DCUP_BRUSU      DCFERFCIRPVARIVQKVRAVY--PQARIIGFPKGAGMLYAGYREKTGVD-------MLG
DCUP_RHILO      ASFDQFCVWPVAEIVRQVQAVH--PDVPIIGFPKGAGARYRTYRQKTGVT-------GLG
DCUP_AGRFC      KEFEEYAIKPVARIIASVRARR--PSAKIIAFAKGAGYLLRDYRRKTGAN-------AIG
DCUP_BRADU      AEFARWSVEPTRRIVEGVRAKV--PDAKIIGFPRGAGAQLPGYVEATGVN-------GVS
DCUP_CAUVC      PLFDRLVTQPHIRIIEGLRARG--VTVPIIGFPRGAGTLVEDYAARTPVQ-------GVA
DCUP_RHOCA      QDFEDFAVEPARVITAEMKRRF--PGLPVIAFPREAGQGYIGFAEKTGAD-------CVA
DCUP_HELPY      EAYLKFSWDYLKKISKELKKRY--AHIPVILFPKGIG-AYLDSI-DGEFD-------VFG
DCUP_HELPJ      EAYLEFSWDYLKKISKELKKRY--AHIPVILFPKGIG-AYLDSI-DGEFD-------VFG
DCUP_CAMJE      DKFFEFSFNYMLEISNFIKSKY--PNIPVILFPKGIS-GYLDRI-DGNFD-------VFG
DCUP_ECOLI      RDYQQFSLYYMHKIVDGLLRENDGRRVPVTLFTKGGG-QWLEAMAETGCD-------ALG
DCUP_ECO57      RDYQQFSLYYMHKIVDGLLRENDGRRVPVTLFTKGGG-QWLEAMAETGCD-------ALG
DCUP_ECOL6      RDYQQFSLYYMHKIVDGLLRENDGRRVPVTLFTKGGG-QWLEAMAETGCD-------ALG
DCUP_SALTI      RDYQQFSLYYMHKIVDGLLRENDGRRVPVTLFTKGGG-QWLEAMAETGCD-------ALG
DCUP_SALTY      RDYQQFSLYYMHKIVDGLLRENDGRRVPVTLFTKGGG-QWLEAMAETGCD-------ALG
DCUP_YERPE      RDYHEFSLNYMHKIVDGLIRENEGRRVPVTLFTKGGG-PWLEAMAATGCD-------ALG
DCUP_VIBPA      RDYNLFSLQYMHKIVDGLIRENDGRRVPVTLFTKNGG-MWLEQIAATGCD-------AVG
DCUP_VIBVU      RDYNLFSLQYMHKIVDGLIRENDGRRVPVTLFTKNGG-MWLEQIAATGCD-------AVG
DCUP_VIBCH      RDYQQFSLQYMHKIVDGLIRENEGRRVPVTLFTKNGG-MWLEQIAATGCD-------AVG
DCUP_PASMU      REYLDFSLHYMHKIVAGLIRENEGRKVPVTLFTKGGG-MWLEAMAETGCD-------ALG
DCUP_SHEON      TAYREFSLRYMQKIVDGLTRFADGRQVPVTLFTKGGG-LWLEAMAETGCD-------ALG
DCUP_PSEPK      AAYQEFSLAYMRKIVSGLIREHEGRKVPVILFTKNGG-LWLESIAEAGAD-------ALG
DCUP_PSESM      AAYQEFSLAYMRKIVNGLIRENDGRKVPVIVFTKGGG-LWLESIAEIGAD-------TLG
DCUP_PSEAE      AAYQEFSLAYMRKIVDGLIREHDGRRVPVILFTKGGG-LWLESMAEVGAE-------ALG
DCUP_NEIMA      AAFKEFSLKYIRQIVAGLKRESEGRRVPVIVFAKGGG-LWLESMAQIGAD-------ALG
DCUP_NEIMB      AAFKEFSLKYIRQIVAGLKRESEGRRVPVIVFAKGGG-LWLESMAQIGAD-------ALG
DCUP_NITEU      AAYQEFSLRYMNQILDGLKREHNGDRIPNILFTKGGG-LWLESIMASGCD-------AIG
DCUP_RALSO      GIYQTFSLAYMARVVEGLRAGADGQRVPVILFTKGGG-LWLESMAQTGAD-------ALG
DCUP_XANAC      AMYREFSLPYLTRIARELERGDGAERTPLVLFGKGNG-AYVADLAASGAE-------AVG
DCUP_XANCP      AMYREFSLPYLTRIAQELERGSGEERTPLVLFGKGNG-AYVSELAASGAE-------AVG
DCUP_XYLFA      TMYRTFSLPYLTRIARELERGTGTERTPLVLFGKGNG-PYIAELAMSGTE-------AVG
DCUP_XYLFT      TMYRTFSLPYLTRIARELERGTGTEHTPLVLFGKGNG-PYIAELAMSGTE-------AVG
DCUP_COXBU      SLYRQFSLDYLSQIAAEVVRQKNGRKIPLIFFTKNGG-QWLESIANSGCD-------AVG
DCUP_WIGBR      EKYCEYSLHYMSLIIKNLFCKYKGNKIPVTIFTKNGG-QWIKKIAKSGCD-------VIA
DCUP_CHLTE      DDYREFALPYIKQNVAAVKAAY--PEIPVIAFAKDMN-TILSDIADCGAD-------AVG
DCUP_SYNE7      IDYDTFALPYQQRVFQQVKAKH--PEVPLILYISGSA-GVLERMGQSGCD-------IVS
DCUP_SYNY3      QDYDTFALPYQQKVVKLVKEIH--PDTPLILYISGSA-GILERMGKSGVD-------IVS
DCUP_NOSS1      QDYDTFALPYQQRVFQQIKQTH--PDTPLILLVSGSA-GVLERMGQSGAD-------IVT
DCUP_THEEB      QDYDTFAFPYQKQVIQQVKAVY--PDVPIILYINGSA-AIVDRMAATGVD-------IVS
DCUP_BACAN      ADYRVFIKPAMERIFAEVR----TMGVPMIMHGVGAAHLVNEWHDLPLD--------VVG
DCUP_BACCR      ADYRVFIKPAMERIFAEVR----KMGVPMIMHGVGAAHLVNEWHDLPLD--------VVG
DCUP_BACHD      QDYRVFVKPVMERTFSELQ----KEKVPLIMFGVGASHLVNEWNDLPLD--------VVG
DCUP_BACSU      ADYRTYIKPVMNRIFSELA----KENVPLIMFGVGASHLAGDWHDLPLD--------VVG
DCUP_STAAM      EDYRRYIKPHMIRLISEVKE---KHDVPVILFGVGASHLINEWNDLPID--------VLG
DCUP_STAES      KDYRYYIKPAMNKLISGIKA---YYDVPIILFGVGASHLINEWNDLPID--------VLG
DCUP_OCEIH      EDYRVFIKPVMTRIFSELR----RHEVPLITFGVGARHLLMEWNDLPVD--------VIG
DCUP_LISIN      ADYAQYIRPVIEMIVKEVKAV--HPTTPIIMQAVGASHLLAEWETMPLD--------VVG
DCUP_LISMO      ADYAEYIRPVIEMIVREVKAV--HPTTPIIMQAVGASHLLEEWETMPLD--------VVG
DCUP_DEIRA      YDYQTFVKPATAGLIERVK----KLGVPVIYFGTGATHLMPDMASLGSD--------VMG
DCUP_COREF      RDYTEHVLPYSTRILQEVE----QYQLPRIHFGVGTGELLGAMSRAGSE--------VMG
DCUP_CORGL      RDYTEFVLPYSTEILEEVG----KYQLPRIHFGVGTGELLGAMSKAGSE--------VMG
DCUP_MYCLE      SDYRQYVLPHSARIFATVA----EHGVPMTHFGVGTADLLGAMSAAVRSGEKPGHQAVVG
DCUP_MYCTU      IDYRQYVLPHSARVFAALG----EHGVPMTHFGVGTAELLGAMSEAVTAGERPGRGAVVG
DCUP_STRAW      ADYRRSVMPASTKVFQAVE----SYGVPRIHFGVGTGELLGLMGEAGAD--------VVG
DCUP_STRCO      ADYRRSVLPASRKVFEAVS----GYGVPRIHFGVGTGELLGLLGEAGAD--------VVG
DCUP_PICTO      QTYENYIKGHIEEILSEIN-------VPVIYFSTGTSSIIEKLSRLNVDY--------IS
DCUP_THEAC      GEYEHFVKPYVYDILQELSG-----SIPTIYFSTMTSSYVADMD-LPADF--------YS
DCUP_AQUAE      EDYGEYVYPYVNYLISELKDFS---DTPVIYFFRGSSSFIDLAVDYRADA--------LS
DCUP_CHLMU      SLFSKYVVSPNAKLIRLIKQR---ENPPVSLFCRCFYQEFLSLYATGADT--------LH
DCUP_CHLTR      HLFAKYVVAPNTKLIRQIKQT---GNPPISLFCRCFYQEFLSLYAIGADT--------LH
DCUP_CHLCV      ELFSRYVTAPNTQLISQLKQC---IASPISLFCRCFDENFLDLYSIGADT--------LH
DCUP_CHLPN      ALFTRYVTEPNRRLIAKLKE----QAIPVSLFCRCFEENFYTLQATQADT--------LH
                  :              :                                          

DCUP_RICCN      VDQMVPLEKMKE-WSDKVI----VQGNLDPVVLLT-NKEIIKEKTYKILQVMKG------
DCUP_RICPR      VDQMVPLEKMKE-WSNKVI----IQGNLDPVILLT-NKEIIKEKTYKILQAMKG------
DCUP_ORITB      CDYDLQLDEMLK-LQKNVL----VQGNLNPNTILSKNSKIIEESVIKIMDTLSN------
DCUP_NEOSM      TDHSLPLDWIADNLQTHAV----VQGNLDPYLLAF-NKKEALLQTERIVDAFSE------
DCUP_BRUME      LDWSVPLSFAAL-LQEEGA----VQGNLDPLRVVA-GGNALDEGVDAILERMGQ------
DCUP_BRUSU      LDWSVPLSFAAL-LQEEGA----VQGNLDPLRVVA-GGNALDEGVDAILERMGQ------
DCUP_RHILO      IDWTVPLAAAKD-LQRSGA----VQGNLDPLRLVA-GGKALSDGVEAILKALGD------
DCUP_AGRFC      LDWSVPLSFARD-LQKEGP----VQGNLDPMLMVA-GGKALQDGIDAVLQSLGQ------
DCUP_BRADU      IDWTAEPAFIRERVQSRVA----VQGNLDPLVLIT-GGAALDRAVDNVLANFAQ------
DCUP_CAUVC      LDTSASAKLGQT-IQKTKT----IQGALDPLLLRA-GGDALLKRVDEMLEQWNQ------
DCUP_RHOCA      IDNSVSPDWAAENVQKGKT---CVQGNLDPSYMVT-GGQELVEATKKVVAAFKN------
DCUP_HELPY      VDWGTPLTAAKKILGGKYV----LQGNLEPTRLYD-K-NALEEGVETILKVMGN------
DCUP_HELPJ      VDWGTPLTAAKKILGGKYV----LQGNLEPTRLYD-K-NALEEGVEKILKVMGN------
DCUP_CAMJE      VDWSTPLDLARDKLSHKYT----LQGNMEPCRLYD-K-NAIKEGVEKILKTMQN------
DCUP_ECOLI      LDWTTDIADARRRVGNKVA----LQGNMDPSMLYA-PPARIEEEVATILAGFGH------
DCUP_ECO57      LDWTTDIADARRRVGNKVA----LQGNMDPSMLYA-PPARIEEEVATILAGFGH------
DCUP_ECOL6      LDWTTDIADARRRVGNKVA----LQGNMDPSMLYA-PPARIEEEVASILAGFGH------
DCUP_SALTI      LDWTTDIADARRRVGHKVA----LQGNMDPSMLYA-PPARIEDEVATILAGFGQ------
DCUP_SALTY      LDWTTDIADARRRVGHKVA----LQGNMDPSMLYA-PPARIEDEVATILAGFGQ------
DCUP_YERPE      LDWTTDIADARRRVGDKVA----LQGNMDPSVLYA-PPARIEQEVSTILASFGQ------
DCUP_VIBPA      LDWTINIADAKARIGDKVA----LQGNMDPSMLYA-SPERIREEVAGILEGFGDA-----
DCUP_VIBVU      LDWTINIADAKARVGDKVA----LQGNMDPSMLYA-SHDRIREEVASILEGFGHG-----
DCUP_VIBCH      LDWTINIADAKARVGDKVA----LQGNMDPSILYA-PAPRIREEVASILAGFGQG-----
DCUP_PASMU      VDWTVNLAQAKARVGHKVA----LQGNMDPSVLYA-SPARIEQEVRSILADFGE------
DCUP_SHEON      LDWTVDIADARRRVGHKVA----LQGNMDPSMLYA-PIPRIEEEVGQILAGYGE------
DCUP_PSEPK      LDWTCEIGDARRRVGDKVA----LQGNMDPTVLYA-KPEAIRKEVARILASYGH------
DCUP_PSESM      LDWTCDIGEARQRVGNKVS----LQGNMDPTVLYA-RPEAIRQEVARILASYGS------
DCUP_PSEAE      LDWTCDIGSARARVGERVA----LQGNMDPSVLYA-NPAAIRAEVARILAAYGK------
DCUP_NEIMA      LDWTCNIGEARRRVGKQVA----LQGNFDPFALFG-TPESIRTEVARILADYGHG-----
DCUP_NEIMB      LDWTCNIGEARRRVGKQVA----LQGNFDPFALFG-TPESIRTEVARILADYGHG-----
DCUP_NITEU      LDWTIDIGEARRRTQDKVA----LQGNLDPAVLFS-SPEVIAAEAGKILASYGHG-----
DCUP_RALSO      VDWTVNLQLARVRTGGRVA----LQGNLDPTVLFA-EPDAIRAQVRRVLEDYAAGG---D
DCUP_XANAC      VDWTISLADAAQRAGGRVA----LQGNLDPATLYG-SPEAIRAEVGKTLDSYAQGNG-GS
DCUP_XANCP      VDWTISLADAAERAGGRVA----LQGNLDPATLYG-SPDAIRSEVGKTLDSYAYGNG-GS
DCUP_XYLFA      VDWTIELEDAARRSNGQVA----LQGNLDPATLYG-TPNNIAHEVQRTLDSYAAGNG-GS
DCUP_XYLFT      VDWTIELEDAARRSNGQVA----LQGNLDPATLYG-TPNNIAREVQRTLDSYAAGNG-GS
DCUP_COXBU      LDWTTDIGQARRRVGDRVA----LQGNLDPAILLS-NPESISTAAVDILKSYGQ------
DCUP_WIGBR      LDWSVDIEYARKQVNGKIA----IQGNMDPFELYG-SFSSIEEETNKILSKFGY------
DCUP_CHLTE      LGWNIDIAKARKELNDRVC----LQGNMDPTVLYG-TPEKIKSEAAKVLKQFGQHN---D
DCUP_SYNE7      VDWTVDLLDARRRLGPDIG----LQGNIDPGVLFG-SQDFIRDRILDTVRKAGN------
DCUP_SYNY3      VDWTVDMADARQRLGKEMK----VQGNMDPGVLFG-SQDFIKERILDTVRKAGQ------
DCUP_NOSS1      VDWTVDMADARARLGKQMK----VQGNLDPGVLYA-SKQFIRDRIIDTVRKAGN------
DCUP_THEEB      LDWTVDLGTIRQQFPPSVG----LQGNLDPVILFA-PQPVLKERSLAIIEAGRK------
DCUP_BACAN      LDWRLPIEEARARG-VH---KA-VQGNMDPSFLLA-PWSVIEEHVKGILDQGM------K
DCUP_BACCR      LDWRLPIEEARARG-VH---KA-VQGNMDPSFLLA-PWSVIEEHVKGILDQGM------K
DCUP_BACHD      LDWRLQIKEARELG-VT---KT-VQGNLDPAILLA-PWEVIEARAKEILDQGL------E
DCUP_BACSU      LDWRLGIDEARSKG-IT---KT-VQGNLDPSILLA-PWEVIEQKTKEILDQGM------E
DCUP_STAAM      LDWRTSINQAQQLG-VT---KT-LQGNLDPSILLA-PWNVIEERLKPILDQGM------E
DCUP_STAES      LDWRTTIKQADKMG-VN---KA-IQGNLDPSILLA-PWDVIESRLKDILNQGL------N
DCUP_OCEIH      LDWRTSINEAREMG-VT---KV-VQGNLDPAILLS-DWQTIEQRTKQILDQGM------Q
DCUP_LISIN      VDWRETITTARQKV-PT---KA-IQGNLDPSTLLA-PEKCIAE-TERILQEGI------L
DCUP_LISMO      VDWRETITSARKKV-PT---KA-IQGNLDPSTLLA-PEKCLKE-ANRILQEGV------L
DCUP_DEIRA      ADWRTPLDKAWDLIQPG---QS-IQGNLDPLLLQA-PWRELKHQTDRILHEAN------G
DCUP_COREF      VDWRVPLDKAAERIAAVSGPKV-LQGNLDPALLFA-GTEPLTREINRIKGEAAAAIAAGN
DCUP_CORGL      VDWRVPLDKAAERIAAVSGPKV-LQGNLDPALLFA-GRAPLTKEIERIKAEAQTAVDAGH
DCUP_MYCLE      VDWRTSLTDAAARVEPC---TA-LQGNLDPVVLLA-GWPAVERVARTVVDDGRRAVVAGA
DCUP_MYCTU      VDWRTPLTDAAARVVPG---TA-LQGNLDPAVVLA-GWPAVERAARAVVDDGRRAVDAGA
DCUP_STRAW      VDWRVPLDEAARRVGTG---KA-LQGNLDPAVLFS-TTEAVETKTREVLD-----AAAGL
DCUP_STRCO      VDWRVPLDEAARRVGPG---KA-LQGNLDPAVLFA-GREAVETKTREVLD-----AATGL
DCUP_PICTO      VDWRLDMKLARSMVN-KKG----LQGNLDPLIAAYNLRYALKETSDIINAA-GR------
DCUP_THEAC      IDWRIDMKRFSAEIPDEKG----IQGNLDPAIVNYD--YALHEASKIVEAASGR------
DCUP_AQUAE      VDWSVDIPELFKIYDKG------FQGNLEPAVLYA-SEEVIEEKTLGLLRRIPV------
DCUP_CHLMU      PDYHVELSEIYRQLGDPG----SIQGNFDPALLLL-PQDLLIAHLETYLAPLKQ------
DCUP_CHLTR      PDYHVELPEVYRQIHSPG----SIQGNFDPALLLL-PQDALIAHLEAYLAPLKQ------
DCUP_CHLCV      PDYHVNLNKIYKTVPQPG----SLQGNIDPTLFLL-PQDQLLAHLEKYLTTLKD------
DCUP_CHLPN      PDYHVDLHRIQKNLML------SLQGNLDPAIFLL-PQEKLLHYVEAFLVPLRT------
                 .                     .** ::*                              

DCUP_RICCN      -KNFIFNLGHGILPETPTENVEFLTEYVRLYEEKNSNSTF----
DCUP_RICPR      -KNFIFNLGHGILPETHPENVEFLTQYVRLYEQKNSNSTF----
DCUP_ORITB      -NRFIFNLGHGILPETPIKNVELIVKLVKNYHSSE---------
DCUP_NEOSM      -KNFIFNLGHGIYKETPLSSVEAVLDFIRARN------------
DCUP_BRUME      -GPLVFNLGHGITPQAPIENVQRMIDRVRGGKS-----------
DCUP_BRUSU      -GPLVFNLGHGITPQAPIENVQRMIDRVRGGKS-----------
DCUP_RHILO      -GPLIFNLGHGITPETPIAHVEAMVKQVRSAAR-----------
DCUP_AGRFC      -GPLIFNLGHGITPQADPENVTRLVQRVRSVGGAG---------
DCUP_BRADU      -GRFIFNLGHGIQPETPIAHVEQMLKRVRG--------------
DCUP_CAUVC      -GPYIFNLGHGILPDTPIAHVEAVLERVTGQKVGQ---------
DCUP_RHOCA      -GPHIFNLGHGITPEANPDNVTLLMETIRKG-------------
DCUP_HELPY      -QGHIFNLGHGMLPDLPRENAKYLVQLVHAKTRR----------
DCUP_HELPJ      -QGHIFNLGHGMLPDLPRENAKYLVQLVHAKTRR----------
DCUP_CAMJE      -KAHIFNLGHGILPDIPVENAKYFIKLVQESSAK----------
DCUP_ECOLI      GEGHVFNLGHGIHQDVPPEHAGVFVEAVHRLSEQYHR-------
DCUP_ECO57      GEGHVFNLGHGIHQDVPPEHAGVFVEAVHRLSEQYHR-------
DCUP_ECOL6      GEGHVFNLGHGIHQDVPPEHAGVFVEAVHRLSEQYHR-------
DCUP_SALTI      GEGHVFNLGHGIHQDVPPEHAGAFVEAVHRLSAQYHN-------
DCUP_SALTY      GEGHVFNLGHGIHQDVPPEHAGAFVEAVHRLSAQYHN-------
DCUP_YERPE      GEGHVFNLGHGIHQDVPPAHAGAFVNAVHALSRPYHQK------
DCUP_VIBPA      GTGHVFNLGHGIHLDVPPENAGVFVEAVHELSKPYHK-------
DCUP_VIBVU      GTGHVFNLGHGIHLDVPPENAGVFVEAVHELSKPYHQ-------
DCUP_VIBCH      GTGHVFNLGHGIHLDVPPENAGVFVEAVHELSKPYHP-------
DCUP_PASMU      GSGHVFNLGHGIHQDVPEQSPAVFVNAIHQFSQPYHK-------
DCUP_SHEON      GTGHVFNLGHGIHQHVDPEHAGAFIKAVHAQSKQYHK-------
DCUP_PSEPK      GTGHVFNLGHGITPEVDPEHAGAFINAVHELSAQYHQ-------
DCUP_PSESM      GTGHVFNLGHGITPEVDPANAGAFINAVHELSAQYHQ-------
DCUP_PSEAE      GTGHVFNLGHGITPEVDPAHAGAFFEAVHELSAQYHG-------
DCUP_NEIMA      -SGHVFNLGHGINQHADPEHAKILVDTVHELSRQYHGG------
DCUP_NEIMB      -SGHVFNLGHGINQHADPEHAKILVDTVHELSRQYHGG------
DCUP_NITEU      -HGHVFNLGHGISQFTPPENALALIEAVHAQSVRYHTD------
DCUP_RALSO      SDGHVFNLGHGISQFTPPESVAVLVDEVHTFSRALRTRLP----
DCUP_XANAC      REGHVFNLGHGMSPDMNPEHVGVLVEAVQTLSKR----------
DCUP_XANCP      REGHVFNLGHGMSPDMNPDHVGVLVEAVQTLSKR----------
DCUP_XYLFA      REGHVFNLGHGMTPGMDPDHVSALVEAVQRLSRR----------
DCUP_XYLFT      REGHVFNLGHGMTPGMNPDHVSALVEAVQRLSRR----------
DCUP_COXBU      GSGHVFNLGHGIDPSTPIENVAALVEAVQNFSIKNEKPISSYYR
DCUP_WIGBR      NSGHIFSLGHGIYKDTPPENVNFLIESVHNLSKKYHKKNRFKK-
DCUP_CHLTE      HSGHVFNLGHGILPDVDPANLKCLVEFVKEESAKYH--------
DCUP_SYNE7      -QRHILNLGHGILPGTPEDNARHFFETAKNLDQLLAASH-----
DCUP_SYNY3      -GGHIFNLGHGVLVGTPEDNVRFFFETAKQVDQLL---------
DCUP_NOSS1      -WGHILNLGHGVLPDTPEENVAFFFETAKQLNVLV---------
DCUP_THEEB      -GKYIFNLGHGVLQGTPEENVAFLFDWVKSLA------------
DCUP_BACAN      QPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK------
DCUP_BACCR      QPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK------
DCUP_BACHD      TPNFIFNLGHGVFPEVEPDTLKRLTAFVHEYSANN---------
DCUP_BACSU      SDGFIFNLGHGVFPDVSPEVLKKLTAFVHEYSQNKKMGQYS---
DCUP_STAAM      NGKHIFNLGHGVFPEVQPETLRKVSEFVHTYTQR----------
DCUP_STAES      RGKYIFNLGHGVFPEVKPETLRKVTEFVHNYTAK----------
DCUP_OCEIH      SGKHVFNLGHGVTPDIEPATLKKLTELVHNYSKQK---------
DCUP_LISIN      EPGYIFNLGHGVFPEVPPEMLKKLTKYIHERSEILLKKG-----
DCUP_LISMO      EPGYIFNLGHGVFPEVPPEMLKQLTNYIHERSEILLKKDDIK--
DCUP_DEIRA      RPGHIFNVGHGLLPETPQDMVHRLTDYVHEQTQR----------
DCUP_COREF      ATGHIFNLGHGVLPNTVAENITEAVSIIHAS-------------
DCUP_CORGL      ATGHIFNLGHGVLPNTVAEDITEAVSIIHS--------------
DCUP_MYCLE      A-GHVFNLGHGVLPETDPGVLSELVSFIHSL-------------
DCUP_MYCTU      A-GHIFNLGHGVLPESDPAVLADLVSLVHSL-------------
DCUP_STRAW      E-GHVFNLGHGVPPTTDPDALTRLVEYVHTQTAR----------
DCUP_STRCO      E-GHVFNLGHGVLPTTDPDALTRLVEYVHTQTTR----------
DCUP_PICTO      -SSYIFNLGHGVIPETPVENLKHIVNFVHNFNQ-----------
DCUP_THEAC      -DRYIFNTGHGLLPSTDPEKLKRLVEYVHSVNL-----------
DCUP_AQUAE      KTRYVFNLGHGLAPDMELEKVKYLVDLVKSFPLT----------
DCUP_CHLMU      QSHYIFNLGHGILPQTPLENVQAVVKCLTSISTS----------
DCUP_CHLTR      QSHYIFNLGHGILPQTPIENVQAVVSCLTSISTS----------
DCUP_CHLCV      QPNYIFNSGHGILPETPLENVQAAVLCLTSISTS----------
DCUP_CHLPN      YPNFIFNSGHGILPETPLENVQLVVSYVQRQL------------
                    ::. ***: