CLUSTAL format seed alignment for MF_00219

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRC_HELPJ            ------------------MEITLF----------------DPIDAHLHVREN-ALLKAVL
PYRC_HELPG            ------------------MEITLF----------------DPIDAHLHVRED-ALLKAVL
PYRC_HELPY            ------------------MEITLF----------------DPIDAHLHVREN-ALLKAVL
PYRC_HELAH            ------------------MEITLF----------------DPIDAHLHVREG-VLLKAVL
D3UHC9_HELM1          -----------------MQNFSLK----------------NPLDMHLHLREG-DMLASVL
PYRC_HELHP            ----------------MPQTLQLT----------------NPMDMHLHLREG-EMLSAIL
Q0PBP6_CAMJE          --------------------MKLK----------------NPLDMHLHLRDN-QMLELIA
A6Q4X5_NITSB          ------------------MQIRLE----------------SPLDMHLHLRDG-AMLQTVA
B9L714_NAUPA          -------------------MITLN----------------TPIDMHLHLREG-KMLRDVI
A9WK73_CHLAA          ------------------MTVTLF----------------APLDMHLHLREG-AMLRLVA
PYRC_ECOLI            -------------MTAPSQVLKIR----------------RPDDWHLHLRDG-DMLKTVV
PYRC_ECO57            -------------MTAPSQVLKIR----------------RPDDWHLHLRDG-DMLKTVV
PYRC_SALTY            -------------MTAPSQVLKIR----------------RPDDWHVHLRDG-DMLKTVV
PYRC_SALTI            -------------MTAPSQVLKIR----------------RPDDWHVHLRDG-DMLKTVV
PYRC_YERPE            -------------MTAQPQTLKIR----------------RPDDWHIHLRDD-EMLSTVL
PYRC_YERP3            -------------MTAQPQTLKIR----------------RPDDWHIHLRDD-EMLSTVL
PYRC_PHOLL            -------------MTTESYTIKIR----------------RPDDWHIHFRDG-EMLRTVV
Q1LT32_BAUCH          -MSSHVIQYYFMKKLQQPILIKIR----------------RPDDWHVHLRDN-DMLRTVL
PYRC_BUCAI            -------------MSKFVKKIKII----------------KPDDWHVHLRDN-EILNQVI
Q7V2B2_PROMP          -----------------MKELTIS----------------KPDDWHLHLREG-IVLKNII
PYRC_SYNPX            ----------------MAEQLTIT----------------APDDWHVHLRDE-EMLERVV
PYRC_SYNS9            ----------------MSDQIQLI----------------APDDWHVHLRDG-EMLKQVV
B1LXE7_METRJ          -MGVAELFPAERQEANPVDRITIR----------------RPDDWHIHLRDG-AMLKAVL
PYRC_RHIME            -----------------MQDLVIR----------------RPDDWHLHLRDG-GMLRGVI
PYRC_SINMW            -----------------MQHLVIR----------------RPDDWHLHLRDG-GMLRGVI
PYRC_SINFN            -----------------MQELVIR----------------RPDDWHLHLRDG-GVLRGVI
PYRC_AGRRK            -----------------MQKLTIR----------------RPDDWHLHLRDG-AMLEGVI
A0A0M6XW94_9RHOB      -----------------MDMLTIR----------------RPDDWHLHLRDG-DMLR-LV
C6BW20_DESAD          ----------------MNNEITII----------------RPDDWHLHLREG-EMLAAVL
PYRC_NEIMB            -----------------MQTLTI----------------IRPDDMHLHLRDG-DALKAVA
PYRC_NEIMA            -----------------MQTLTI----------------IRPDDMHLHLRDG-DALKAVA
PYRC_NEIM0            -----------------MQTLTI----------------IRPDDMHLHLRDG-DALKAVV
PYRC_SHESH            -----------------MTQITL----------------LTPDDWHLHFRDG-DMLKETV
PYRC_SHEWM            -----------------MTQITL----------------LTPDDWHLHFRDG-DMLQETV
PYRC_PSEFS            ----------------MSDRLTL----------------LRPDDWHIHLRDG-AALPHTV
PYRC_PSEAE            ----------------MSDRLTL----------------LRPDDWHIHLRDG-AALANTV
PYRC_RALSO            ----------------MIDTLTI----------------VRPDDWHLHLRDG-DALADVV
PYRC_SYNY3            -----------------MEKLTI----------------TRPDDWHLHLRDG-AALKAVL
PYRC_VIBCH            -----------------MTTLTI----------------TRPDDWHVHLRDG-DVLADTV
B7FWU0_PHATC          -------MAISSAEAASGTRLTI----------------RLPDDFHHHCRDG-AKTAAVL
V9EGN6_PHYPR          MWLAAIRNSVSTSSRASASRFLSFCSVTMSSQTEIKWVGARPDDLHHHLRDGDAALSRTV
A5EV85_DICNV          -----------------MQTLVLP----------------RFDDMHTHVRDN-VFLTRTV
A0A0W0ZT49_9GAMM      -----------------MQTLMIN----------------RPDDWHVHLRDN-EMLHHTV
E0RQD1_SPITD          --------------------------------------------MHLHLRQG-AQLVAYA
L0DQ53_SINAD          ------------------MILNIR----------------RPDDFHVHLRDG-EMLRKVV
PYRC_YEAST            ----------------MVQEIDLG----------------LTCDMHVHVREGAMCELVTP
PYRC_USTMA            ---------------MSVQEITIP----------------APADFHVHLRQGKMSELVTP
PYRC_SCHPO            ------------------MSLKIP----------------GLADMHVHLRQDNMLKAVVP
Q7RGQ3_PLAYO          ----------------MENGFSIP----------------LADDMHCHLRQDEMLKFTVP
A5K330_PLAVS          -----------------MEPLHLP----------------LGDDMHCHLRQGDMLRFTVG
Q8IKA9_PLAF7          ----------------MKNYFYIP----------------IADDMHCHLRQGDMLDFTVN
Q4U8H2_THEAN          --------------------MQFL----------------YADDLHCHLRQGELMKKVVK
                                                                   * * *:         

PYRC_HELPJ            EYSSEPFSAAVIMPNLSKPLIDTPITLEYEEEILKN-------------SSNFKPLMSLY
PYRC_HELPG            RYSSEPFSAAVIMPNLSKPLIDTPTTLEYEEEILKN-------------SSNFKPLMSLY
PYRC_HELPY            GYSSEPFSAAVIMPNLSKPLIDTPTTLEYEEEILNH-------------SSNFKPLMSLY
PYRC_HELAH            KYSSEPFSAAVIMPNLSKPLIDTQITLEYEGEILKN-------------SSNFKPLMSLY
D3UHC9_HELM1          PYTSKSFAAGVIMPNLKTPVCTTKDAKNYESQIRAL-------------APDFQPLMTLY
PYRC_HELHP            PFSANPFSAAVVMPNLKTPITTTAQALAYKRQILSLC------------STSFEPLMSIF
Q0PBP6_CAMJE          PLSARDFCAAVIMPNLIPPLCNLEDLKAYKMRILKAC-----------KDENFTPLMTLF
A6Q4X5_NITSB          PLSAKSFSGAIVMPNLVPPITDIEMVQSYKKRIEEAI-----------GEERFEAYMTLF
B9L714_NAUPA          PYTYNQFAAAVVMPNLVPPVDNKERLESYRDEILQNS-----------EN--FTPLMNVF
A9WK73_CHLAA          PFSAAQFAGAVIMPNLVPPVDNADRLARYHEEIRAAV-----------DPYPFLPLMTLF
PYRC_ECOLI            PYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILD---AVPAGH-------DFTPLMTCY
PYRC_ECO57            PYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILH---AVPAGH-------DFTPLMTCY
PYRC_SALTY            PYTSEIYGRAIVMPNLASPITTVDAAIAYRQRILD---AVPAGH-------DFTPLMTCY
PYRC_SALTI            PYTSEIYGRAIVMPNLASPITTVDAAIAYRQRILD---AVPAGH-------DFTPLMTCY
PYRC_YERPE            PYTSEVFARAIVMPNLAQPITTVASAIAYRERILA---AVPAGH-------KFTPLMTCY
PYRC_YERP3            PYTSEVFARAIVMPNLAQPITTVASAIAYRERILA---AVPVGH-------KFTPLMTCY
PYRC_PHOLL            PYTSHYFGRAIVMPNLLTPITEVVSAKAYRGRILA---AIPEGD-------NFQPLMTCY
Q1LT32_BAUCH          PYTSRYFGRAIIMPNIIPPVTTINQAKAYRKRIIDIATQLPNKH-------QFKPLMTCY
PYRC_BUCAI            KYTGKFYKRAVIMPNLNSPITSCLKSIAYRNRILK---SMHLNY-------KFKPLMTCY
Q7V2B2_PROMP          RFTSQYFGRAIVMPNTKNPITSIEKCISYKNSIFE---ALSNNS-------TFEPLMTIY
PYRC_SYNPX            AYTARCFRRAIVMPNLRPPVTTVDAARSYRDRILS---ACPEGV-------AFTPLMTAY
PYRC_SYNS9            PYTAQMFRRAIVMPNLRPPVVTVEAAKAYRDQIVA---ACHPNW-------GFTPLMTAY
B1LXE7_METRJ          PYTAAQFARGIIMPNLVPPVTTVAAAQAYRERILA---ALPEGQ-------DFTPLMTCY
PYRC_RHIME            ADTSRHFARAIIMPNLVPPVVTSADAAAYRERILA---AIPAGD-------RFEPLMTLY
PYRC_SINMW            ADTSRHFARAIIMPNLVPPVVTSADAATYRERILA---AIPAGH-------RFEPLMTLY
PYRC_SINFN            GDTSRHFARAIVMPNLVPPVVTSADAAAYRQRILA---AIPAGD-------RFEPLMTLY
PYRC_AGRRK            GDTSRHFARAIIMPNLVPPVVTTADATAYRERILK---ALPAGD-------RFQPLMTLY
A0A0M6XW94_9RHOB      APQSRHFARAIVMPNLVPPVVTGAQAAAYRDRVVA---AGFA-----------RPLMTLY
C6BW20_DESAD          PSSAKIYGRAIVMPNLTVPVTTAKQAEEYRRRIID---ARPEGS-------NFEPLMTCY
PYRC_NEIMB            PYTARQMGRAVIMPNLKPPVVSVADALAYKARIMA---ALPEGS-------AFEPLMTLY
PYRC_NEIMA            PYTARQMGRAVIMPNLKPPVVSVADALAYKARIMA---ALPEGS-------AFEPLMTLY
PYRC_NEIM0            PYTARQMGRAVIMPNLKPPVVSVADALAYKARIMA---ALPEGS-------AFEPLMTLY
PYRC_SHESH            PATARLFQRAIVMPNLLPPVTDAKMVIEYRERILA---ARPEGS-------DFEPLMTLF
PYRC_SHEWM            PATARLFQRAIVMPNLLPPVTDAKLASAYRERILA---ARPEGS-------SFEPLMTIF
PYRC_PSEFS            ADVARTFGRAIIMPNLVPPVRNAEQADAYRQRILA---ARPAGS-------RFEPLMVLY
PYRC_PSEAE            GDAARTFGRAIVMPNLVPPVRNAAEADAYRQRILA---ARPAAS-------RFEPLMVLY
PYRC_RALSO            GDTARQFGRAIIMPNLKPPVTTTAQARAYRERILA---ALPAGT-------RFEPLMTLY
PYRC_SYNY3            PHTVRQFARAIVMPNLKPPVRSVADAAAYRERILA---AIPAGG-------QFEPLMTLY
PYRC_VIBCH            RDISRYNGRALIMPNTVPPVTTTEMALAYRERIMA---AQPQA--------HFEPLMALY
B7FWU0_PHATC          HHAVQRFGYCLMMPNLQPPVTTTEMALNYKSHIMA---SMPEGSFP-----YFKPVMTLY
V9EGN6_PHYPR          THVTSQFARCIVMPNLVPPVTTTEQALAYRERIMA---HVPEEKREPNSPNGFEPLMTLY
A5EV85_DICNV          RDIAAWAGRAVIMPNLVPAIDTISAVEQYRRRIEA---HLPPES-------EFTPLMTLY
A0A0W0ZT49_9GAMM      ADSAQHFARALVMPNLKPALTTLASINEYRNRILT---ALPKDN-------TFEPYMTFY
E0RQD1_SPITD          RDAARSFARGLVMPNTLPPLASPESVRAYGRQIEEAA-------------PGFTPLLTFK
L0DQ53_SINAD          NHTSKHFERALVMPNVPPIDTGPQASDLRNRISKCSE-------------FEFQPLMTIR
PYRC_YEAST            KIRDGGVSIAYIMPNLQPPITTLDRVIEYKKTLQKLA-------------PKTTFLMSFY
PYRC_USTMA            HVAEGGVSLAYVMPNLVPPITSTQQAMEYLERLRALA-------------PQTMFVGTLY
PYRC_SCHPO            TVAEGGVSVAYVMPNLIPPITTVDACLQYKKEIEQLD-------------SKTTYLMSLY
Q7RGQ3_PLAYO          AIKKGGCNRVLVMPNTTPIISSCEEAKKYRDELIKYD-------------NSIEYLMTLY
A5K330_PLAVS          AVKQGGCDRVLVMPNITPIVSTCEDAKKYRSELTKQD-------------PSVDYLMTLY
Q8IKA9_PLAF7          SIRRGGCNRVLVMPNTHPIISTCSDAQKYLYQLKSRD-------------DDIEYLMTLY
Q4U8H2_THEAN          YIRKGGCNRVLVMPNTVPEITSCSQALEYRKRLLELD-------------PNVDYLMTLY
                                 :***                                             

PYRC_HELPJ            FNDGLTLEELQRAKNKG-IKFLKLYPKGMTTNA------QNGTSDLLGEKTLEVLENAQK
PYRC_HELPG            FNDGLTLEELQRAQEKG-IRFLKLYPKGMTTNA------QNGTSDLLGEKTLEILENAQK
PYRC_HELPY            FNDGLTLEELQCAKEKG-VRFLKLYPKGMTTNA------QNGTSDLLGEKTLEVLENAQK
PYRC_HELAH            FNDGLTLEELQHAKHQG-IKFLKLYPKGMTTNA------QNGTSDLLGEKTLEILEDAQK
D3UHC9_HELM1          ITQGLHAKELEVARASS-YKILKLYPKGATTNS------SDGIQNILDAQVLEVLEIAQE
PYRC_HELHP            LTPDLDKQELIRAKEAG-IHILKLYPKGSTTGS------EKGVKEMLCEKTLHIFEIAQE
Q0PBP6_CAMJE          FK-NYDEKFLYSAKDE--IFGIKLYPAGITTNS------NGGVSSFDIEYLKPTLEAMSD
A6Q4X5_NITSB          FKPSYSYDFLYQARPY--ITAIKLYPAGITTNS------QDGVDNFSIDALAPTLEAMSE
B9L714_NAUPA          MR-EYTKEELEDLKND--IFAIKLYPAGITTNS------EAGVK--SIENVYPVLEIMQE
A9WK73_CHLAA          FR-PYDAQTLQALREH--IFAIKLYPEGVTTNS------AGGVS--DLTAIEPTLAMMEE
PYRC_ECOLI            LTDSLDPNELERGFNEGVFTAAKLYPANATTNS------SHGV--TSIDAIMPVLERMEK
PYRC_ECO57            LTDSLDPNELERGFNEGVFTAAKLYPANATTNS------SHGV--TSVDAIMPVLERMEK
PYRC_SALTY            LTDSLDADELERGFHEGVFTAAKLYPANATTNS------SHGV--TSVDAIMPVLERMEK
PYRC_SALTI            LTDSLDADELERGFHEGVFTAAKLYPANATTNS------SHGV--TSVDAIMPVLERMEK
PYRC_YERPE            LTNSLDAKELTTGFEQGVFTAAKLYPANATTNS------THGV--SDIPAIYPLFEQMQK
PYRC_YERP3            LTNSLDVKELTTGFEQGVFTAAKLYPANATTNS------THGV--SDIPAIYPLFEQMQK
PYRC_PHOLL            LTDTTESSQIEIGYKEGIFTACKLYPANATTNS------SHGV--SDIKNIYPLLAVMEK
Q1LT32_BAUCH          ITESSKNWELIEGYRQKIFTAAKLYPAYATTNT------QHGV--TNITTIYPLLSTMQD
PYRC_BUCAI            LTNSTSPKELEFGFSKKIFVAAKFYPNGCTTNS------KTGI--KKISDITPVLECMEK
Q7V2B2_PROMP          LTDETIKHELVEGFKNKVFFAAKLYPANATTNS------RHGV--KKIENLYEIFEVMQE
PYRC_SYNPX            LTDNSDPDDLERGFQEGVYTAAKLYPANATTNS------AAGV--TDLDQIGRVLSRMEA
PYRC_SYNS9            LTDDIAPEEIERGFHEGVFTAAKLYPANATTNS------AAGV--TELRHIHGVLLVMER
B1LXE7_METRJ          LRDDTDPDEIERGFGEKVWVAAKLYPAGATTNS------HAGV--TDLNGIAPVLERMER
PYRC_RHIME            LTEGTDPGDVEAGFRSGLVKAVKLYPAGATTNS------SSGV--RDIDKAMPVLERMAE
PYRC_SINMW            LTEGTDPDDVEEGFRSGLVKAVKLYPAGATTNS------SSGV--RDIDKAMPVLERMAE
PYRC_SINFN            LTEGTDPDDVEAGYGSGLVKAVKLYPAGATTNS------HSGV--RDIAKAMPVLERMAE
PYRC_AGRRK            LTEHTNPDDVEEGKKSGLITAVKLYPAGATTNS------HGGV--RNLDKAMPTLERMAK
A0A0M6XW94_9RHOB      LTEETDPADVVAAHRDGIITAVKLYPAGATTNS------ASGV--SDFARVRPVFDAMEK
C6BW20_DESAD          LTDSTSAEDIHTAYAVKAFHAVKLFPAGATTNS------DNGV--TDIKKVYSVLEAMQE
PYRC_NEIMB            LTDNATPELVREAKAAG-IVAFKLYPAGATTNS------DSGV--TDLFKLIPVLEEMAK
PYRC_NEIMA            LTDQATPALVREAKAAG-IVAFKLYPAGATTNS------DSGV--TDLFKLIPVLEEMAK
PYRC_NEIM0            LTDNATSELVREAKAAG-IVAFKLYPAGATTNS------DSGV--TDLFKLIPVLEEMAK
PYRC_SHESH            LTNDTTEQDIIDAKAAG-VVAAKLYPAGATTNS------DAAV--KALDALFPIFEKMAE
PYRC_SHEWM            LTNDTSKQDIIDAKAAG-VVAAKLYPAGATTNS------DAAV--KGLDALFPIFETMAE
PYRC_PSEFS            LTDRTQPEEIREAKASGFVHAAKLYPAGATTNS------DSGV--TSIDKILPAIEAMAE
PYRC_PSEAE            LTDRTSTEEIRTAKASGFVHAAKLYPAGATTNS------DSGV--TRIDNIFEALEAMAE
PYRC_RALSO            LTDNTTPEEVRAARASGFVHGVKLYPAGATTNS------DAGV--TDLRRCAKTLEAMQD
PYRC_SYNY3            LTDNTNPEEIIAAKASQFVKAVKYYPAGATTNS------DFGV--TDIHRCDAVLAAMEQ
PYRC_VIBCH            LTDNTSPEEIRKAKASGKVVAAKLYPAGATTNS------DSGV--TSAKNIYPVLQAMQE
B7FWU0_PHATC          LTDKTTPDEIKKASSSG-VVGCKFYPAGATTNS------ALGV--TDIKNCYPALQEMSD
V9EGN6_PHYPR          MTDGTTADEIRRAAETKKIFAVKLYPAGATTNS------DSGV--TKIDNIYPALEAMAD
A5EV85_DICNV          LSANLTIDSIQQAKNAG-VVAVKWYPKGATTHS------AQGI--AQIHAFYPLLEAMQK
A0A0W0ZT49_9GAMM      LNDSVNAEELHHAANTSYILGAKLYPAGATTNS------EAGA--KSLKDLYPLFEVLQN
E0RQD1_SPITD          ILPHMDAGLVRSLKEAG-AVAGKLYPEGVTTHA------EDGV--RDVEGLFPVFEAMAE
L0DQ53_SINAD          LTERTTPATIHEAKEHG-VVAAKVYPQGVTTGS------HGGVTVEQLRGLGDTFAAMEQ
PYRC_YEAST            LSKDLTPDLIHEAAQQHAIRGVKCYPAGVTTNS------AAGVDPNDFSAFYPIFKAMQE
PYRC_USTMA            LSPDLTPAEIAKAAQ-NGVRGVKSYPRGVTTNS------DSGIE--DYETYYPIFEEMQK
PYRC_SCHPO            LSPETTPEVIYEAAK-KGIRGVKSYPKGATTNS------ESGVE--SYEPFYPTFAAMQE
Q7RGQ3_PLAYO          LNKKTDENDILNNYKECNLQGIKIYPSNVTTNS------NDGVS--NLEPYYKIFSTLEK
A5K330_PLAVS          LNNKTDANDILRNHEECNLQGVKIYPSNVTTNS------SHGVT--TLETYYEIFHTLER
Q8IKA9_PLAF7          LNKNTDENDILSNYYKCNLQGVKIYPSNVTTNS------SDGIT--SLEPYYKVFHALEK
Q4U8H2_THEAN          LTDELSVEDLKNNAKKCHVQGVKCYPLGVTTNSDRSFEVTNRNK--SFEKYYPVFSEMEK
                      :        :            * :*   ** :                     :     

PYRC_HELPJ            LGFILCVHAEQAGFCLDK---------EFLCHSVLETFALSFPKLKIIIEHLSDWRSIAL
PYRC_HELPG            LGFILCIHAEQAGFCLDK---------EFLCHSVLETFALSFPKLKIIIEHLSDWRSIAL
PYRC_HELPY            LGFILCIHAEQTGFCLDK---------EFLCHSVLETFALSFPKLKIIIEHLSDWRSIAL
PYRC_HELAH            LGFILCIHAEQAGFCLDK---------EFLCHSVLETFAHSFPKLKIIIEHLSDWRSIAL
D3UHC9_HELM1          LGFILSIHGESNGFSMDR---------EYEFASVFTTLAKCYPKLKIIIEHMSDHRSIRL
PYRC_HELHP            LGFILSIHGESNGFCMER---------EYEFLPIFAHIAQHFPRLRIIIEHMSDRRSLEL
Q0PBP6_CAMJE          LNIPLLVHGETNDFVMDR---------ESNFAKIYEKLAKHFPRLKIVMEHITTKTLCEL
A6Q4X5_NITSB          LGIPLCVHGETNGFVMDR---------EAEFIPIYEKIARKFPNLKIIMEHITTKEAVDA
B9L714_NAUPA          LGIPLSVHGETNGFVLDR---------EREFAVVYEKLARDFPNLKIIMEHISTYNLVDL
A9WK73_CHLAA          LGIPLLVHGESHGFVLDR---------EAEFLPVYERWARTFPRLRIVMEHITTAAALDL
PYRC_ECOLI            IGMPLLVHGEVTHADIDIF-----DREARFIESVMEPLRQRLTALKVVFEHITTKDAADY
PYRC_ECO57            IGMPLLVHGEVTHADIDIF-----DREARFIESVMEPLRQRLTALKVVFEHITTKDAADY
PYRC_SALTY            LGIPLLVHGEVTHADVDIF-----DREARFIDTVMEPLRQRLTALKVVFEHITTKDAAQY
PYRC_SALTI            LGMPLLVHGEVTHADVDIF-----DREARFIDTVMEPLRQRLTALKVVFEHITTKDAAQY
PYRC_YERPE            IGMPLLIHGEVTDAAVDIF-----DREARFIDQILEPIRQKFPELKIVFEHITTKDAADY
PYRC_YERP3            IGMPLLIHGEVTDAAVDIF-----DREARFIDQILEPIRQKFPELKIVFEHITTKDAADY
PYRC_PHOLL            LGMPLLVHGEVTASHIDIF-----DREARFIEQVMEPLRNQFPALKVVFEHITTKEAAQY
Q1LT32_BAUCH          IGMPLLVHGEVTNPEIDIF-----DREAVFIDQILEPLRRIFPALKIVFEHITTKEAVDY
PYRC_BUCAI            IGMPLLIHGEEINQNIDIY-----DREAKFIEKTLDPLRKKFPKLKIVLEHITTKESVEY
Q7V2B2_PROMP          LGMPLLIHGEVTDPEVDIF-----DREEVFIDKELSPLIQQFPRLKIVLEHITTSYAVDF
PYRC_SYNPX            IGMPLLIHGEVTDADVDVF-----DREAVFIERHLKSLRTRHPELKVVFEHITTEQAVDY
PYRC_SYNS9            IGMPLLIHGEVTDVDVDVF-----DREAVFIERSLKPIRDRYPGLKVVLEHITTEQAVDF
B1LXE7_METRJ          IGMPLLIHGEATDPEIDIF-----DREAAFMEGSLIPLLGRHQGLKVTVEHATTAEILDV
PYRC_RHIME            IGLPLCVHGEVTTAEVDIF-----DREAVFIETVLDPLRRRLPDLRITMEHVTTKDGVDY
PYRC_SINMW            VGVPLCVHGEVTTADVDIF-----DREAVFIETVLDPLRRRLPDLRITMEHVTTKDGVDY
PYRC_SINFN            IGMPLCVHGEVTTPEVDIF-----DREAVFIETVLDPLRRRLPDLRITMEHVTTKDGVDY
PYRC_AGRRK            IGLPLCVHGEVTTPEVDIF-----DREAVFIETVLDPLRQRLPELKVTMEHVTTSDGIDY
A0A0M6XW94_9RHOB      AGVPLCLHGEVTDPSVDIF-----DREAAFLDRVLTPLRDAHPALKLTLEHVTTSDAVDW
C6BW20_DESAD          IGMPLSVHGEVTDPEVDVF-----DREAVFIDRVLKPVRENFPELKIIFEHLTSKAGVDY
PYRC_NEIMB            QGILFLVHGEVTDPEIDIF-----DREAAFIGRVMKPVLAQVPNLKVVFEHITTAEAARL
PYRC_NEIMA            QGILFLVHGEVTDPEIDIF-----DREAAFIGRVMKPVLAQVPNLKVVFEHITTAEAARL
PYRC_NEIM0            QGILFLVHGEVTDPEIDIF-----DREAAFIGRVMKPVLAQVPNLKVVFEHITTAEAARL
PYRC_SHESH            VGMLLLVHGEVTESHIDIF-----DREALFIERNLRRIVDAFPTLKVVFEHITTKEAADF
PYRC_SHEWM            IGMLLLVHGEVTESHIDIF-----DREALFIERNLSRIVDAFPQLKVVFEHITTKEAAEF
PYRC_PSEFS            VGMPLLIHGEVTRGDVDVF-----DREKIFIDEHMRRVVELFPTLKVVFEHITTADAVQF
PYRC_PSEAE            VGMPLLVHGEVTRAEVDVF-----DREKQFIDEHLRRVVERFPTLKVVFEHITTGDAAQF
PYRC_RALSO            VGMPLLVHGEVTDPTVDIF-----DREAVFIDTVMQPLRRDFPALKVVFEHITTKHAAEY
PYRC_SYNY3            VDLPLLLHGEVTDSNIDIF-----DREKVFIEKYLIPLREKFPRLRVVLEHITTSDAVQF
PYRC_VIBCH            VGMLLLVHGEVTTHEVDIF-----DREKTFLDTVLAPIVNDFPQLKIVLEHITTADAVTF
B7FWU0_PHATC          QNMMLCIHSEVT--HADIF-----DREPVFIEEIMTPLVTDFPNLRISMEHISTKEAVDF
V9EGN6_PHYPR          VGMPLLVHGEVTDPSVDLF-----DREATFVEQVIKPLVAKFPQLKVVMEHITTKEAAEF
A5EV85_DICNV          AGLLLLIHGEVTDDDIDIF-----DREAVFIDRVLEPLRRDFPQLKMVLEHITTAAAVDY
A0A0W0ZT49_9GAMM      NNLVLQIHGEVT--HSDIF-----ERESLFIDEYLKPIVKNFPKLRIVLEHISTQSAVEY
E0RQD1_SPITD          EGLVLCIHAESPGAPVLER-----EAA---FHETFLRIHHAVPSLRIVFEHVSDARTVAL
L0DQ53_SINAD          SGMVLCWHGELPGPGWLTA-----EQR---MLPEMHRVVDGFPKLRQVMEHISTREGVEW
PYRC_YEAST            ENLVLNLHGEKPSVHDGDKEPIHVLNAEEAFLPALKKLHNDFPNLKIILEHCTSESAIKT
PYRC_USTMA            HDMVLNLHGELPSNADAG---ICVLNAEEKFLTHLFKIHGEFPKLKIVLEHATTRKAVEA
PYRC_SCHPO            TGMILNIHGEVPPSKDNT-----VFTAEPKFLPTLLDLHQRFPKLKIVLEHCTTADAVEA
Q7RGQ3_PLAYO          INKSLHIHCEEPN--------INPVYAEKEYLQHIHDISIKFPHLKIVLEHISTENMIEM
A5K330_PLAVS          LNKSLHIHCEEPN--------VNPLYAERSYAQHIHDLALHFPHLKIVLEHISTVDMINL
Q8IKA9_PLAF7          LNKSIHIHCEEPN--------INPLYAEEKYLPHIHDLAIKFPGLNIVLEHISSSESINV
Q4U8H2_THEAN          IGVSLHLHGELSG--------APPLTAEKDFLTPIENICRRFPSLKVVLEHVTSRESLEV
                          :  * *                                  *.  .** :       

PYRC_HELPJ            IEKHD---------NLYATLTLHHISMTLDDLLG---------------GSLDPHCFCKP
PYRC_HELPG            IEKHT---------NLYATLTLHHISMTLDDLLG---------------GSLNPHCFCKP
PYRC_HELPY            IEKHD---------NLYATLTLHHISMTLDDLLG---------------GSLNPHCFCKP
PYRC_HELAH            IEKHD---------NLYATLTLHHISMTLDDLLG---------------GSLNPHCFCKP
D3UHC9_HELM1          LEDFE---------NIFATLTLHHITMDLDDLLG---------------KNLSPHHFCKP
PYRC_HELHP            IEQYP---------NLYATLTLHHITMNLDDVLG---------------GGINPHHFCKP
Q0PBP6_CAMJE          LKDYE---------NLYATITLHHLIITLDDVIG---------------GKMNPHLFCKP
A6Q4X5_NITSB          LMQYE---------NLYATITLHHLYITLDDVAG---------------GLLQPHLFCKP
B9L714_NAUPA          LDKHD---------NLYATVTLHHLLLTLDDLIG---------------GALNPHNFCKP
A9WK73_CHLAA          LDRYP---------NLFATVTLHHLLITLDDVAG---------------GLLQPHLFCKP
PYRC_ECOLI            VRDGN--------ERLAATITPQHLMFNRNHMLV---------------GGVRPHLYCLP
PYRC_ECO57            VRDGN--------ERLAATITPQHLMFNRNHMLV---------------GGVRPHLYCLP
PYRC_SALTY            VRDGN--------DYLAATITPQHLMFNRNDMLV---------------GGIRPHLYCLP
PYRC_SALTI            VRDGS--------YNLAATITPQHLMFNRNDMLV---------------GGIRPHLYCLP
PYRC_YERPE            VLAGN--------RFLGATVTPQHLMFNRNHMLV---------------GGIRPHLFCLP
PYRC_YERP3            VLAGN--------RFLGATVTPQHLMFNRNHMLV---------------GGIRPHLFCLP
PYRC_PHOLL            VLEGN--------NNLAATLTPQHLMFNRNHMLV---------------GGIRPHLYCLP
Q1LT32_BAUCH          ILAGD--------RYLGATITPQHLIFNRNHMLV---------------DGIHPHLYCLP
PYRC_BUCAI            IKNNDV-------NYLSATITPHHLMLNRNDMFY---------------GGIQPYLYCLP
Q7V2B2_PROMP          VQR----------NNLGATITPHHLHINRNAMFF---------------GGLNSDFYCLP
PYRC_SYNPX            VGSSD--------RNLAATITPHHLQINRNSMFL---------------GGLRSDFYCLP
PYRC_SYNS9            VGSAD--------QNLAATITPHHLHINRNAMFA---------------GGLRSDFYCLP
B1LXE7_METRJ          VREHR--------SRCAATITPHHLVINRTHIFQ---------------GGLRPHLYCLP
PYRC_RHIME            IREHA--------ANLAGSITTHHLIINRNAILV---------------GGIKPHYYCLP
PYRC_SINMW            IREHA--------VNLAGSITTHHLIINRNAILV---------------GGIKPHYYCLP
PYRC_SINFN            IKEHA--------GNLAGSITTHHLIINRNAILV---------------GGIKPHYYCLP
PYRC_AGRRK            IKSAK--------ANLAGSITTHHLIINRNAILV---------------GGIRPHYYCLP
A0A0M6XW94_9RHOB      VRAHP--------GT-GATITVQHLMANRNDMLV---------------GGMRPHFYCLP
C6BW20_DESAD          VLEQD--------ENMVATITPHHLLLTRNDLFK---------------GGMNPYMYCLP
PYRC_NEIMB            VLEAG--------DNVAATVTPQHLLLNRNDLLV---------------GGVRPHHFCLP
PYRC_NEIMA            VLEAG--------DNVAATVTPQHLLLNRNDLLV---------------GGVRPHHFCLP
PYRC_NEIM0            VLEAG--------DNVAATVTPQHLLLNRNDLLV---------------GGVRPHHFCLP
PYRC_SHESH            VMSAS--------DNVAATITPQHLLLNRNDLLV---------------GGVRPHNFCLP
PYRC_SHEWM            VTSAS--------DNVAATITPQHLLLNRNDLLV---------------GGVRPHNFCLP
PYRC_PSEFS            VTEAS--------ANVGATITAHHLLYNRNHMLV---------------GGIRPHFYCLP
PYRC_PSEAE            VREAP--------ANVGATITAHHLLYNRNHMLV---------------GGIRPHFYCLP
PYRC_RALSO            VRDAQ--------GPVGATITAHHLLYNRNALFV---------------GGIRPHYYCLP
PYRC_SYNY3            VLSAN---------NIAATITPQHLLFSRNALFK---------------GGICPHFYCLP
PYRC_VIBCH            VQQAG--------DNVAATITAHHLLFNRNHMLV---------------GGIRPHFYCLP
B7FWU0_PHATC          VLSSP--------DNVKASITCHHLLYNRNHMLV---------------GGIRPHLYCLP
V9EGN6_PHYPR          VTNAP--------ANVAATITPQHLLYNRNAIFQ---------------GGLRPHKYCLP
A5EV85_DICNV          VMHAA--------CNLAATITPQHLLYNRNQLLV---------------GGLKPHYYCLP
A0A0W0ZT49_9GAMM      VTKAP--------ATVAATITPHHLLYNRNKLLV---------------GGLRPHYYCLP
E0RQD1_SPITD          IRTLPP-------DKVAGTITLHHLLFTLDDLLG---------------GRLNPHLFCKP
L0DQ53_SINAD          VRSCP--------DTVAGTITVHHLYLTLDDLGGRGRWG--------GGGQLHPHYFYSP
PYRC_YEAST            IEDINKNVKKATDVKVAATLTAHHLFLTIDDWA------------------GNPVNFCKP
PYRC_USTMA            V--------KQCGDTVGCTITPHHLELIVDDWA------------------GKPLNFCKP
PYRC_SCHPO            V--------KACGESVAGTITAHHLYLTQKDWQ------------------DDPYCFCKP
Q7RGQ3_PLAYO          V---------KKYPNVAGSITPHHLHLTIDDVVDIKNYDYSFNNTDIEKYVKNVYNYCKP
A5K330_PLAVS          V---------RTYPNIAGSVTPHHLQLTIDDVVDVESYDYAPDVVTIEKYIKNVYNYCKP
Q8IKA9_PLAF7          I---------KEFRNVAGSITPHHLYLTIDDVVNMDIYDHAIDNTYIEKYIKNTYHYCKP
Q4U8H2_THEAN          V---------KRLQNLSATVTPHHMRLTVSDVLNTTE---NVTLENITRHLKDPFAYCKP
                      :                 ::* :*:                               :  *

PYRC_HELPJ            LIKTKKDQERLLSLALKAHP-KISFGSDSAPHFI---SKKHSAN----------------
PYRC_HELPG            LIKTKKDQERLLSLALKAHP-KISFGSDSAPHFV---SKKHSAS----------------
PYRC_HELPY            LIKTKKDQERLLSLALKAHP-KISFGSDSAPHFI---SKKHSAN----------------
PYRC_HELAH            LIKTQKDQERLLSLALKAHP-KISFGSDSAPHVI---SKKHSAN----------------
D3UHC9_HELM1          ILKTKKDKEKLLELALSAHP-KVCFGSDSAPHLL---QSKLQ-N----------------
PYRC_HELHP            MLKTKKDQQALLQAALNAHP-KVSFGSDSAPHLE---SAKLNSK----------------
Q0PBP6_CAMJE          IAKRYEDKEALCELAFSGYE-KVMFGSDSAPHPK---DTKECCG----------------
A6Q4X5_NITSB          IAKRPEDRMALRKVAFMAHP-KVMFGSDSAPHPR---EKKEAPG----------------
B9L714_NAUPA          VVKTPKDRDALQEIVRSGHK-KVMFGSDSAPHSI---ENK--LK----------------
A9WK73_CHLAA          IAKRPTDRDALLAAALAGHP-KLMFGSDSAPHPI---DRKEAAF----------------
PYRC_ECOLI            ILKRNIHQQALRELVASGFN-RVFLGTDSAPHAR---HRKESSC----------------
PYRC_ECO57            ILKRNIHQQALRELVASGFN-RVFLGTDSAPHAR---HRKESSC----------------
PYRC_SALTY            ILKRNIHQQALRELVASGFT-RAFLGTDSAPHSR---HRKETSC----------------
PYRC_SALTI            ILKRNIHQQALRDLVASGFT-RAFLGTDSAPHSR---HRKETRC----------------
PYRC_YERPE            ILKRSTHQQALRAAVASGSD-RFFLGTDSAPHAK---HRKESSC----------------
PYRC_YERP3            ILKRSTHQQALRAAVASGSD-RFFLGTDSAPHAK---HRKESSC----------------
PYRC_PHOLL            VLKRNVHQEALRAAVASGCD-RFFLGTDSAPHAQ---QKKESSC----------------
Q1LT32_BAUCH          ILKRSSHQKALRAAITSGCN-RFFLGTDTAPHTR---NTKESYC----------------
PYRC_BUCAI            ILKKNKHRMALRKAISNGDK-HFFLGSDTAPHLH---KNKINML----------------
Q7V2B2_PROMP          VAKRENNRIALRKAATSGKE-CFFIGTDSAPHLR---QWK-AFC----------------
PYRC_SYNPX            VVKRERHRLALRRAATSGDP-RFFLGTDSAPHPR---AGKETSC----------------
PYRC_SYNS9            VAKRERHRLALRRAAMSGDR-RFFLGTDSAPHAR---PGKESSC----------------
B1LXE7_METRJ          VAKRERHRLALRRAATSGEA-CFYLGTDTAPHVR---GAKEASC----------------
PYRC_RHIME            VAKREAHRLALRQAAISGDV-RFFLGTDSAPHVD---PLKECAC----------------
PYRC_SINMW            VAKREMHRLALREAAISGDV-RFFLGTDSAPHVD---PLKECAC----------------
PYRC_SINFN            VAKRERHRQALRAAAVSGDV-RFFLGTDSAPHVD---PLKECAC----------------
PYRC_AGRRK            VAKRESHRLALRAAATSGDS-RFFLGTDSAPHVD---PLKECAC----------------
A0A0M6XW94_9RHOB      ILKRAAHQAALRQAATSGEA-QFFLGTDSAPHPT---HAKESAC----------------
C6BW20_DESAD          VAKTFEDREAVRRAAVSGDE-RFFLGTDSAPHPA---RAKEKAG----------------
PYRC_NEIMB            VLKRETHRQALVAAVTGEKAHKFFLGTDSAPHAK---SAKENAC----------------
PYRC_NEIMA            VLKRETHRQALVAAVTGEKAHKFFLGTDSAPHAK---SAKENAC----------------
PYRC_NEIM0            VLKRETHRQALVAAVTGEKAHKFFLGTDSAPHAK---SAKENAC----------------
PYRC_SHESH            VLKRNIHQEALRAAIATGSS-KFFLGTDSAPHEK---HRKESAC----------------
PYRC_SHEWM            VLKRNIHQEALRAAVATGSS-KFFLGTDSAPHEK---HRKESAC----------------
PYRC_PSEFS            ILKRNTHQVALLDAATSGNP-KFFLGTDSAPHAQ---HAKEAAC----------------
PYRC_PSEAE            ILKRNTHQEALLDAAVSGNP-KFFLGTDSAPHAR---HAKEAAC----------------
PYRC_RALSO            VLKRETHRLALVAAATSGHP-RFFLGTDSAPHAK---GLKEHAC----------------
PYRC_SYNY3            ILKREEHRLSLLHAATSGNP-KFFLGTDSAPHAR---NSKESLC----------------
PYRC_VIBCH            ILKRATHQHALVAAATSGSK-KFFLGTDSAPHAK---GRKEAAC----------------
B7FWU0_PHATC          ILKAEIHRLALVKAATSGSK-KFFLGTDSAPHST---DMKEAFC----------------
V9EGN6_PHYPR          VLKRETHRQALLQAVASGSK-KFFLGTDSAPHVS---SKKESGC----------------
A5EV85_DICNV          ILKTERDRKRLLEAAISGDP-RFFLGTDSAPHLR---TQKECSC----------------
A0A0W0ZT49_9GAMM      ILKHEKDQKALQNAVCSGNP-KFFAGTDSAPHTI---STKESAC----------------
E0RQD1_SPITD          VVKTSADRDALREAAFSGDP-HFFFGSDSAPHPREKKEREG-------------------
L0DQ53_SINAD          IAKFDEDREILLRAALEPTG-KFFLGTDSAPHPTAAKFNVDAGC----------------
PYRC_YEAST            VAKLPNDKKALVKAAVSGKP-YFFFGSDSAPHPV---QNKANYE----------------
PYRC_USTMA            VAKYPDDRQALRDVIRQGHP-RFFLGSDSAPHPL---ANKYPSAVTHGAPGTKASASGSD
PYRC_SCHPO            VAKTERDRRALIEAATSKNP-KFFFGSDSAPHPR---SSKLKTP----------------
Q7RGQ3_PLAYO          LPKTLDDKIALCNIIKEGNP-KVFLGSDSAPHYQ---KFKQEPH----------------
A5K330_PLAVS          LPKTIDDKVALCKIIQEGFP-RIFLGSDSAPHYK---EQKNDPH----------------
Q8IKA9_PLAF7          LPKLLEDKIALQDVIKDDFP-RVFLGSDSAPHYK---VMKRKPY----------------
Q4U8H2_THEAN          VAKFEEDRQAILETLKSGHP-RLFLGSDSAPHTC---DSKRSDN----------------
                      : *   .:  :              *:*:***                            

PYRC_HELPJ            -----------IPAGIFSAPILLPALCELFEKHNALENLQAFISDNAKKIYALDNLPSKK
PYRC_HELPG            -----------IPAGIFSAPILLPALCELFEKHNALENLQAFISDNAKKIYTLDNLPNKK
PYRC_HELPY            -----------IPAGIFSAPILLPALCELFEKHNALENLQAFISDNAKTIYGLENLPSKK
PYRC_HELAH            -----------IPAGIFSAPILLPALCELFEKHNALENLQAFISDNAKKIYTLDNLPSKK
D3UHC9_HELM1          -----------GAAGIFSAPCLLESLITLFEEHGALENLQAFVSDNAIKNYQITLEKERI
PYRC_HELHP            -----------GAAGIFSAPILLPALAEVFAFHNALDCLQTFISNRAIANYKLKHFPIKT
Q0PBP6_CAMJE          -----------CAAGVFSAPVILPVLAELFKQNSSEENLQKFLSDNTCKIYDLKFKEDKI
A6Q4X5_NITSB          -----------CAAGVFTAPIALQALAQIFEEAGVLENLQLFVSDNARKIYGITPPK-KE
B9L714_NAUPA          -----------GAAGLFSAPVILPALAEFFDGDN--DTFQKFISDNARENFDLNIPE-KE
A9WK73_CHLAA          -----------CAAGVFSAPVLLPMLVELFERHNALDRLPDFVSGNARRIHGLNPPP-RT
PYRC_ECOLI            -----------GCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPVNDTFI
PYRC_ECO57            -----------GCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPVNDTFI
PYRC_SALTY            -----------GCAGCFNAPSALGSYAAVFEEMNALAHFEAFCSLNGPQFYGLPMNTGWV
PYRC_SALTI            -----------GCAGCFNAPSALGSYAAVFEEMNALAHFEAFCSLNGPQFYGLPVNTGWV
PYRC_YERPE            -----------GCAGVFNAPAALPAYASVFEELNALQHLEAFCALNGPRFYGLPVNDDVV
PYRC_YERP3            -----------GCAGVFNAPAALPAYASVFEELNALQHLEAFCALNGPRFYGLPVNDDVV
PYRC_PHOLL            -----------GCAGVFNAPSALPAYATVFEEMNALPHFEAFCSLNGPKFYGLPVNEGFI
Q1LT32_BAUCH          -----------GCAGVFSAPIALPAYATVFEELNAFNYFENFCSINGPHFYGLPINEDFI
PYRC_BUCAI            -----------GCAGIFNAPSSLLSYVKVFEEMRALKYLQSFCSENGPKFYNMPINKETI
Q7V2B2_PROMP          -----------GCAGIFNSPVAIESYLKVFEEENALNQFEKFASLNGPNFYNLPINNEKI
PYRC_SYNPX            -----------GCAGIFNAPFALESYAQVFAEEEAMHHLEGFASLHGPAFYGLPANNDTV
PYRC_SYNS9            -----------GCAGIFNAPHALESYAMAFAQDDKLDKLEAFASLHGPAFYGLPVNEGIV
B1LXE7_METRJ          -----------GCAGVFCGPSALQTYVQVFDEEGALDKFEAFASLNGARFHGLEPNAGTV
PYRC_RHIME            -----------GCAGIYTSINTLSCLAHVFEEEGALDRLEAFTSLNGPAWYGLPANEETI
PYRC_SINMW            -----------GCAGIYTSINSLSCLAHVFEEEGALDRLEAFTSLNGPAWYGLPPNEETI
PYRC_SINFN            -----------GCAGIYTSVNTMSCLAHVFEEEGALDRLEAFTSLNGPAWYGLPANEETI
PYRC_AGRRK            -----------GCAGIYTSINTMSCLAHVFEQDGALDKLEAFASLNGPAWYGLAPNEERI
A0A0M6XW94_9RHOB      -----------CSAGCFTAPHALPLLAHVFEEEEALDRLEGFASLHGPGHYGLPANDDTI
C6BW20_DESAD          -----------AAAGIFNAPTSIGYVTQVFDELNALDKLEGFTSIYGARFYGFSPNGSTI
PYRC_NEIMB            -----------GCAGMFSAMTAIELYAEVFEKAGALDKLEAFASKNGARFYGIPENTDTI
PYRC_NEIMA            -----------GCAGMFSAMTAIELYAEVFEKAGALDKLEAFASKNGARFYGIPENTDTI
PYRC_NEIM0            -----------GCAGMFSAMTAVELYAEVFEKAGALDKLEAFASKNGARFYGIPENAGTI
PYRC_SHESH            -----------GCAGCYSAWSALELYAQVFDDLGIIDKLEGFASIHGPDFYGLPRNTSTV
PYRC_SHEWM            -----------GCAGCYSAWSALELYAQVFDDLGVIEKLEGFASTHGPDFYGLPRNTGTV
PYRC_PSEFS            -----------GCAGCYTAFAAIELYAEAFEQRNALDKLEGFASINGPRFYGLPANTDRI
PYRC_PSEAE            -----------GCAGCYSAYAAIELYAEAFEQRNALDKLEGFASLHGPDFYGLPRNTDRI
PYRC_RALSO            -----------GCAGCYTALHAMELYAEAFEDANALDKLEGFASLHGPDFYGLPRNAGTL
PYRC_SYNY3            -----------GCAGCYSALHAMELYAEAFESVNSLDKLEAFASFYGPDFYQLPRNTAQI
PYRC_VIBCH            -----------GCAGSYTAHAALELYAEVFEKEGKLENLEAFASFNGPDFYGLPRNQETV
B7FWU0_PHATC          -----------GCAGIFTAHAAVELYAEVFDKVGALDKLEAFCSSNGADHYGLERNTATI
V9EGN6_PHYPR          -----------GCAGIYSAHAALELYAEAFESIGKLDLLRAFACENGADFYGIKRNTVGE
A5EV85_DICNV          -----------GCAGCYSAFHAPALYATIFERAGALPRLHDFACRFGADYYGLPYNNGSI
A0A0W0ZT49_9GAMM      -----------GCAGIYSAPFALALYTQVFDQLNQLKQLNPFISRFGAEFYQLPINQQHI
E0RQD1_SPITD          ------------AAGCYTAPYALEALASLFEAHGVLGVLEGFVSERGARFYGLLLNEERV
L0DQ53_SINAD          -----------CAAGVFSSPVAMAALASRFDAEEALDRLEDFTSVNGAKFYGLPLNEGRM
PYRC_YEAST            ----------GVCAGVYSQSFAIPYIAQVFEEQNALENLKGFVSDFGISFYEVKDSEVAS
PYRC_USTMA            HLEATGVVSCGCAAGVYTSSILVPLCATLLEAFGALDQLANYVSINGRNFYGYNDDQHAK
PYRC_SCHPO            -----------PAAGVFTQPFAASYLAEVFDKEGRLDALKDFACIFGRKFYCIPLDFKES
Q7RGQ3_PLAYO          -----------YKPGIFTQPFLLSYLAHIFNKFNSLDKIENFACKNAAQFLNLEPKSIEN
A5K330_PLAVS          -----------YKPGIYTQPFLMSYVSHIFNKMNSLDKVENFACKNAANFLNLKEKKTGT
Q8IKA9_PLAF7          -----------YKPGIYTQPFLINYVAHILNKFDALDKMENFTSKNASLFLNLAEK---K
Q4U8H2_THEAN          -----------PPAGIYTQPFLLQYLSDTFEDFGFFDKLENFCCKNGQEFLQLPPK----
                                   .* :            :        .  : .                

PYRC_HELPJ            AHLSKKPFIVPTH------TLCLNEK-----------------IAILRGGETLSWNLQEI
PYRC_HELPG            ARLSKKPFIVPTH------TICLNEK-----------------IAILRGGETLSWNLQEI
PYRC_HELPY            ARLSKKPFMIPTH------TLCLNEK-----------------IAILRGGETLSWNLQEI
PYRC_HELAH            VRLSKKPFIVPTH------TLCLNEK-----------------IAILREGETLSWNIQEI
D3UHC9_HELM1          FDFQKTPCTIPKA------VKTKDGE-----------------IIPLHAEKSLPWSRV--
PYRC_HELHP            ITLERVENPVPPY------INTPLGH-----------------IIPLRAQTNLSWRIKEE
Q0PBP6_CAMJE          LTLEEKEWQVPNV------YEDKYNQ-----------------VVPYMAGEILKFQLKH-
A6Q4X5_NITSB          VTLEKVPFDV----------PSSYND-----------------VVPMFAERELSWSITSV
B9L714_NAUPA          VVLVEEEYIA----------PQMVGE-----------------VKPMFAGKRFSYSVKNF
A9WK73_CHLAA          VRLVEDPWQV----------PMRYGD-----------------VVPFAAGQTLRWQVVAE
PYRC_ECOLI            ELVREE-QQVAES------IALTD-----------------DTLVPFLAGETVRWSVKQ-
PYRC_ECO57            ELVREE-HQVAES------IALTD-----------------DTLVPFLAGETVRWSVKQ-
PYRC_SALTY            ELVRDE-QQIPGN------IALAD-----------------DSLVPFLAGETVRWSVKK-
PYRC_SALTI            ELVRDE-QQIPEN------IALAD-----------------DSLVPFLAGETVRWSVKK-
PYRC_YERPE            ELVRTP-FLQPEE------IPLGN-----------------ESVIPFLAGQTLNWSVKR-
PYRC_YERP3            ELVRTP-FLQPEE------IPLGN-----------------ESVIPFLAGQTLNWSVKR-
PYRC_PHOLL            ELTRKP-STVIEH------IDCNN-----------------EKLIPFLAGEDARWDVKVT
Q1LT32_BAUCH          FLRREY-DSQTEI------ISLENG----------------EQILSALVKQRLHWTVSD-
PYRC_BUCAI            TIIKKP-CKIIKK------INVGRN-----------------VIIPFLSGEILNWSIESD
Q7V2B2_PROMP          RLVSRS-NKIPEF------IEVIEQNKVV------------GQIKPFHGGETLTWRVEGV
PYRC_SYNPX            TLEKVA-VDVPEL------V---------------------NGLVPFHAGETLPWRLQPC
PYRC_SYNS9            TLQRDD-KLVPNV------V---------------------NGLVPFHAGETLPWRLQPC
B1LXE7_METRJ          TLERRE-SRIAEA------VAVDD-----------------TAVVVFRGEETLPWSVA--
PYRC_RHIME            TLRKQE-EPVSYP------ARIETEA---------------GPVTVFDPMFPLHWAVTQA
PYRC_SINMW            TLRKQE-EPVGYP------AKIETEA---------------GPVTVFDPMFPLYWTVIEA
PYRC_SINFN            TLRKAN-EPVRYP------AKIETEA---------------GLITVFDPLFPLYWAVA--
PYRC_AGRRK            TLIRRV-ESVTFP------EKIETGA---------------GTVTVFDPMFPLHWDVEG-
A0A0M6XW94_9RHOB      TLARG---ALEFP------PAIEGHG---------------QRVTLFDPGHPVNWHVKDT
C6BW20_DESAD          TLAKRE-NPVEMD------WQIKVGG---------------DIVKIFKPDTPLLWDLVD-
PYRC_NEIMB            TLVKQS-QTVPAS------VPYGDGE-----------------LVPMRAGGEIGWTVQY-
PYRC_NEIMA            TLVKQS-QTVPAS------IPYGDGE-----------------LVPMRAGGEIGWTVQY-
PYRC_NEIM0            TLVKQS-QTVPAS------VPYGDGE-----------------LVPMRAGGEIGWTVQY-
PYRC_SHESH            TLVKEK-WTVPSE------IILPNGNP----------------IVPFFAGEEVSWKVKS-
PYRC_SHEWM            TLVKES-WTVPSE------IILPNGNP----------------IVPFFAGEEVNWKVKS-
PYRC_PSEFS            TLVRED-WTAPAS------LPFGELT-----------------VIPLRAGETLRWRLLEE
PYRC_PSEAE            TLVREE-WQAPAS------LPFGDFD-----------------VVPLRAGETLRWKLLEA
PYRC_RALSO            TLTRSQ-WQLPAE------VPFGEQM-----------------LVPLRGGEMLRWKTV--
PYRC_SYNY3            TLMKNP-WRIPAE------LPFPESG-----------------LVPLRAGEEITWQMV--
PYRC_VIBCH            TLTKQA-WPVAES------MPFGSDI-----------------VVPIRAGENIEWTVK--
B7FWU0_PHATC          TLEKKS-WRVPRT------FDFGDGKG----------------VTPLRAGEEIKWSIAAQ
V9EGN6_PHYPR          TVLKKEDWTVPDS------YPFDNGV-----------------VVPLKAGETISWKLQQ-
A5EV85_DICNV          CLQRQE-CIVPDV------LSYGEGE-----------------LVPLSAGMSLPWTLADK
A0A0W0ZT49_9GAMM      ELIKSP-QTIPDY------LPLGSNQ-----------------VVPIAAGEIIQWSVHES
E0RQD1_SPITD          VLRKEE-WVVPAE------YH---------------------GVVPACAGMRLGWRVVEK
L0DQ53_SINAD          ELAREP-WVVPRM------IE---------------------GMTPFLAGEELPWRVL--
PYRC_YEAST            SDKAILFKKEQ---------VIPQVI----------SDGKDISIIPFKAGDKLSWSVRWE
PYRC_USTMA            HGSIKLRKVRSRSSISPAAATVPAVYVHPEFREVPDSDASKVQVVPFWAGKCLGWEIVRS
PYRC_SCHPO            N---IVLKKES--------FRVPESV--------------ANDLVPFHPNEVLQWHCSWE
Q7RGQ3_PLAYO          N-QNSIIYIQKKN------LTIPNDY---------------FGVVPFLANQTIDFTASYK
A5K330_PLAVS          NLQPLSLCIQKKE------LKIADEY---------------SGVVPFLAGQTIDFTATCV
Q8IKA9_PLAF7          KLAKYYICVEKHP------FKLPREY---------------NGVVPFLAGKTLDYDIHYV
Q4U8H2_THEAN          --EPEYFELVKQP------FKVPEEV---------------EGIVPFRAGQFLNYSILF-
                                                                 :          :     

PYRC_HELPJ            A---
PYRC_HELPG            A---
PYRC_HELPY            A---
PYRC_HELAH            A---
D3UHC9_HELM1          ----
PYRC_HELHP            NR--
Q0PBP6_CAMJE          ----
A6Q4X5_NITSB          Q---
B9L714_NAUPA          ----
A9WK73_CHLAA          ----
PYRC_ECOLI            ----
PYRC_ECO57            ----
PYRC_SALTY            ----
PYRC_SALTI            ----
PYRC_YERPE            ----
PYRC_YERP3            ----
PYRC_PHOLL            D---
Q1LT32_BAUCH          ----
PYRC_BUCAI            ----
Q7V2B2_PROMP          VK--
PYRC_SYNPX            M---
PYRC_SYNS9            T---
B1LXE7_METRJ          ----
PYRC_RHIME            ----
PYRC_SINMW            ----
PYRC_SINFN            ----
PYRC_AGRRK            ----
A0A0M6XW94_9RHOB      A---
C6BW20_DESAD          ----
PYRC_NEIMB            ----
PYRC_NEIMA            ----
PYRC_NEIM0            ----
PYRC_SHESH            ----
PYRC_SHEWM            ----
PYRC_PSEFS            SK--
PYRC_PSEAE            GA--
PYRC_RALSO            ----
PYRC_SYNY3            ----
PYRC_VIBCH            ----
B7FWU0_PHATC          E---
V9EGN6_PHYPR          ----
A5EV85_DICNV          N---
A0A0W0ZT49_9GAMM      KR--
E0RQD1_SPITD          GR--
L0DQ53_SINAD          ----
PYRC_YEAST            PR--
PYRC_USTMA            ----
PYRC_SCHPO            ----
Q7RGQ3_PLAYO          YDVV
A5K330_PLAVS          GADV
Q8IKA9_PLAF7          SKF-
Q4U8H2_THEAN          ----