CLUSTAL format seed alignment for MF_00221

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MNTH_BRUME       ----------------------------------------------------------MV
MNTH_BRUSU       ----------------------------------------------------------MV
MNTH_AGRFC       -------------------------------------------------MFFMRMICNCI
MNTH_LISMO       ------------------------------------------------------------
MNTH_LISMH       ------------------------------------------------------------
MNTH_LISMC       ------------------------------------------------------------
MNTH_LISMF       ------------------------------------------------------------
MNTH_LISW6       ------------------------------------------------------------
MNTH_LISIN       ------------------------------------------------------------
MNTH_NOSS1       ------------------------------------------------------------
MNTH_BRADU       ------------------------------------------------------------
MNTH_RHILO       ------------------------------------------------------------
MNTH_XANAC       ------------------------------------------------------------
MNTH_XANCP       ------------------------------------------------------------
MNTH_XYLFA       ----------------------------------------------MSCGIANAIRWDVS
MNTH_XYLFT       ----------------------------------------------MSCCIANAIRWDVS
MNTH2_PSEAE      ------------------------------------------------------------
MNTH1_PSEAE      ------------------------------------------------------------
MNTH_RALSO       ------------------------------------------------------------
MNTH_LACBR       ------------------------------------------------------------
MNTH_PEDPA       ------------------------------------------------------------
MNTH_LACP3       ------------------------------------------------------------
MNTH_LACCB       ------------------------------------------------------------
MNTH_LACBA       ------------------------------------------------------------
MNTH_LACPL       ------------------------------------------------------------
MNTH_LACSS       ------------------------------------------------------------
MNTH_STAA1       ------------------------------------------------------------
MNTH_STAAM       ------------------------------------------------------------
MNTH_STAAC       ------------------------------------------------------------
MNTH_STAA2       ------------------------------------------------------------
MNTH_STAA9       ------------------------------------------------------------
MNTH_STAAS       ------------------------------------------------------------
MNTH_STAAW       ------------------------------------------------------------
MNTH_STAAN       ------------------------------------------------------------
MNTH_STAA8       ------------------------------------------------------------
MNTH_STAAE       ------------------------------------------------------------
MNTH_STAA3       ------------------------------------------------------------
MNTH_STAAB       ------------------------------------------------------------
MNTH_STAAR       ------------------------------------------------------------
MNTH_STAES       ------------------------------------------------------------
MNTH_STAEQ       ------------------------------------------------------------
MNTH_STAHJ       ------------------------------------------------------------
MNTH_STAS1       ------------------------------------------------------------
MNTH_MYCTU       ------------------------------------------------------------
MNTH_MYCLE       ------------------------------------------------------------
MNTH_SHIB3       ------------------------------------------------------------
MNTH_SHIBS       ------------------------------------------------------------
MNTH_ECO24       ------------------------------------------------------------
MNTH_ECO57       ------------------------------------------------------------
MNTH_ECO5E       ------------------------------------------------------------
MNTH_ECOLU       ------------------------------------------------------------
MNTH_ECOK1       ------------------------------------------------------------
MNTH_ECO45       ------------------------------------------------------------
MNTH_ECOL6       ------------------------------------------------------------
MNTH_ECOL5       ------------------------------------------------------------
MNTH_ECO7I       ------------------------------------------------------------
MNTH_ECO8A       ------------------------------------------------------------
MNTH_ECO81       ------------------------------------------------------------
MNTH_SHISS       ------------------------------------------------------------
MNTH_ECOUT       ------------------------------------------------------------
MNTH_ESCF3       ------------------------------------------------------------
MNTH_ECOBW       ------------------------------------------------------------
MNTH_ECODH       ------------------------------------------------------------
MNTH_ECOSE       ------------------------------------------------------------
MNTH_ECOSM       ------------------------------------------------------------
MNTH_ECO55       ------------------------------------------------------------
MNTH_ECOLC       ------------------------------------------------------------
MNTH_ECOLI       ------------------------------------------------------------
MNTH_SHIF8       ------------------------------------------------------------
MNTH_ECO27       ------------------------------------------------------------
MNTH_SHIDS       ------------------------------------------------------------
MNTH_ECOHS       ------------------------------------------------------------
MNTH_CITK8       ------------------------------------------------------------
MNTH_SALTY       ------------------------------------------------------------
MNTH_SALPC       ------------------------------------------------------------
MNTH_SALCH       ------------------------------------------------------------
MNTH_SALEP       ------------------------------------------------------------
MNTH_SALG2       ------------------------------------------------------------
MNTH_SALSV       ------------------------------------------------------------
MNTH_SALTI       ------------------------------------------------------------
MNTH_SALPA       ------------------------------------------------------------
MNTH_SALPK       ------------------------------------------------------------
MNTH_CROS8       ------------------------------------------------------------
MNTH_ENT38       ------------------------------------------------------------
MNTH_KLEP3       ------------------------------------------------------------
MNTH_KLEP7       ------------------------------------------------------------
MNTH_PECCP       ------------------------------------------------------------
MNTH_BLOPB       ------------------------------------------------------------
MNTH_ERWT9       ------------------------------------------------------------
MNTH_YERPE       ------------------------------------------------------------
MNTH_YERPP       ------------------------------------------------------------
MNTH_YERPA       ------------------------------------------------------------
MNTH_YERPN       ------------------------------------------------------------
MNTH_YERPS       ------------------------------------------------------------
MNTH_YERPB       ------------------------------------------------------------
MNTH_YERP3       ------------------------------------------------------------
MNTH_YERPY       ------------------------------------------------------------
MNTH_YERE8       ------------------------------------------------------------
MNTH_AERHH       ------------------------------------------------------------
MNTH_VIBCB       ------------------------------------------------------------
MNTH_CHRSD       ------------------------------------------------------------
MNTH_ACICJ       ------------------------------------------------------------
MNTH_VEREI       ------------------------------------------------------------
MNTH_GRABC       ------------------------------------------------------------
MNTH_BURCM       ------------------------------------------------------------
MNTH_DEIRA       ------------------------------------------------------------
MNTH_BACSU       ------------------------------------------------------------
MNTH_CLOAB       ------------------------------------------------------------
MNTH_CALS4       ------------------------------------------------------------
NRAM1_ARATH      ------------------------------------------------------------
NRAM6_ARATH      ------------------------------------------------------------
NRAM3_ORYSJ      ------------------------------------------------------------
NRAM1_ORYSJ      ------------------------------------------------------------
NRAM5_ORYSJ      ------------------------------------------------------------
NRAT1_ORYSJ      ------------------------------------------------------------
NRAM4_ORYSJ      -----------------------------------------------------------M
NRAM3_ARATH      ------------------------------------------------------------
NRAM4_ARATH      ------------------------------------------------------------
NRAM2_ARATH      ------------------------------------------------------------
NRAM6_ORYSJ      ------------------------------------------------------------
NRAM5_ARATH      ------------------------------------------------------------
NRAM2_ORYSJ      ------------------------------------------------------------
NRAM1_DICDI      ------------------------------------------------------------
NRAM1_BOVIN      ------------------------------------------------------------
NRAM1_BISBI      ------------------------------------------------------------
NRAM1_BUBBU      ------------------------------------------------------------
NRAM1_CEREL      ------------------------------------------------------------
NRAM1_SHEEP      ------------------------------------------------------------
NRAM1_HUMAN      ------------------------------------------------------------
NRAM1_CANLF      ------------------------------------------------------------
NRAM1_PIG        ------------------------------------------------------------
NRAM1_MOUSE      ------------------------------------------------------------
NRAM1_CHICK      ------------------------------------------------------------
NRAM2_RAT        ------------------------------------------------------MVLDPE
NRAM2_MOUSE      ------------------------------------------------------MVLDPK
NRAM2_HUMAN      ------------------------------------------------------MVLGPE
MVL_DROME        ---------------------------------------------------MSSNEAYHE
NRAMA_CAEEL      ------------------------------------------------------------
NRAM2_DICDI      MNNNNNNKKLNKENLNEIENWNEIELTDYKKQGLDEGTSSNIYLFESNGNVVNGSIEDSP
SMF3_YEAST       ------------------------------------------------------------
SMF2_YEAST       ------------------------------------------------------------
SMF1_YEAST       -------------------------------------------------------MVNVG
PDT1_SCHPO       ------------------------------------------------------------
                                                                             

MNTH_BRUME       PHGSCPSGAREVTFEGWRRERG------------------EASMSDVHRTIRVNRSG---
MNTH_BRUSU       PHGSCPSGAREVTFEGWRRERG------------------EASMSDVHRTIRVNRSG---
MNTH_AGRFC       NSISMKAQKMDKPVFGWRRNGD------------------DLSLSDVHSSIRIKPDA---
MNTH_LISMO       ----MKKDKTERTKQSWRKAQN------------------APSLSEVNNSVAIPKNA---
MNTH_LISMH       ----MKKDKTERTKQSWRKAQN------------------APSLSEVNNSVAIPKNA---
MNTH_LISMC       ----MKKDKTERTKQSWRKAQN------------------APSLSEVNNSVAIPKNA---
MNTH_LISMF       ----MKKDKTERTKQSWRKAQN------------------APSLSEVNNSVAIPKNA---
MNTH_LISW6       ----MKKEKTERTKQSWRKAQN------------------APSLSEVNNSVAIPKNA---
MNTH_LISIN       ----MKKEKTERTKQSWRKAQN------------------APSLSEVNNSVAIPKNA---
MNTH_NOSS1       ----------------MTPPEN------------------RPSLPEVHRSIRVPNSN---
MNTH_BRADU       -MDARSPDLTTDAAGWRTDVPT------------------TKSLAEVNASVALPTAG---
MNTH_RHILO       MSDAEATAPRSSWRFAGRDEDD------------------QPSLREVNSTIAVPSSG---
MNTH_XANAC       ------MSADTAASAPSSTTAI------------------G-GLGDHQASVSVPNSG---
MNTH_XANCP       ------MSSEIVPIAEPIRPAD------------------G-GLGAAHASVAVPKGG---
MNTH_XYLFA       LLIHRSMSSSMSSVQPTSPVSD------------------SPSLGEMHASVAVSRRG---
MNTH_XYLFT       LLIHRSMSSSMSSVQPTSPVSD------------------SPSLGEMHASVAVSRRG---
MNTH2_PSEAE      ------MSAKDTPAPQAAE-------------------------PGRAQPVEVPGGG---
MNTH1_PSEAE      -----------MKYSLPTTATA------------------PFCPSAVSHSVAVPADA---
MNTH_RALSO       ---------MFRLPALPRIPTA------------------PFCPSEVRGCVAIPPDL---
MNTH_LACBR       --------------MKEGIDMRESVAEEPKHKFFQSTEGENKSLDEVNGSVKVPKNA---
MNTH_PEDPA       --------------MSEKLDEVDS-----------------KSLDEINGSIKVPKNA---
MNTH_LACP3       ------------MASEDKKSKREHIIHFEDTA--------SKSLDEVNGSVEVPHNA---
MNTH_LACCB       ------------MASEDKKSKREHIIHFEDTP--------SKSLDEVNGSVEVPHNA---
MNTH_LACBA       --------------MKNHETDTKTKHHMIESTG-----SGQKSLDEVNGTVEVPQNA---
MNTH_LACPL       ---------MKSAKTKDHAKMKAAEEKAIHSTG-----ADSKSLDEVNGSVRVPKDA---
MNTH_LACSS       ------------MDKKQREDSQKHEKFIHYAD--------GSSLEEINNTVAIPKNA---
MNTH_STAA1       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAM       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAC       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAA2       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAA9       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAS       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAW       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAN       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAA8       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAE       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAA3       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAB       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAAR       --------------MNNKRHSTNEQ----------------LSLDEINNTIKFDHRS---
MNTH_STAES       ---------MGVILLNSNNNNHEQQ----------------RSLDEINNTINFNHND---
MNTH_STAEQ       ---------MGVILLNSNNNNHEQQ----------------RSLDEINNTINFNHND---
MNTH_STAHJ       --------------MGVIDN--KEQ----------------RSLDEINSTIEFNDSQ---
MNTH_STAS1       ----------------MKNHVQTHN----------------KSLDEINNTVSINTHG---
MNTH_MYCTU       ---------------------------------------MAGEFRLLSHLCSRGSKV---
MNTH_MYCLE       ---------------------------------------MFVNLTCLSE--GNGSRG---
MNTH_SHIB3       -----------------------------------------------------MTNY---
MNTH_SHIBS       -----------------------------------------------------MTNY---
MNTH_ECO24       -----------------------------------------------------MTNY---
MNTH_ECO57       -----------------------------------------------------MTNY---
MNTH_ECO5E       -----------------------------------------------------MTNY---
MNTH_ECOLU       -----------------------------------------------------MTNY---
MNTH_ECOK1       -----------------------------------------------------MTNY---
MNTH_ECO45       -----------------------------------------------------MTNY---
MNTH_ECOL6       -----------------------------------------------------MTNY---
MNTH_ECOL5       -----------------------------------------------------MTNY---
MNTH_ECO7I       -----------------------------------------------------MTNY---
MNTH_ECO8A       -----------------------------------------------------MTNY---
MNTH_ECO81       -----------------------------------------------------MTNY---
MNTH_SHISS       -----------------------------------------------------MTNY---
MNTH_ECOUT       -----------------------------------------------------MTNY---
MNTH_ESCF3       -----------------------------------------------------MTNY---
MNTH_ECOBW       -----------------------------------------------------MTNY---
MNTH_ECODH       -----------------------------------------------------MTNY---
MNTH_ECOSE       -----------------------------------------------------MTNY---
MNTH_ECOSM       -----------------------------------------------------MTNY---
MNTH_ECO55       -----------------------------------------------------MTNY---
MNTH_ECOLC       -----------------------------------------------------MTNY---
MNTH_ECOLI       -----------------------------------------------------MTNY---
MNTH_SHIF8       -----------------------------------------------------MTNY---
MNTH_ECO27       -----------------------------------------------------MTNY---
MNTH_SHIDS       -----------------------------------------------------MTNY---
MNTH_ECOHS       -----------------------------------------------------MTNY---
MNTH_CITK8       -----------------------------------------------------MTND---
MNTH_SALTY       -----------------------------------------------------MTDN---
MNTH_SALPC       -----------------------------------------------------MTDN---
MNTH_SALCH       -----------------------------------------------------MTDN---
MNTH_SALEP       -----------------------------------------------------MTDN---
MNTH_SALG2       -----------------------------------------------------MTDN---
MNTH_SALSV       -----------------------------------------------------MTDN---
MNTH_SALTI       -----------------------------------------------------MTDN---
MNTH_SALPA       -----------------------------------------------------MTDN---
MNTH_SALPK       -----------------------------------------------------MTDN---
MNTH_CROS8       -----------------------------------------------------MNHT---
MNTH_ENT38       -----------------------------------------------------MNNS---
MNTH_KLEP3       -----------------------------------------------------MTSS---
MNTH_KLEP7       -----------------------------------------------------MTSS---
MNTH_PECCP       -----------------------------------------------------MPGS---
MNTH_BLOPB       -----------------------------------------------------MLNE---
MNTH_ERWT9       -----------------------------------------------------MSES---
MNTH_YERPE       -----------------------------------------------------MLNG---
MNTH_YERPP       -----------------------------------------------------MLNG---
MNTH_YERPA       -----------------------------------------------------MLNG---
MNTH_YERPN       -----------------------------------------------------MLNG---
MNTH_YERPS       -----------------------------------------------------MLNG---
MNTH_YERPB       -----------------------------------------------------MLNG---
MNTH_YERP3       -----------------------------------------------------MLNG---
MNTH_YERPY       -----------------------------------------------------MLNG---
MNTH_YERE8       -----------------------------------------------------MLNS---
MNTH_AERHH       --------------------------------------------------------M---
MNTH_VIBCB       -----------------------------------------MSNASINHASIQLENA---
MNTH_CHRSD       ---------------------------------------MRTGSMLRTISDSAIRDQ---
MNTH_ACICJ       -------------------------MSDLVSR--------------PGLSERTARAV---
MNTH_VEREI       -------------------------MDDCVHKTVG--------S--AARTERTALAV---
MNTH_GRABC       -------------------------MTQITPTCAP--------PPGPTITDRTSLRL---
MNTH_BURCM       -------------------------MIPVTSKSSSGFALPDLSTDRAHRAVPAEGAA---
MNTH_DEIRA       -------------------------MDSRSPSLPDD------RPDPPEQHLDARAGA---
MNTH_BACSU       -----------------------------------------MMNKDITAQSPRSKAV---
MNTH_CLOAB       --------------------------------------MDKLSIREDNYNIKHKTIS---
MNTH_CALS4       --------------------------------------METREIASQ----RRKNLY---
NRAM1_ARATH      --------------MAATGSGRSQFISSSGGNRS-FSN---SPLIENSDSNQII------
NRAM6_ARATH      --------------MAAE--------TASGSNRS-ISN---SPLIENSDSNQIL------
NRAM3_ORYSJ      --------------MSGPMQRSSQPQFISSVERNNQSNGPGTPLIDSIDVDQIV------
NRAM1_ORYSJ      -------------------MGVTKAEAVAG------DGGKVVDDIEALAD----------
NRAM5_ORYSJ      -------------------MEIERESSERGSISWRASAAHDQDAKKLDADDQ-L------
NRAT1_ORYSJ      -------------MEGTGEMREVGRETLHGGVVQSVSETDEYKEKTIDSEKDGQ------
NRAM4_ORYSJ      EEGAKIGREHEQQQQQHGRVNGSGRVAAVGGGSGGGGDEIEIEVAAAAGASPSRQHGG--
NRAM3_ARATH      -------------MPQLENNE----------PLLINEEEEEETAYDETEKVHIVRN----
NRAM4_ARATH      -------------MSETDRER----------PLLASEER----AYEETEKVLIVGI----
NRAM2_ARATH      --------MENDVKENLEEEEDRLLPPPPPSQSLPSTDSESEAAFETNEKILIVDF----
NRAM6_ORYSJ      MAPLPAAATATASSAATPADDEAHSLLPSTPSNEEDDDDLEERAYEATEKVIVSISDFPD
NRAM5_ARATH      -----MTGSTVSRQENSPKRPNDSNGEFKRLLVPETSQPEEDELHESPPENQILNV----
NRAM2_ORYSJ      ----------MASRDLAESLLPVGGGAATATATATAHDEYDERAYDSDDKVSIAVSD---
NRAM1_DICDI      ---------MTPRIESEESAPLVNKNNNNNNDNNNNNNVDEENPLIIESGIPIEDLE---
NRAM1_BOVIN      --MSGD-----TGPPKQGGTRYGSISSPPSPE---PQQAPPGGTYLS-EKIPIPDTE---
NRAM1_BISBI      --MSGD-----TGPPKQGGTRYGSISSPPSPE---PQQAPPGGTYLS-EKIPIPDTE---
NRAM1_BUBBU      --MSGD-----TGPSKQGGTRYGSISSPPSPG---PQQAPPGGTYLG-EKIPIPDTE---
NRAM1_CEREL      --MPGD-----MGPPKQGGTRYGSISSPPSPG---PQQAPPGGTYLS-EKIPIPDTE---
NRAM1_SHEEP      --MSGD-----TGTPNQGGTRYGSISSPPSPG---PQQAPPGGTYLS-EKIPIPDTE---
NRAM1_HUMAN      --MTGD-----KGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLS-EKIPIPDTK---
NRAM1_CANLF      --MTGD-----KDPQSVSRPNYGSISHPPSSE---PQQEPLRTTYLS-EKIPIPDTE---
NRAM1_PIG        --MTGD-----TDPPKQSRTQYGSISSSPSPG---PPQVPPGGTYLS-EKIPIPNAE---
NRAM1_MOUSE      --MISD-----KSPPRLSRPSYGSISSLPGPA---PQPAPCRETYLS-EKIPIPSAD---
NRAM1_CHICK      --MSGSGPAMASLEPGLAGSLNRGQTDASNVPVPPHHPVPHAQTYLD-ELISIPKGS---
NRAM2_RAT        EKIPDDGASGDHGDSASLGAINPAYSNSSLPHST-GDSEEPFTTYFD-EKIPIPEEE---
NRAM2_MOUSE      EKMPDDGASGDHGDSASLGAINPAYSNSSLPHST-GDSEEPFTTYFD-EKIPIPEEE---
NRAM2_HUMAN      QKMSDDSVSGDHGESASLGNINPAYSNPSLSQSP-GDSEEYFATYFN-EKISIPEEE---
MVL_DROME        PGAGGDGPGGSSGASGGGSQRSNQLHHQQILNETTYLKPAAKQAYFSDEKVLIPDDDS--
NRAMA_CAEEL      -----------MASSNNDGPIEPEAEPWRITQNDHLEQDLLEEDAESQERVDIPVDD---
NRAM2_DICDI      KQQQQQQQQQQQQQQQQQQQQQQQQNIISSDEEIEDKPFQDRDSNIGDGSDIDSSGDSID
SMF3_YEAST       ------------------------------------------------------------
SMF2_YEAST       --------------MTSQEYEPIQWSDESQTNNDSVNDAYADVNTTHESRRRTTLQP---
SMF1_YEAST       PSHAAVAVDASEARKRNISEEVFELRDKKDSTVVIEGEAPVRTFTSSSSNHEREDTY---
PDT1_SCHPO       MSSQSYYMNDLDDLRSLESSTLNKKDTAINELNPEQNDTRRSTDLLLEDKYGIQTGF---
                                                                             

MNTH_BRUME       ------------------------SKFRRALSFFGPGYLVAVGYMDPGNWATSLAGGSRF
MNTH_BRUSU       ------------------------SKFRRALSFFGPGYLVAVGYMDPGNWATSLAGGSRF
MNTH_AGRFC       ------------------------STFRRAMAFFGPGYLVAVGYMDPGNWATSLAGGSKF
MNTH_LISMO       ------------------------KFFRKLFAFMGPGALIAVGYVDPGNWATSIAGGSEF
MNTH_LISMH       ------------------------KFFRKLFAFMGPGALIAVGYVDPGNWATSIAGGSEF
MNTH_LISMC       ------------------------KFFRKLFAFMGPGALIAVGYVDPGNWATSIAGGSEF
MNTH_LISMF       ------------------------KFFRKLFAFMGPGALIAVGYVDPGNWATSIAGGSEF
MNTH_LISW6       ------------------------KFFRKLFAFMGPGALIAVGYVDPGNWATSIAGGSEF
MNTH_LISIN       ------------------------KFFRKLFAFMGPGALIAVGYVDPGNWATSIAGGSEF
MNTH_NOSS1       ------------------------SFWRKMLAYAGPGYLVSVGYIDPGNWATDIAGGSKF
MNTH_BRADU       ------------------------VWWRRLLAFVGPGYLVSVGYMDPGNWATDLAGGSKF
MNTH_RHILO       ------------------------VWFRRLFAFMGPGYMVSVGYMDPGNWATDLAGGAQF
MNTH_XANAC       ------------------------HWWSRLLAFLGPGYMVSVGYMDPGNWATDLAGGSQF
MNTH_XANCP       ------------------------HWWFRLLAFLGPGYMVSVGYMDPGNWATDLAGGSQF
MNTH_XYLFA       ------------------------HWGFRLLAFLGPGYMVSVGYMDPGNWATGLAGGSRF
MNTH_XYLFT       ------------------------HWGFRLLAFLGPGYMVSVGYMDPGNWATGLAGGSRF
MNTH2_PSEAE      ------------------------HWWRRLLAFAGPGYLVAVGYMDPGNWATDVAGGAQL
MNTH1_PSEAE      ------------------------SPLRKLALFVGPGLLVSVGYMDPGNWATAIEAGSRF
MNTH_RALSO       ------------------------PLWKKLLRFAGPGLLVSVGYMDPGNWATDIEAGSRY
MNTH_LACBR       ------------------------GFWRTLFAYTGPGILIAVGYMDPGNWITSIAGGAQF
MNTH_PEDPA       ------------------------GFWKTLMAYSGPGFLIAVGYMDPGNWITSIAGGAQF
MNTH_LACP3       ------------------------GFWKTLAAYTGPGILVAVGYMDPGNWITSIAGGASF
MNTH_LACCB       ------------------------GFWKTLAAYTGPGILVAVGYMDPGNWITSIAGGASF
MNTH_LACBA       ------------------------GFWRTLMAYTGPGALIAVGYMDPGNWITSIAGGAQY
MNTH_LACPL       ------------------------SFWRTLIAYTGPGALVAVGYMDPGNWITSIAGGSQY
MNTH_LACSS       ------------------------GFWKTLMAFMGPGALVAVGYMDPGNWITSIAGGAQF
MNTH_STAA1       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAM       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAC       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAA2       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAA9       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAS       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAW       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAN       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAA8       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAE       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAA3       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAB       ------------------------SNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAAR       ------------------------SNKQKFLSFLGPGLLVAGGYMDSGNWITSMQGGAQY
MNTH_STAES       ------------------------SASQKFLAFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAEQ       ------------------------SASQKFLAFLGPGLLVAVGYMDPGNWITSMQGGAQY
MNTH_STAHJ       ------------------------RTSQKFLAFLGPGLLVAVGYMDPGNWITSMQGGAQF
MNTH_STAS1       ------------------------KFSQKLFSFLGPGLLVAVGYMDPGNWITSMQGGAQF
MNTH_MYCTU       ----------------GELAQDTRTSLKTSWYLLGPAFVAAIAYVDPGNVAANVSSGAQF
MNTH_MYCLE       ----------------KALAESTQAELKTSWYLLGPAFVAAIAYVDPGNVAANVSSGAQF
MNTH_SHIB3       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SHIBS       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO24       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO57       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO5E       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOLU       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOK1       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO45       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOL6       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOL5       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO7I       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO8A       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO81       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SHISS       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOUT       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ESCF3       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOBW       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECODH       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOSE       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOSM       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO55       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOLC       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOLI       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SHIF8       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECO27       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SHIDS       ----------------RVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ECOHS       ----------------RVESSSGRAARKTRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_CITK8       ----------------RVESSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALTY       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALPC       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALCH       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALEP       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALG2       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALSV       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALTI       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALPA       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_SALPK       ----------------RVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_CROS8       ----------------RVEQNRGRTARKLRLALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_ENT38       ----------------RVEGSSGRAARKLRFALMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_KLEP3       ----------------RVENSSSRAARKVKLALMGPAFVAAIGYIDPGNFATNIQAGASF
MNTH_KLEP7       ----------------RVENSSSRAARKVKLALMGPAFVAAIGYIDPGNFATNIQAGASF
MNTH_PECCP       ----------------RVIESTSRTSRKVKLSLMGPAFIAAIGYIDPGNFATNIQSGAAY
MNTH_BLOPB       ----------------QDSVTEHRSRRKIKFALLGPAFIAAIGYIDPGNFATNIQAGATF
MNTH_ERWT9       ----------------RTVERSVRSNRKIKFALMGPAFIAAIGYIDPGNFATNIQAGASY
MNTH_YERPE       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERPP       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERPA       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERPN       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERPS       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERPB       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERP3       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERPY       ----------------RAVDTSRRPLRKIKLSLMGPAFIAAIAYIDPGNFATNIQAGATF
MNTH_YERE8       ----------------RVVDTPPRTSRRIKLSLMGPAFIAAIGYIDPGNFATNIQAGASF
MNTH_AERHH       ----------------QPALTTAIPARKFKLTLLGPAFIAAIGYIDPGNFATNIQAGSTF
MNTH_VIBCB       ----------------AVSNVSAFNKTKRKLMMLGPAFIAAIGYIDPGNFATNIESGSSF
MNTH_CHRSD       ----------------AASTLSGKPRRWSWTAFFGPALIAAVAYIDPGNFATNIEAGSRY
MNTH_ACICJ       ----------------ADRLAGRA-GWRNPLIFAGPAVVASIAYMDPGNFATNIQAGARY
MNTH_VEREI       ----------------RAVLEGRRRGASMLLPFAGPAVVVSVAYMDPGNLATNIQAGARY
MNTH_GRABC       ----------------SKAIAGKSRGWKTGLLFAGPAVIASIAYVDPGNFATNIQAGSRY
MNTH_BURCM       ----------------RAALEGRRTGIAALLPFVGPAVIASIGYMDPGNFATNIQAGAAY
MNTH_DEIRA       ----------------TLRGTAGPRGVRRILPFLGPAVIASIAYMDPGNFATNIEGGARY
MNTH_BACSU       ----------------QDALDGKIRGFRGLLPFLGPAFIAAIAYIDPGNFATNISAGSKY
MNTH_CLOAB       ----------------LNRASSVTRNLKGLLKFLGPAFVVSVAYIDPGNFATNISGGSSF
MNTH_CALS4       ----------------LGI------ELKKFLKYLGPAFIVSVAYVDPGNFATNISGGSLF
NRAM1_ARATH      -----------------VSEKKSW---KNFFAYLGPGFLVSIAYIDPGNFETDLQAGAHY
NRAM6_ARATH      -----------------VPEKKSW---KNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQY
NRAM3_ORYSJ      -----------------IPEKNSW---KNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQY
NRAM1_ORYSJ      -----------------LRKEPAW---KRFLSHIGPGFMVCLAYLDPGNMETDLQAGANH
NRAM5_ORYSJ      -----------------LMKEPAW---KRFLAHVGPGFMVSLAYLDPGNLETDLQAGANH
NRAT1_ORYSJ      -----------------FRVQPRW---RKFLAHVGPGALVAIGFLDPSNLETDMQAGADF
NRAM4_ORYSJ      --------------LHGDVQAPTW---KRFLAHVGPGFVISIAYLDPSNLQTDLVAGSSH
NRAM3_ARATH      ----EEEDDLEHGVGCGGAPPFSW---KKLWLFTGPGFLMSIAFLDPGNLEGDLQAGAVA
NRAM4_ARATH      ----DEEEDADYDDDPGNSPKFSW---KKLWLFTGPGFLMSIAFLDPGNLESDLQAGAIA
NRAM2_ARATH      ----ESPDDPTTGDTP---PPFSW---RKLWLFTGPGFLMSIAFLDPGNLEGDLQAGAIA
NRAM6_ORYSJ      ADDDEEESGLATSTAASGIPPFSW---RKLWLFTGPGFLMSIAFLDPGNLEGDLQAGAVA
NRAM5_ARATH      ----EEDRD----KTYDSVPPFSW---AKLWKFTGPGFLMSIAFLDPGNIEGDLQAGAVA
NRAM2_ORYSJ      ----SDSEDGGGGGGDAMRPAFSW---RKLWRFTGPGFLMCIAFLDPGNLEGDLQAGAAA
NRAM1_DICDI      ----QKNKPYLIKVPNIDKPDSKWINFKTLWAFTGPGFLMSIAYLDPGNLESDIQAGAMA
NRAM1_BOVIN      ------------------SGTFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_BISBI      ------------------SGTFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_BUBBU      ------------------SGAFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_CEREL      ------------------SGAFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_SHEEP      ------------------SGAFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_HUMAN      ------------------PGTFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_CANLF      ------------------PGTFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_PIG        ------------------PGTFSL---RKLWAFTGPGFLMSIAYLDPGNIQSDLQAGAVA
NRAM1_MOUSE      ------------------QGTFSL---RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVA
NRAM1_CHICK      ------------------TPGFSF---RKLWAFTGPGFLMSIAYLDPGNVESDLQCGAVA
NRAM2_RAT        ------------------YSCFSF---RKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVA
NRAM2_MOUSE      ------------------YSCFSF---RKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVA
NRAM2_HUMAN      ------------------YSCFSF---RKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVA
MVL_DROME        -----------------TNVGFSF---RKLWAFTGPGFLMSIAYLDPGNIESDMQSGAAA
NRAMA_CAEEL      -----------------VEKAFSF---KKLWAFTGPGFLMSIAYLDPGNIESDLQSGAQA
NRAM2_DICDI      IENTDYSILVPFEDEENNNGSKSKFSIKKLKSFLGPALFISVGYMDPGNWATDLEGGSRF
SMF3_YEAST       -------------------MRSYMQILQKFAKFIGPGILVSVAYMDPGNYATSVSGGAQY
SMF2_YEAST       ----------------NSTSQSMIGTLRKYARFIGPGLMVSVSYMDPGNYSTAVAAGSAH
SMF1_YEAST       ----------------VSKRQVMRDIFAKYLKFIGPGLMVSVAYIDPGNYSTAVDAGASN
PDT1_SCHPO       ----------------SKYWKKCTYGIREYCKFIGPGFLIAVAYIDPGNYSTDLDAGSRF
                                                   **. . . .::*..*    :  *:  

MNTH_BRUME       GYALLSVVLLSNLMAVLLQALCTRLAVATGRDLAQACRDAYPRF-LAWPLWLLAELAICA
MNTH_BRUSU       GYALLSVVLLSNLMAVLLQALCTRLAVATGRDLAQACRDAYPRF-LAWPLWLLAELAICA
MNTH_AGRFC       GYTLLAVALVSNIMAIVLQSLCARLAIASGRDLAQACRDAYPKP-VAMVLWLLAEIAIIA
MNTH_LISMO       GYTLLSVILISNILAVLLQSLASKLGIVTGRDLAQASSDHFSKP-FGFVLWILAELAIIA
MNTH_LISMH       GYTLLSVILISNILAVLLQSLASKLGIVTGRDLAQASSDHFSKP-FGFVLWILAELAIIA
MNTH_LISMC       GYTLLSVILISNILAVLLQSLASKLGIVTGRDLAQASSDHFSKP-FGFVLWILAELAIIA
MNTH_LISMF       GYTLLSVILISNILAVLLQSLASKLGIVTGRDLAQASSDHFSKP-FGFVLWILAELAIIA
MNTH_LISW6       GYTLLSVILISNILAVLLQSLASKLGIVTGRDLAQASSDHFSKP-FGFVLWILAELAIIA
MNTH_LISIN       GYTLLSVILISNILAVLLQSLASKLGIVTGRDLAQASSDHFSKP-FGFVLWILAELAIIA
MNTH_NOSS1       GYTLLTVILLSNLMAILLQSLCVRLGVATGRDLAQACRDYFSPK-VSFCLWVLCEIAIAA
MNTH_BRADU       GYTLLSVILLSNLMAILLQSLAARLGIVTDRDLAQACRATYSPA-VNFLLWLACEAAIIA
MNTH_RHILO       GYTLLFVIMLSNLMAILLQALAARLGIATGRDLAQACRAYYPRP-VNFVLWIACELAIIA
MNTH_XANAC       GYLLLSVILLSNLMAIVLQGLSARLGIATGLDLAQACRARYPRG-VNLALWGICELAIIA
MNTH_XANCP       GYLLLSVILLSNLMAIVLQGLSARLGIATGLDLAQACRARYPRG-INLALWGLCELAIIA
MNTH_XYLFA       GYMLLSVILLSNVMAIVLQALAARLGIASDMDLAQACRARYSRG-TTLALWVVCELAIIA
MNTH_XYLFT       GYMLLSVILLSNVMAIVLQALAARLGIASDMDLAQACRARYSRG-TNLALWAVCELAIIA
MNTH2_PSEAE      GYLLLSVILLSSLMAMLLQALSARLGIASGLDLAQACRERYSPS-TCRLLWLACETAIIA
MNTH1_PSEAE      GYALLFVVVLASFSGMLLQSLCSRLGIATGRDLAQLSRERYRPG-VARGQWLLAELSIVA
MNTH_RALSO       GYSLLFVVLLSSLAAMVLQCLSARLGIVTGKDLARLSRERYRPG-AVRVQWLLAELSIVA
MNTH_LACBR       KYSLLSVILISSLIAMLLQSMAARLGIVTGKDLAQLTRERTSKT-MGIILWLITESAIMA
MNTH_PEDPA       RYTLLSVILLSSLIAMLLQAMSARLGIVTGKDLAQLTRERTSKR-VGFLLWIVAELAIMA
MNTH_LACP3       KYSLLSVILISSLIAMLLQAMAARLGIVTGRDLAQMTRDHTSKA-MGGFLWVITELAIMA
MNTH_LACCB       KYSLLSVILISSLIAMLLQAMAARLGIVTGRDLAQMTRDHTSKA-MGGFLWVITELAIMA
MNTH_LACBA       KYTLLTVVLLSSLVAMLLQAMSARLGIVTGKDLAQLTREHTGKR-TGFALWIITELAIMA
MNTH_LACPL       KYALLSVILLSSLIAMLLQAMAARLGIVTGKDLAQLTRERTSKG-MGIFLWIITELAIMA
MNTH_LACSS       AYTLISVILVSNLIAMLLQAMAARLGIVTGMDLAQMTRAKTGKK-MGIFLWIVTELAIMA
MNTH_STAA1       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAM       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAC       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAA2       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAA9       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAS       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAW       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAN       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAA8       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAE       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAA3       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAB       GYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAAR       GYTLLFGNLISRLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRP-IAIIFWIIAELAIIA
MNTH_STAES       GYTLLFIILISSLSAMLLQSMTVRLGIATGMDLAQMTRHFLNKP-VAIMFWIIAELAIIA
MNTH_STAEQ       GYTLLFIILISSLSAMLLQSMTVRLGIATGMDLAQMTRHFLNKP-VAIMFWIIAELAIIA
MNTH_STAHJ       GYTLLFVILISSLSAMLLQSMTVRLGIATDKDLAQMTRHYLNKP-TAIIFWVIAELAIIA
MNTH_STAS1       GYILLFVILLSSLSAMLLQSMTIRLGISTGMDLAQATKHYLNKP-VAFVFWIIAELAIIA
MNTH_MYCTU       GYLLLWVIVAANVMAALVQYLSAKLGLVTGRSLPEAIGKRMGRP-ARLAYWAQAEIVAMA
MNTH_MYCLE       GYLQLWVVVVANVLAGLVQYLSAKLGLVTGQSLPQAISKQMSHP-FRLGFWLQAELVAMA
MNTH_SHIB3       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SHIBS       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO24       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO57       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO5E       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOLU       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOK1       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO45       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOL6       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOL5       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO7I       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO8A       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO81       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SHISS       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOUT       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ESCF3       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOBW       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECODH       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOSE       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOSM       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO55       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOLC       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOLI       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SHIF8       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECO27       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-FVWFYWVQAEIIAMA
MNTH_SHIDS       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ECOHS       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_CITK8       GYKLLWVVVWANLMAMLIQVLSAKLGIATSKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALTY       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALPC       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALCH       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALEP       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALG2       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALSV       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALTI       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALPA       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_SALPK       GYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_CROS8       GYQLLWVVVWANLMAMLIQVLSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_ENT38       GYKLLWVVVWANLMAMLIQVLSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_KLEP3       GYQLLWVVVWANLMAMLIQVLSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_KLEP7       GYQLLWVVVWANLMAMLIQVLSAKLGIATGKNLAEQIRDHYPRP-VVWFYWVQAEIIAMA
MNTH_PECCP       GYTLLWVVVWANLMAMLIQLLSAKLGIATGKNLAEHIRDRFPRP-AVWAYWVQAEIIAMA
MNTH_BLOPB       GYQLLWVVVWANIMAMLIQLLSAKLGIATGKNLAEHIRDQFPRS-VVWMYWIQAEIIAMA
MNTH_ERWT9       GYQLLWVVVWANVMAMVIQLMSAKLGIATGKNLAEHIRDRFPRP-AVWFYWVQAEIIAMA
MNTH_YERPE       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERPP       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERPA       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERPN       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERPS       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERPB       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERP3       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERPY       GYTLLWVVVWANVMAMLVQLLSAKLGIATGKNLAEHIRDRFPRP-VVWAYWVQAEIIVMA
MNTH_YERE8       GYTLLWVVVWANFMAMLIQLLSAKLGIATGKNLAEHIRDRFPRP-AVWAYWVQAEIIAMA
MNTH_AERHH       GYQLLWVVVWANLMAMLVQTLSAKLGIVTGKNLAEHIRDRLPKP-AVWAYWVQAEIIAMA
MNTH_VIBCB       GYQLLWVVLWANLMAMLIQYLSAKLGIVTGKNLAEHLRDHLPNKWAVGFYWIQAEIIAIA
MNTH_CHRSD       GYTLLWVVLAANLMAMLIQTLSARLGLATGQNLPQVIRARYPRP-LVWCYWVQAEIVAIA
MNTH_ACICJ       GYDLLWVVLLASLIAMLFQGLSARLGIVTGRNLAELCRDTLPPA-LTIPMWIISEIAAMA
MNTH_VEREI       GYALLWVVLLANVVAMLFQSLSAKLGIVTGRNLAELCRERFSRP-VALAMWVVSEIAAMA
MNTH_GRABC       GYTLLWVVAAANLIAMLFQALSAKLGIATGRNLPELCRDHFSRP-LVIALWIISEIAAMA
MNTH_BURCM       GYRLLWVVLAANAIAMLFQAMSAKLGIVTGRNLAELCREHFPAP-IVWGMWIASEIAAMA
MNTH_DEIRA       GYSLLWVILAANLMAMVIQNLSANLGIASGRNLPELIRERWPRP-LVWFYWIQAELVAMA
MNTH_BACSU       GYMLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKP-VSIGLWIQGELVIIA
MNTH_CLOAB       NYNLIWVILWSNLMAIFLQTMSAKLGIATGCSLPEMCAKVFSKR-ANWIFWIVGELGAMA
MNTH_CALS4       DYHLIWVILWSNVIAIFLQIQSAKLGIATGYNLPEMCSIIFPRK-WNWFLWITAELAAMA
NRAM1_ARATH      KYELLWIILVASCAALVIQSLAANLGVVTGKHLAEQCRAEYSKV-PNFMLWVVAEIAVVA
NRAM6_ARATH      KYELLWIILVASCAALVIQSLAANLGVVTGKHLAEHCRAEYSKV-PNFMLWVVAEIAVVA
NRAM3_ORYSJ      KYELLWIILIASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKA-TNFILWILAELAVVA
NRAM1_ORYSJ      KYELLWVILIGLIFALIIQSLSANLGVVTGRHLAELCKTEYPVW-VKTCLWLLAELAVIA
NRAM5_ORYSJ      RYELLWVILIGLIFALIIQSLAANLGVVTGRHLAEICKSEYPKF-VKIFLWLLAELAVIA
NRAT1_ORYSJ      KYELLWVILVGMVFALLIQTLAANLGVKTGRHLAELCREEYPHY-VNIFLWIIAELAVIS
NRAM4_ORYSJ      RYSLLWVLLFGFIFVLTVQSLAANLGIITGRHLAELCMGEYPKY-VKYCLWLLAELGVIA
NRAM3_ARATH      GYSLLWLLMWATAMGLLVQLLSARLGVATGRHLAELCRDEYPTW-ARMVLWVMAELALIG
NRAM4_ARATH      GYSLIWLLMWATAIGLLIQLLSARLGVATGRHLAELCREEYPTW-ARMVLWIMAEIALIG
NRAM2_ARATH      GYSLLWLLMWATAMGLLIQMLSARVGVATGRHLAELCRDEYPTW-ARYVLWSMAELALIG
NRAM6_ORYSJ      GDTLLWLLLWATSMGLLVQLLAARVGVATGRHLAELCRDEYPSW-ARRALWLMAEVAMVG
NRAM5_ARATH      GYSLLWLLLWATLMGLLMQLLSARIGVATGRHLAEICRSEYPSW-ARILLWFMAEVALIG
NRAM2_ORYSJ      GYQLLWLLLWATVMGALVQLLSARLGVATGKHLAELCREEYPPW-ATRALWAMTELALVG
NRAM1_DICDI      GYQLLWVLFWSTVIGFWLQMLASRLGVVTGKHLAEHCREQYPKT-PRLLLWLMTELAIIG
NRAM1_BOVIN      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKV-PRILLWLTIELAIVG
NRAM1_BISBI      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKV-PRILLWLTIELAIVG
NRAM1_BUBBU      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKV-PRILLWLTIELAIVG
NRAM1_CEREL      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKV-PRILLWLTIELAIVG
NRAM1_SHEEP      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKV-PRTLLWLTIELAIVG
NRAM1_HUMAN      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKV-PRTVLWLTIELAIVG
NRAM1_CANLF      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEICHLYYPKV-PRTLLWLTIELAIVG
NRAM1_PIG        GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEICHLYYPKV-PRTLLWLNMELAIVG
NRAM1_MOUSE      GFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKV-PRILLWLTIELAIVG
NRAM1_CHICK      GFKLLWVLLWATVLGLLCQRLAIRLGVVTGKDLAEICYLYYPRV-PRVLLWLMMEIAIIG
NRAM2_RAT        GFKLLWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKV-PRIILWLMVELAIIG
NRAM2_MOUSE      GFKLLWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKV-PRIILWLMVELAIIG
NRAM2_HUMAN      GFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQYPKV-PRVILWLMVELAIIG
MVL_DROME        KYKILWVLLWATVLGLLMQRLAARLGVVTGLHLAEMCYRQYKRL-PRWILWIMIEIAIIG
NRAMA_CAEEL      AYKLLWVLLSAHIIGMLLQRMSARLGVVSGKHMAEVAYQFYPRL-PRIILWLMIEIAIVC
NRAM2_DICDI      GYQLMWVLLFSNIMALFLQTLVIKLALVTKNDLAQQCRKEYSKT-VNIFLWLILELAIIS
SMF3_YEAST       KYTLLFSIFISNIFAVLLQCLCVKLGTITGYDLAENCRHNLPKK-LNYTLYLFAEVAIIA
SMF2_YEAST       RYKLLFSVLVSNFMAAFWQYLCARLGAVTGLDLAQNCKKHLPFG-LNITLYILAEMAIIA
SMF1_YEAST       QFSLLCIILLSNFIAIFLQCLCIKLGSVTGLDLSRACREYLPRW-LNWTLYFFAECAVIA
PDT1_SCHPO       QYKLLFIVFLSNLFAVYLQSLCIRLGSVTGMDLARNCREHYNRY-ICWSFYVLAEIAIIA
                     :     .       *    .:.  :   : .               :   *     

MNTH_BRUME       TDLAEVIGTAIGLNLLFG--IPLEIGVILTAVDVLLVLYLQ------NKGFRRVEALIIT
MNTH_BRUSU       TDLAEVIGTAIGLNLLFG--IPLEIGVILTAVDVLLVLYLQ------NKGFRRVEALIIT
MNTH_AGRFC       TDIAEVIGTAIGLNLIFG--IPLELGVLITALDVFLILYLQ------KLGFRWVEALVIT
MNTH_LISMO       TDIAEVIGSAIALNLLFG--IPLIWGVCITALDIFLVLFLQ------HKGFRYIEVIVIT
MNTH_LISMH       TDIAEVIGSAIALNLLFG--IPLIWGVCITALDIFLVLFLQ------HKGFRYIEVIVIT
MNTH_LISMC       TDIAEVIGSAIALNLLFG--IPLIWGVCITALDIFLVLFLQ------HKGFRYIEVIVIT
MNTH_LISMF       TDIAEVIGSAIALNLLFG--IPLIWGVCITALDIFLVLFLQ------HKGFRYIEVIVIT
MNTH_LISW6       TDIAEVIGSAIALNLLFG--IPLIWGVCITALDIFLVLFLQ------HKGFRYIEVIVIT
MNTH_LISIN       TDIAEVIGSAIALNLLFG--IPLIWGVCITALDIFLVLFLQ------HKGFRYIEVIVIT
MNTH_NOSS1       CDLAELLGSAIALQLLFV--IPLIWGVCITALDVLVLLFLQ------HKGFRYTEALVIM
MNTH_BRADU       CDLAEVIGTAIALKLLFG--IPLIGGALIAALDAFLLLLLM------NRGFRFLEAFVIA
MNTH_RHILO       CDLAEVIGTAIALKLLFG--IPLIGGAILTALDAFLVLLLM------NKGFRYLEAFVIA
MNTH_XANAC       CDLAEVIGTAIALKLLFG--IPLTMGAIITAVDVVLVLLLM------NRGFRALEAFVIA
MNTH_XANCP       CDLAEVIGTAIALKLLFG--IPLTLGAIITALDVVLVLLLM------NRGFRALEAFVMA
MNTH_XYLFA       CDLAEVIGTAIALNLLLG--VPIIWGVVITAVDVVLVLLLM------HRGFRALEAFVIA
MNTH_XYLFT       CDLAEVIGTAIALNLLLG--VPIILGAVITAVDVVLVLLLM------HRGFRALEAFVIA
MNTH2_PSEAE      CDLAEVIGTAIALKLLFG--LPLAWGALLCVGDALLVLVLI------GRGQRPLEAFVVA
MNTH1_PSEAE      TDLAEVLGAALAFHLLLG--VSITTGVVLTAFDTLIVLALQ------GANFRRLEAIVLG
MNTH_RALSO       CDLAEVLGCALAFHLLLG--VPILGGVALTALDTLIVLGLK------GKNFRQLEAIVLG
MNTH_LACBR       TDVAEIIGSGIAIKLLFN--IPLVVGILITTADVLILLLLM------KLGFRKIEAIVAT
MNTH_PEDPA       TDIAEIIGSGIALELLFH--IPLIIGILITAADVLILLLLM------KLGFRKIEAIVAT
MNTH_LACP3       TDIAEIIGSAIALKLLFN--MPLIVGIIITTADVLILLLLM------RLGFRKIEAVVAT
MNTH_LACCB       TDIAEIIGSAIALKLLFN--MPLIVGIIITTADVLILLLLM------RLGFRKIEAVVAT
MNTH_LACBA       TDIAEIIGSAIALKLLFG--FPLIVGIIITAMDVLVLLVLM------KLGFRKIEAIVAT
MNTH_LACPL       TDVAEIIGSGIALKLLFG--FPLIVGILITTADVLILLLLM------KLGFRKIEAIVAT
MNTH_LACSS       TDIAEIIGSAIALELIFN--IPLLWGVLITAFDVLLLLLLM------KLGFRKIEAIVAT
MNTH_STAA1       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAM       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAC       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAA2       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAA9       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAS       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAW       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAN       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAA8       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAE       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAA3       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAB       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAAR       TDIAEVIGSAIALNLLFN--IPLIVGALITVLDVFLLLFIM------KYGFRKIEAIVGT
MNTH_STAES       TDIAEVIGSAIALDLIFG--IPLIVGALITVFDVFLLLFIM------KFGFRKIEAIVGT
MNTH_STAEQ       TDIAEVIGSAIALDLIFG--IPLIVGALITVFDVFLLLFIM------KFGFRKIEAIVGT
MNTH_STAHJ       TDIAEVIGSAIALDLLFN--IPLIIGALITVFDVFLLLFIM------KFGFRKIEAIVGT
MNTH_STAS1       TDIAEVIGSAIALDLLFG--IPLLVGALITVFDVFLLLFIM------RFGFRKIEAIVGT
MNTH_MYCTU       TDVAEVIGGAIALRIMFN--LPLPIGGIITGVVSLLLLTIQD-----RRGQRLFERVITA
MNTH_MYCLE       TDVAEIVGGAIAFHILFR--VSLLLGGVITGTVSLLLLMVKD-----RRGQLLFERVITG
MNTH_SHIB3       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SHIBS       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO24       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO57       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO5E       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOLU       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOK1       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO45       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOL6       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOL5       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO7I       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO8A       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO81       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SHISS       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOUT       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ESCF3       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOBW       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECODH       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOSE       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOSM       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO55       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOLC       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECOLI       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SHIF8       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_ECO27       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SHIDS       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLTLMLQ------RRGQKPLEKVIGG
MNTH_ECOHS       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_CITK8       TDLAEFIGAAIGFKLILG--ISLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALTY       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALPC       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALCH       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALEP       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALG2       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALSV       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALTI       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALPA       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_SALPK       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLEKVIGG
MNTH_CROS8       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------KRGQKPLEKVIGG
MNTH_ENT38       TDLAEFIGAAIGFKLILG--VSLLQGAVLTGIATFLILMLQ------RRGQKPLELVIGG
MNTH_KLEP3       TDLAEFIGAAIGFKLVLG--VSLLQGAVLTGVATFLILMLQ------RRGQKPLEKVIGG
MNTH_KLEP7       TDLAEFIGAAIGFKLVLG--VSLLQGAVLTGVATFLILMLQ------RRGQKPLEKVIGG
MNTH_PECCP       TDLAEFIGAAIGFKLLLG--VSLLEGAILTAIATFLILMLQ------QRGQKPLEMVIGG
MNTH_BLOPB       TDLAEFIGAAIGFKILLG--IPLLQGALLTGLITFLILTLQ------RYGKKPLEFVVGG
MNTH_ERWT9       TDLAEFIGAAIGFKLVFG--VTLLQGAMLTGVATFLILMLQ------NRGQKPLELVIGG
MNTH_YERPE       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERPP       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERPA       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERPN       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERPS       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERPB       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERP3       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERPY       TDLAEFIGAAIGFKLLFG--VTLLQGAVLTGIATFLILMLQ------NRGQKPLELVIGG
MNTH_YERE8       TDLAEFIGAAIGFKLLLG--VTLLEGAVLTGIATFLILMLQ------KRGQKPLELVIGG
MNTH_AERHH       TDLAEFIGAAVGFKLLLG--VTLLEGAGITAVVTWGILMLQ------SRGQKPLEFVVGG
MNTH_VIBCB       TDLAEFIGAAVGFQLVFG--ISLMEGAMITAVATVMILILN------QKGQKPLEVVIGS
MNTH_CHRSD       TDLAEFLGAALAFHLLFG--LSLMEGALLTGTITYLALHLY------RYGFRLMEILIGA
MNTH_ACICJ       TDLAEFLGGAIGIALLAH--LPLMAGMAITGIVTYGILLLD------RRGFRPMELVIGA
MNTH_VEREI       TDLAAFLGGAIGLSLLFR--MPLLGGMVVTAIVTYGLLLLE------DAGFRPLELAIGA
MNTH_GRABC       TDLAEFLGGAIGLALLFR--LPLIIGMVATAMITFALLLFE------KRGYRVMELVIGA
MNTH_BURCM       TDLAEFLGGALAFALLCH--LPLFAGMIATALATCAILALE------KRGFRPLEAAIAA
MNTH_DEIRA       TDLAEFLGAALAIQLLTG--LPMFWGAVVTGVVTFWLLNLQ------KRGTRPLELAVGA
MNTH_BACSU       TDLAEFIGAALGLYLLFG--IPMLEASIIAAIGSFAILELQ------RRGYRSLEAGIAG
MNTH_CLOAB       TDLAEFIGGTLGLYLLFR--IPMIYAGLLTGVLTFIIVYME------KYGQKMVETIIAA
MNTH_CALS4       TDLAEFLGGTMGLYLLFH--IPMTYAAFLTGVVTFAIVYME------KYGQKVVEGIIFG
NRAM1_ARATH      CDIPEVIGTAFALNMLFS--IPVWIGVLLTGLSTLILLALQ------KYGVRKLEFLIAF
NRAM6_ARATH      CDIPEVIGTAFALNMLFN--IPVWIGVLLTGLSTLILLALQ------QYGIRKLEFLIAF
NRAM3_ORYSJ      CDIPEVIGTAFALNMLFK--IPVWCGVLITGLSTLMLLLLQ------QYGVRKLEFLIAI
NRAM1_ORYSJ      SDIPEVIGTGFAFNLLFH--IPVWTGVLIAGSSTLLLLGLQ------RYGVRKLEVVVAL
NRAM5_ORYSJ      ADIPEVIGTAFAFNILFH--IPVWVGVLITGTSTLLLLGLQ------KYGVRKLEFLISM
NRAT1_ORYSJ      DDIPEVLGTAFAFNILLK--IPVWAGVILTVFSTLLLLGVQ------RFGARKLEFIIAA
NRAM4_ORYSJ      ATIPGVLGTALAYNMLLH--IPFWAGVLACGACTFLILGLQ------GYGARKMEFTISV
NRAM3_ARATH      SDIQEVIGSAIAIKILSNGILPLWAGVVITALDCFVFLFLE------NYGIRKLEAVFAV
NRAM4_ARATH      ADIQEVIGSAIAIKILSNGLVPLWAGVVITALDCFIFLFLE------NYGIRKLEAVFAI
NRAM2_ARATH      ADIQEVIGSAIAIQILSRGFLPLWAGVVITASDCFLFLFLE------NYGVRKLEAVFAV
NRAM6_ORYSJ      ADIQEVIGSAIAIKILSRGFLPLWAGVVITALDCFIFLSLE------NYGVRKLEAVFAI
NRAM5_ARATH      ADIQEVIGSAIALQILTRGFLPIWVGVIITSFDCFLISYLE------KCGMRKLEGLFAV
NRAM2_ORYSJ      ADIQEVIGSAIAIKILSAGTVPLWGGVVITAFDCFIFLFLE------NYGVRKLEAFFGV
NRAM1_DICDI      SDIQEVIGTAIALQILSNGHIPLWAGVLFTAADTFTFLFLE------KYGIRKLEAFFCS
NRAM1_BOVIN      SDMQEVIGTAIAFSLLSAGRIPLWGGVLITVVDTFFFLFLD------NYGLRKLEAFFGF
NRAM1_BISBI      SDMQEVIGTAIAFSLLSAGRIPLWGGVLITIVDAFFFLFLD------NYGLRKLEAFFGF
NRAM1_BUBBU      SDMQEVIGTAIAFSLLSAGRIPLWGGVLITVVDTFFFLFLD------NYGLRKLEAFFGF
NRAM1_CEREL      SDMQEVIGTAIAFSLLSAGRIPLWGGVLITIVDTFFFLFLD------NYGLRKLEAFFGF
NRAM1_SHEEP      SDMQEVIGTAIAFSLLSAGRIPLWGGVLITIVDTFFFLFLD------NYGLRKLEAFFGF
NRAM1_HUMAN      SDMQEVIGTAIAFNLLSAGRIPLWGGVLITIVDTFFFLFLD------NYGLRKLEAFFGL
NRAM1_CANLF      SDMQEVIGTAIAFSLLSAGRIPLWGGVLITIVDTFFFLFLD------NYGLRKLEAFFGI
NRAM1_PIG        SDMQEVIGTAIAFNLLSAGRIPLWGGVLITVVDTFFFLYLN------NYGLRKLEAFFAF
NRAM1_MOUSE      SDMQEVIGTAISFNLLSAGRIPLWDGVLITIVDTFFFLFLD------NYGLRKLEAFFGL
NRAM1_CHICK      SDMQEVIGTAIAFSLLSAGRIPLWGGVLITITDTLFFLFLD------KYGLRKLEAFFGF
NRAM2_RAT        SDMQEVIGSAIAINLLSAGRVPLYGGVLITIADTFVFLFLD------KYGLRKLEAFFGF
NRAM2_MOUSE      SDMQEVIGSAIAINLLSAGRVPLWGGVLITIADTFVFLFLD------KYGLRKLEAFFGF
NRAM2_HUMAN      SDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLD------KYGLRKLEAFFGF
MVL_DROME        SDMQEVIGTAIAIYLLSNKVVPLWGGVLITIVDTFTFLFLD------KYGLRKLEFLFGT
NRAMA_CAEEL      SDMQEVIGTAIAIFLLSKGFVPLYVGVFITILDTFTFLLID------RYGIRKLELIFGF
NRAM2_DICDI      TDLAEVIGTAIGLNILFG--LPLIAGVAITSLDTLLFLAIQ------RWGIRKLELLILL
SMF3_YEAST       TDLAEVVGTAIALQILFK--IPLTWGVLLTVLDVLVILMFYTPNGQSLKKVRVFEFGVGI
SMF2_YEAST       TDLAEVVGTAISLNILFH--IPLALGVILTVVDVLIVLLAYKPNG-SMKGIRIFEAFVSL
SMF1_YEAST       TDIAEVIGTAIALNILIK--VPLPAGVAITVVDVFLIMFTYKPGASSIRFIRIFECFVAV
PDT1_SCHPO       TDIAEVIGTAVALKILMH--IPLVAGVVITILDVLLVLIAWRPEG-SMLSVRIFETAVAL
                   :  .:*  ..  ::    ...  .                            *  .  

MNTH_BRUME       LLGVIALCFLTQIIMA-QPQWGEVIKG-FAPTTEIVSNPDMLYIALGIIGATVMPHNLYL
MNTH_BRUSU       LLGVIALCFLTQIIMA-QPQWGEVIKG-FAPTTEIVSNPDMLYIALGIIGATVMPHNLYL
MNTH_AGRFC       LLGVIAVCFAIQLALA-DPDWGQVILG-FAPTTEIVTNPDMLYLALGILGATVMPHNLYL
MNTH_LISMO       LMVTILVCFGAEMVMS-HPDMQAIAKG-FIPQSEIVTNPAMLYIALGILGATVMPHNLYL
MNTH_LISMH       LMVTILVCFGAEMVMS-HPDMQAIAKG-FIPQSEIVTNPAMLYIALGILGATVMPHNLYL
MNTH_LISMC       LMVTILVCFGAEMVMS-HPDMQAIAKG-FIPQSEIVTNPAMLYIALGILGATVMPHNLYL
MNTH_LISMF       LMVTILVCFGAEMVMS-HPDMQAIAKG-FIPQSEIVTNPAMLYIALGILGATVMPHNLYL
MNTH_LISW6       LMVTILVCFGAEMVMS-HPDMQAIAKG-FIPQSEIVTNPAMLYIALGILGATVMPHNLYL
MNTH_LISIN       LMVTILVCFGAEMVMS-HPDMQAIAKG-FIPQSEIVTNPAMLYIALGILGATVMPHNLYL
MNTH_NOSS1       LVATVGICFTAEILFS-RPDMGGILLG-YLPKKEILQNPEMLYIAIGILGATVMPHNLYL
MNTH_BRADU       LLAVIAVCFAVQIVAA-APPVAEVLHG-FMPKSEIFTNPEMLYIAIGIIGATVMPHNLYL
MNTH_RHILO       LLIIIFSCFAIQIFVA-APPAGTILHSMFVPSSEIVTNPAMLYIAIGIIGATVMPHNLYL
MNTH_XANAC       LLLIIFACFGIQIALA-APPIAAVLGG-FIPRAQVVTDPQALYLAIGIIGATVMPHNLYL
MNTH_XANCP       LLLVIFVCFGIQIALA-APPIAAVLAG-FIPRAEVVTNPHALYLAIGIIGATVMPHNLYL
MNTH_XYLFA       LLLVIFGCFVVQIVLA-APPLQEVLGG-FVPRWQVVADPQALYLAIGIVGATVMPHNLYL
MNTH_XYLFT       LLLVIFGCFVVQIVLA-APPLQEVLGG-FVPRWQVVADPQALYLAIGIVGATVMPHNLYL
MNTH2_PSEAE      LLTLIFACFAVQLLLS-RPELGEVLQG-FLPSPRVLSDPAALYLAIGIVGATVMPHNLYL
MNTH1_PSEAE      LIATIGACFFVELVLI-GPYWPDVAAG-LRPSWDTLSSQEPLYLAIGILGATVMPHNLYL
MNTH_RALSO       LILTIGLCYFVELALI-RPHWPSVAGA-LVPSWQALSAREPLYLAIGILGATVMPHNLYL
MNTH_LACBR       LVAVILLVFTYEVFLA-GPQLDQMFAG-YMPTKDIVTNKSMLYLALGIVGATVMPHDLYL
MNTH_PEDPA       LVAVILIVFAYEVLLS-DPSISGIIKG-YVPSVEILGNNSMLYLSLGIVGATVMPHDLYL
MNTH_LACP3       LVLVILLVFAYEVILA-QPNVPELLKG-YLPHADIVTNKSMLYLSLGIVGATVMPHDLFL
MNTH_LACCB       LVLVILLVFAYEVILA-QPNVPELLKG-YLPHADIVTNKSMLYLSLGIVGATVMPHDLFL
MNTH_LACBA       LVAVILFVFLYEVILA-QPHMGEVLKG-YLPSSTVVTNHGMLYLSLGIVGATVMPHDLYL
MNTH_LACPL       LVAVILFVFLYEVIIS-QPNIPEMLKG-YVPTSRIVSNRSMLFLALGIVGATVMPHNLYL
MNTH_LACSS       LVAVILFVFLYEVILA-QPNMGDVVRG-FVPSPRIMTDKKMLFLALGIVGATVMPHNLYL
MNTH_STAA1       FIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAM       FIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAC       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAA2       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAA9       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAS       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAW       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAN       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAA8       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAE       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAA3       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAB       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAAR       LIFTVLFIFIFEVYIS-SPQLNAVLNG-FIPHSEIITNNGILYIALGIIGATIMPHNLYL
MNTH_STAES       LIFTVLAIFVFEVYIS-SPHIIDMLNG-FVPHKEIITNQGILYIALGIIGATIMPHNLYL
MNTH_STAEQ       LIFTVLAIFVFEVYIS-SPQITDMLNG-FVPHKEIITNQGILYIALGIIGATIMPHNLYL
MNTH_STAHJ       LIFTVLMIFVFEVYIS-SPNLIEILNG-FVPHYQIIANHSILYIALGIIGATIMPHNLYL
MNTH_STAS1       LIFTVLVIFVFEVFIA-SPHVTEVLNG-FVPSSTIITDNGALFIALGIIGATIMPHNLYL
MNTH_MYCTU       LLLVIAIGFTASFFVV-TPP-PNAVLGGLAPRFQGTE---SVLLAAAIMGATVMPHAVYL
MNTH_MYCLE       LLFVIVVGFTSSFFVA-TPS-PEDMVNGLLPRFQGTE---SVLLAAAIIGATVMPHAVYL
MNTH_SHIB3       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_SHIBS       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO24       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO57       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO5E       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOLU       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOK1       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO45       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOL6       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOL5       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO7I       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO8A       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO81       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_SHISS       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOUT       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ESCF3       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOBW       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECODH       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOSE       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOSM       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO55       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOLC       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOLI       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_SHIF8       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECO27       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_SHIDS       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ECOHS       LLLFVAAAYIVELIFS-QPNLAQLGKGMVIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_CITK8       LLLFVAAAYIVELIFS-QPSLAQLSKGMIIPSLPNSE---AVFLAAGVLGATIMPHVIYL
MNTH_SALTY       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALPC       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALCH       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALEP       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALG2       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALSV       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALTI       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALPA       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_SALPK       LLLFVAAAYIVELFFS-QPDMAQLGKGMVIPALPNPE---AVFLAAGVLGATIMPHVIYL
MNTH_CROS8       LLLFVAAAYIVELFFS-QPKLAELGKGMLIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_ENT38       LLLFVAAAYIVELVFS-QPNLVQLSKGMAIPSLPTSE---AVFLAAGVLGATIMPHVIYL
MNTH_KLEP3       LLLFVAVAYVVELIFS-QPALAPLTKGLVIPTLPNGE---AVFLAAGVLGATIMPHVIYL
MNTH_KLEP7       LLLFVAVAYVVELIFS-QPALAPLTKGLVIPTLPNGE---AVFLAAGVLGATIMPHVIYL
MNTH_PECCP       LLLFVAAAYIVELVFS-QPELSALAKGMAMPSLPTSD---AVLLAAGVLGATIMPHVIYL
MNTH_BLOPB       LLFFVAIAYVIELFYS-KPKFIMLGMSMLLPILPNRE---AVFLSAGVLGATIMPHVIYL
MNTH_ERWT9       LLLFVAAAYVIELFFS-QPKVVDLLQGMAVPSLPTAD---AVLLAAGVLGATIMPHVIYL
MNTH_YERPE       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERPP       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERPA       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERPN       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERPS       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERPB       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERP3       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERPY       LLLFVAAAYIVELIFS-QPDIAALGRGMLIPNLPDGN---AVFLAAGVLGATIMPHVIYL
MNTH_YERE8       LLLFVAAAYIVELVFS-RPEIAALGRGMLIPDLPNRD---AVFLAAGVLGATIMPHVIYL
MNTH_AERHH       LLLFVAAAYIVELVFS-RPHLPSLLEGALFPGLPNSD---AVYLAAGVLGATVMPHVIYL
MNTH_VIBCB       LLMLVAVIYIAELFFA-HPAGGEMVKGLLTPTFTDSH---QIYLAAGILGATVMPHVIYL
MNTH_CHRSD       MILAVAGGFILELVLS-RPEPAPLLKGLLIPGFPDGY---ALYLAAGILGATVMPHVIYL
MNTH_ACICJ       LVGVIALCYLAELLIV-PVHWRQAALHTVLPSLPDAE---ALTIAVGIVGATVMPHALFL
MNTH_VEREI       LVGIIGLSYLAELFIT-PIAWSSVLAHTVSPRFPDAN---ALLIAVGIVGATVMPHALFL
MNTH_GRABC       LVATIGLCYLAEMFIA-PVDWTAAAWATITPRLPDAT---ALTIATGIVGATVMPHAVYL
MNTH_BURCM       LVGVIGACYLGELMIA-PQDWHAAAFHLVVPQIPDRA---ALTIAVGIIGATIMPHTLYL
MNTH_DEIRA       FVLMIGVAYLVQVVLA-RPDLAAVGAGFV-PRLQGPG---SAYLAVGIIGATVMPHVIYL
MNTH_BACSU       MLFVVVIAFALQTFFA-KPDAVSVMKGLFVPAFHGTD---SVLLAAGILGATVMPHAIYL
MNTH_CLOAB       LIAVICVAYTIELFLA-RPAWTQVGMHTLIPSLPNGE---AVLIAVGMLGATVMPHVIYL
MNTH_CALS4       LVAVISLAYAFELFIA-RPDWSKVLYHTFIPSIPNKD---AMLIAVGILGATVMPHVIYL
NRAM1_ARATH      LVFTIAICFFVELHYS-KPDPGEVLHGLFVPQLKGNG---ATGLAISLLGAMVMPHNLFL
NRAM6_ARATH      LVFTIALCFFVELHYS-KPDPKEVLYGLFVPQLKGNG---ATGLAISLLGAMVMPHNLFL
NRAM3_ORYSJ      LVSLIATCFLVELGYS-KPNSSEVVRGLFVPELKGNG---ATGLAISLLGAMVMPHNLFL
NRAM1_ORYSJ      LVFVMAGCFFVEMSIV-KPPVNEVLQGLFIPRLSGPG---ATGDSIALLGALVMPHNLFL
NRAM5_ORYSJ      LVFVMAACFFGELSIV-KPPAKEVMKGLFIPRLNGDG---ATADAIALLGALVMPHNLFL
NRAT1_ORYSJ      FMFTMAACFFGELSYL-RPSAGEVVKGMFVPSLQGKG---AAANAIALFGAIITPYNLFL
NRAM4_ORYSJ      LMLVMATCFFMELGKV-NPPAGGVIEGLFIPRPKGDY---STSDAVAMFGSLVVPHNLFL
NRAM3_ARATH      LIATMGVSFAWMFGQA-KPSGSELLIGILVPKLSSR----TIQKAVGVVGCIIMPHNVFL
NRAM4_ARATH      LIATMALAFAWMFGQT-KPSGTELLVGALVPKLSSR----TIKQAVGIVGCIIMPHNVFL
NRAM2_ARATH      LIATMGLSFAWMFGET-KPSGKELMIGILLPRLSSK----TIRQAVGVVGCVIMPHNVFL
NRAM6_ORYSJ      LIATMAVSFAWMFTDT-KPNMKNLFIGILVPKLSSR----TIRQAVGVVGCVIMPHNVFL
NRAM5_ARATH      LIATMALSFAWMFNET-KPSVEELFIGIIIPKLGSK----TIREAVGVVGCVITPHNVFL
NRAM2_ORYSJ      LIAVMAVSFAIMFGET-KPSGKELLIGLVVPKLSSR----TIKQAVGIVGCIIMPHNVFL
NRAM1_DICDI      LIAIMAISFGVEYIIS-KPDQIEVVKGVFIPLCSQN----NISQAVGILGAVVMPHNIYL
NRAM1_BOVIN      LITIMALTFGYEYVVA-QPAQGALLQGLFLPSCPGCGQP-ELLQAVGIIGAIIMPHNIYL
NRAM1_BISBI      LITIMALTFGYEYVVA-QPAQGALLQGLFLPSCPGCGQP-ELLQAVGIIGAIIMPHNIYL
NRAM1_BUBBU      LITIMALTFGYEYVVA-QPAQGALLQGLFLPSCRGCGQP-ELLQAVGIIGAIIMPHNIYL
NRAM1_CEREL      LITIMALTFGYEYVVA-RPAQGALLQGLFLPSCAGCGQP-ELLQAVGIVGAIIMPHNIYL
NRAM1_SHEEP      LITIMALTFGYEYVVA-RPAQGALLQGLFLPSCPGCGQP-ELLQAVGIVGAIIMPHNIYL
NRAM1_HUMAN      LITIMALTFGYEYVVA-RPEQGALLRGLFLPSCPGCGHP-ELLQAVGIVGAIIMPHNIYL
NRAM1_CANLF      LITIMALTFGYEYVVA-RPAQVALLQGLLLPSCPGCGRP-ELLQAVGIVGAIIMPHNIYL
NRAM1_PIG        LIAIMAFTFGYEYVVA-RPAQGALLRGLFLPSCSGCGQP-ELLQAVGIVGAIIMPHNIYL
NRAM1_MOUSE      LITIMALTFGYEYVVA-HPSQGALLKGLVLPTCPGCGQP-ELLQAVGIVGAIIMPHNIYL
NRAM1_CHICK      LITIMALTFGYEYVMV-RPAQTEVLKGIFLPYCPGCGRE-ELLQAVGIVGAIIMPHNIFL
NRAM2_RAT        LITIMALTFGYEYVTV-KPSQSQVLRGMFVPSCSGCHTP-QVEQAVGIVGAVIMPHNMYL
NRAM2_MOUSE      LITIMALTFGYEYITV-KPSQSQVLRGMFVPSCPGCRTP-QVEQAVGIVGAVIMPHNMYL
NRAM2_HUMAN      LITIMALTFGYEYVTV-KPSQSQVLKGMFVPSCSGCRTP-QIEQAVGIVGAVIMPHNMYL
MVL_DROME        LITIMAVSFGYEYIVS-APNQGEVLEGMFVPWCSNCNSN-VLLQAVGVVGAVIMPHNLYL
NRAMA_CAEEL      LILTMTVSFGYEFVVV-KPPIGEVISGMVVPWCAGCGKG-EFMQAISVVGAVIMPHNLYL
NRAM2_DICDI      LLSMITMCFVIELFLS-KPIASEVFSGFVPRLNSDS-----VMVATGIVGATTMPHNLFL
SMF3_YEAST       LVIGTCICFVLELFKV-SIPDKAELFKGFLPSNIIFKEQQALYISLGILGATVMPHSLYL
SMF2_YEAST       LVVLTVVCFTVELFYA-KLGPAKEIFSGFLPSKAVFE-GDGLYLSLAILGATVMPHSLYL
SMF1_YEAST       LVVGVCICFAIELAYIPKSTSVKQVFRGFVPSAQMFD-HNGIYTAISILGATVMPHSLFL
PDT1_SCHPO       LVLVVAISFAVVLGRV-HIGGAGTVFKGFLPSSTVFS-REGLYSSIGILGATVMPHSLFL
                 ::      :                                   : .:.*.   *: ::*

MNTH_BRUME       HSGIVQTRDYGHTT-------------------------------AEKREAIRYATLDST
MNTH_BRUSU       HSGIVQTRDYGHTT-------------------------------AEKREAIRYATLDST
MNTH_AGRFC       HSGIVQTREIGPTI-------------------------------AEKREALKFATLDST
MNTH_LISMO       HSSIVQTRQYARTK-------------------------------EGKKEAIRFSFIDST
MNTH_LISMH       HSSIVQTRQYARTK-------------------------------EGKKEAIRFSFIDST
MNTH_LISMC       HSSIVQTRQYARTK-------------------------------EGKKEAIRFSFIDST
MNTH_LISMF       HSSIVQTRQYARTK-------------------------------EGKKEAIRFSFIDST
MNTH_LISW6       HSSIVQTRQYARTK-------------------------------EGKKEAIRFSFIDST
MNTH_LISIN       HSSIVQTRQYARTK-------------------------------EGKREAIRFSFIDST
MNTH_NOSS1       HSSIVQTRDWQPTT-------------------------------EKRWEAIKFGTIDST
MNTH_BRADU       HSSIVQTRAYERNE-------------------------------TGRREAIKWATTDST
MNTH_RHILO       HSSIVQTRAYERTE-------------------------------KGKRDAIKWATTDST
MNTH_XANAC       HSSIVQTRAYPRTD-------------------------------VGRKSALRWAVTDST
MNTH_XANCP       HSSIVQTRAYPRTD-------------------------------AGRRSALRWAVTDST
MNTH_XYLFA       HSSIVQTRAYPRTP-------------------------------VGRRSALRWAVADST
MNTH_XYLFT       HSSIVQTRAYPRTP-------------------------------VGRRSALRWAVADST
MNTH2_PSEAE      HSSLVQSRAYPRSL-------------------------------AGKRKALRWAVADSS
MNTH1_PSEAE      HSSVVQTRVSGDDA-------------------------------ASKRSAIRFSRLDTI
MNTH_RALSO       HSSIVQTRVVSETE-------------------------------PARREAVGLSRLDTI
MNTH_LACBR       GSSISQTRAVDRHDR------------------------------QDVAKAIKFTTIDSN
MNTH_PEDPA       GSSISQTREVDRKDR------------------------------ENVAQAIRFSTIDSN
MNTH_LACP3       GSSISQTRKIDRTKH------------------------------EEVKKAIKFSTIDSN
MNTH_LACCB       GSSISQTRKIDRTKH------------------------------EEVKKAIKFSTIDSN
MNTH_LACBA       GSSISQTRSFDRKNR------------------------------KSVAQAIKFTTIDSN
MNTH_LACPL       GSSISQTRQVDRSDE------------------------------KEVAKAVKFTTIDSN
MNTH_LACSS       HSSIAQARQYDRDDV------------------------------AEKRKAIKFTVIDSN
MNTH_STAA1       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAAM       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAAC       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAA2       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAA9       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAAS       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAAW       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAAN       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAA8       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAAE       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAA3       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAAB       HSSIVQSRTYSRHNN------------------------------EEKSQAIKFATIDSN
MNTH_STAAR       HSSIVQSRTYSRHNN------------------------------EEKAQAIKFATIDSN
MNTH_STAES       HSSIVQSRKYDRHSI------------------------------HEKAQAIKYATIDSN
MNTH_STAEQ       HSSIVQSRKYDRHSI------------------------------HEKAQAIKYATIDSN
MNTH_STAHJ       HSSIVQSRKYNRHSF------------------------------TEKAQAIKFATIDSN
MNTH_STAS1       HSSIVQSRMYDRNSI------------------------------QSKAHAIKYATMDSN
MNTH_MYCTU       HSGLARDRHGHPDPG------------------------------PQRRRLLRVTRWDVG
MNTH_MYCLE       HSGLALDRHGHPHAG------------------------------RSRRRLLRVTRLDVI
MNTH_SHIB3       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_SHIBS       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO24       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO57       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO5E       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOLU       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOK1       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO45       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOL6       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOL5       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO7I       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO8A       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO81       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_SHISS       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOUT       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ESCF3       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOBW       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECODH       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOSE       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOSM       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO55       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOLC       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOLI       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_SHIF8       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_ECO27       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_SHIDS       HSSLTQH---LYG--------------------------------GSRQQRYSATKWDVA
MNTH_ECOHS       HSSLTQH---LHG--------------------------------GSRQQRYSATKWDVA
MNTH_CITK8       HSSLTQH---LHG--------------------------------GSRQQRYAATKWDVA
MNTH_SALTY       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALPC       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALCH       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALEP       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALG2       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALSV       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALTI       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALPA       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_SALPK       HSSLTQH---LHG--------------------------------GTRQQRYSATKWDVA
MNTH_CROS8       HSSLTQN---LHD--------------------------------GSRKERYSATKWDVA
MNTH_ENT38       HSSLTQN---AHD--------------------------------GTRQERYSATKWDVG
MNTH_KLEP3       HSSLTQH---LHG--------------------------------GTRKERYNATRWDVA
MNTH_KLEP7       HSSLTQH---LHG--------------------------------GTRKERYNATRWDVA
MNTH_PECCP       HSSLTQH---EGS--------------------------------HTRAERYSATKVDVA
MNTH_BLOPB       HSSLTQD---ESKT-------------------------------ASRSERYSSTKLDVA
MNTH_ERWT9       HSSLTQN---SGDQ-------------------------------GSRSERYSSTKLDVA
MNTH_YERPE       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERPP       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERPA       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERPN       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERPS       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERPB       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERP3       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERPY       HSALTQT---GGE--------------------------------ESKTERYASTKFDVA
MNTH_YERE8       HSSLTQT---AGE--------------------------------NSKADRYASTKLDVA
MNTH_AERHH       HSALTQH---TQDQ-------------------------------GSVPQRLHTTRVDVA
MNTH_VIBCB       HSALFKN---SYG--------------------------------ESTKTRLRTTRFDVL
MNTH_CHRSD       HSALSQQRIQVKDD-------------------------------AHRLRLMRYYRLDVI
MNTH_ACICJ       HSGLSGARVAPQDA-------------------------------AQRRRLVRYSNIEVL
MNTH_VEREI       HSGLTQRRTPARTE-------------------------------RERAVLLKFSNIEVV
MNTH_GRABC       HSGLAQNRAAAATDD------------------------------ASRHRLIRFSNREVI
MNTH_BURCM       HSGLTQDRIAPRDD-------------------------------TERRRLMRFSNREVV
MNTH_DEIRA       HSALTQGRIQTDTT-------------------------------EEKRRLVRLNRVDVI
MNTH_BACSU       HSALTQRRVVGKTD-------------------------------AERKKIFRFEFIDIL
MNTH_CLOAB       HSELVQHRNTNSSD-------------------------------KEKLHHLKMEKIDIL
MNTH_CALS4       HSQLVQYRNKDGSL-------------------------------QAKKEHLKMEKIDIL
NRAM1_ARATH      HSALVLSRKIPRSAS-------------------------------GIKEACRFYLIESG
NRAM6_ARATH      HSALVLSRKIPRSVT-------------------------------GIKEACRYYLIESG
NRAM3_ORYSJ      HSALVLSRKVPRSVH-------------------------------GIKEACRFYMIESA
NRAM1_ORYSJ      HSALVLSRNTPASAK-------------------------------GMKDVCRFFLFESG
NRAM5_ORYSJ      HSALVLSRKTPASVR-------------------------------GIKDGCRFFLYESG
NRAT1_ORYSJ      HSALVLSRKTPRSDK-------------------------------SIRAACRYFLIECS
NRAM4_ORYSJ      HSSLVLTRKMPYTSK-------------------------------GRKDASTFFLLENA
NRAM3_ARATH      HSALVQSREVDKRQK------------------------------YRVQEALNYYTIEST
NRAM4_ARATH      HSALVQSREVDPKKR------------------------------FRVKEALKYYSIEST
NRAM2_ARATH      HSALVQSRKIDPKRK------------------------------SRVQEALNYYLIESS
NRAM6_ORYSJ      HSALVQSRKIDPNKE------------------------------HQVREALRYYSIEST
NRAM5_ARATH      HSALVQSRKTDPKEI------------------------------NRVQEALNYYTIESS
NRAM2_ORYSJ      HSALVQSRKIDTNKK------------------------------SRVQEAVFYYNIESI
NRAM1_DICDI      HSALVQSREIDRKSE------------------------------TQVKIANKYNRLESA
NRAM1_BOVIN      HSSLVKSREVDRSRR------------------------------ADIREANMYFLIEAT
NRAM1_BISBI      HSSLVKSREVDRSRR------------------------------ADIREANMYFLIEAT
NRAM1_BUBBU      HSSLVKSREVDRSRR------------------------------ADIREANMYFLIEAT
NRAM1_CEREL      HSSLVKSREVDRSRR------------------------------ADIREANMYFLIEAT
NRAM1_SHEEP      HSSLVKSREVDRSRR------------------------------ADIREANMYFLIEAT
NRAM1_HUMAN      HSALVKSREIDRARR------------------------------ADIREANMYFLIEAT
NRAM1_CANLF      HSALVKSREIDRSRR------------------------------PDIREANMYFLIEAS
NRAM1_PIG        HSALVKSREVDRTRR------------------------------EDIREANMYFLIEST
NRAM1_MOUSE      HSALVKSREVDRTRR------------------------------VDVREANMYFLIEAT
NRAM1_CHICK      HSSLVKTRAIDRSKK------------------------------EEVKEANMYFLTESC
NRAM2_RAT        HSALVKSRQVNRANK------------------------------QEVREANKYFFIESC
NRAM2_MOUSE      HSALVKSRQVNRANK------------------------------QEVREANKYFFIESC
NRAM2_HUMAN      HSALVKSRQVNRNNK------------------------------QEVREANKYFFIESC
MVL_DROME        HSALVKSRDIDRRQT------------------------------KKVSEANFYFFIEAS
NRAMA_CAEEL      HSALVKSRRVDRKDR------------------------------RRVAEANKYFTLESA
NRAM2_DICDI      HGSVVKSRKIPNDRRK-----------------------------SVIKQAYRYNVIDTV
SMF3_YEAST       GSSIVKPRLHDYDLKK-----------------------YGKVNARPSLSAIKYTLNYAY
SMF2_YEAST       GSGVVQPRLREYDIKNGHYLPDAND------------MDNNHDNYRPSYEAISETLHFTI
SMF1_YEAST       GSALVQPRLLDYDVKHGNYTVSEEQDKVKKSKSTEEIMEEKYFNYRPTNAAIKYCMKYSM
PDT1_SCHPO       GSGLVQTRLRDLDVRRGNYTPV-----------------GDCSDYRPTHETIKHSLTYSI
                  . :                                                        

MNTH_BRUME       IALTFALVINASILILAAASFHATGHTGVEDLDKAHALLNP-----LLGSA---------
MNTH_BRUSU       IALTFALVINASILILAAASFHATGHTGVEDLDKAHALLNP-----LLGSA---------
MNTH_AGRFC       IALMFALLINASILILAAATFNKTGQTNVAELGEAHSLLAP-----LLGLA---------
MNTH_LISMO       FSLTIALLINASILILAAAAFYTTGQHNVAGIEDAYKLLNP-----TLGSS---------
MNTH_LISMH       FSLTIALLINASILILAAAAFYTTGQHNVAGIEDAYKLLNP-----TLGSS---------
MNTH_LISMC       FSLTIALLINASILILAAAAFYTTGQHNVAGIEDAYKLLNP-----TLGSS---------
MNTH_LISMF       FSLTIALLINASILILAAAAFYTTGQHNVAGIEDAYKLLNP-----TLGSS---------
MNTH_LISW6       FSLTIALLINASILILAAAAFYTTGQHNVAGIEDAYKLLNP-----TLGSS---------
MNTH_LISIN       FSLTIALLINASILILAAAAFYTTGQHNVAGIEDAYKLLNP-----TLGSS---------
MNTH_NOSS1       FALSLALFINSAILIVSAATFHFSGNQNVAEIQDAYKLLSP-----LLGVS---------
MNTH_BRADU       IALMLALFINAAILVVAAATFHKSGHSDVAEIGQAFELLSP-----LLGLG---------
MNTH_RHILO       IALMLALFVNAAILIVSAVAFHNTGHQDVAEIDQAFELLSP-----LLGLG---------
MNTH_XANAC       VALMFALFINASILILAAAVFHAQGRTDVQEIEQAHALLAP-----MLGVG---------
MNTH_XANCP       VALMFALFINAAILILAAAVFHAQGRTDVQEIEQAHALLAP-----MLGVG---------
MNTH_XYLFA       LALMLALFINASILILAAAVFHAQHHFDVEEIEQAYQLLAP-----VLGVG---------
MNTH_XYLFT       LALMLALFINASILILAAAVFHAQHHFDVEEIEQAYQLLAP-----VLGVG---------
MNTH2_PSEAE      LALTLALLVNAAILIVAASVFHRNGHTEVVDIEQAHALLSP-----LLGLE---------
MNTH1_PSEAE      GSLSLALLVNAAILILAAAAFHGSGHTEVVEIQDAYHLLDP-----LVGGA---------
MNTH_RALSO       VSLSLALLVNGAILVLAAAAFHANGHQDVADIQDAHRLLEP-----IVGTA---------
MNTH_LACBR       LQLTIAFIVNSLLLILGAALFFGTNS-TVGRFVDLFNSLNNSHIVGAIASP---------
MNTH_PEDPA       MQLFLAFIVNSLLLILGAALFYGTDS-SLGRFVDLFNALSNNQIVGAIASP---------
MNTH_LACP3       LQLTMAFIVNSLLLILGAALFFGTSS-SVGRFVDLFNALSNSQIVGAIASP---------
MNTH_LACCB       LQLTMAFIVNSLLLILGAALFFGTSS-SVGRFVDLFNALSNSQIVGAIASP---------
MNTH_LACBA       IQLTLAFVVNSLLLILGAALFFGTNS-DLGRFVDLFNALSDSQIVGAIASP---------
MNTH_LACPL       IQLSVAFVVNSLLLILGAALFFGTKG-DLGRFVDLYNALGDSKVVGSIASP---------
MNTH_LACSS       IQLTIAFVVNCLLLILGAAMFYGTNS-DLGRFVDLFNALQNKEIVGSIASP---------
MNTH_STAA1       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAM       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAC       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAA2       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAA9       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAS       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAW       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAN       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAA8       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAE       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAA3       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAB       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAAR       IQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHALKTEPVLGATMGA---------
MNTH_STAES       IQLSIAFVVNCLLLTLGAALFFGTKTEDLGGFYDLYLALKTEPALGATLGG---------
MNTH_STAEQ       IQLSIAFVVNCLLLTLGAALFFGTKTEDLGGFYDLYLALKTEPALGATLGG---------
MNTH_STAHJ       IQLSIAFIVNCLLLVLGAALFYGVNSNNIGGFYDLYQALRTQPVLGVVMGS---------
MNTH_STAS1       IQLSIAFIVNCLLLVLGAALFFGVNTEQLGGFYDLYNALQNQPLLGASLGA---------
MNTH_MYCTU       LAMLIAGGVNAAMLLVAALNMR--GRGDTASIEGAYH---AVHDTLGA------------
MNTH_MYCLE       LAMTIAGIVNTAMLLVAAINLQ--HHQVTAYIEGTYT---AIQDTLGA------------
MNTH_SHIB3       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_SHIBS       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO24       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO57       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO5E       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOLU       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOK1       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO45       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOL6       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOL5       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO7I       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO8A       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO81       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_SHISS       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOUT       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ESCF3       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOBW       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECODH       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOSE       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOSM       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO55       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOLC       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOLI       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_SHIF8       IAMTIAGFVNLVMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECO27       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_SHIDS       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_ECOHS       IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYL---TLQPLLSH------------
MNTH_CITK8       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALTY       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALPC       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALCH       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALEP       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALG2       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALSV       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALTI       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALPA       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_SALPK       IAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYL---TLEPLLSH------------
MNTH_CROS8       IAMTIAGFVNLAMMATAAAAFHFSGHTKVAELDQAYL---TLEPLLSH------------
MNTH_ENT38       IAMTIAGFVNLAMMATAAAAFHFNGHTGVADLDQAYL---TLEPLLSH------------
MNTH_KLEP3       IAMTIAGFVNLAMMATAAAAFHFNGHTGVADLDQAYR---TLEPLLSH------------
MNTH_KLEP7       IAMTIAGFVNLAMMATAAAAFHFNGHTGVADLDQAYM---TLEPLLSH------------
MNTH_PECCP       IAMTIAGFVNLAMMATAAAAFHFSGNQDIADLDKAYL---TLEPLLGK------------
MNTH_BLOPB       IAMTIAGFVNLSMMATAAAVFHYGGYTGISNLDEAYL---TLSPLLNH------------
MNTH_ERWT9       IAMTIAGFVNLAMMATAAATFHFSGHSGVADLDQAYL---TLDPLLGK------------
MNTH_YERPE       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERPP       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERPA       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERPN       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERPS       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERPB       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERP3       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERPY       IAMTIAGFVNLAMMATAAAAFHFNGYENIAEIEEAYI---TLQPLLGN------------
MNTH_YERE8       IAMTIAGFVNLAMMATAAAAFHFNGYGSIAEIEQAYL---TLQPLLGN------------
MNTH_AERHH       IAMTIAGFVNLAMMAMAAAAFHSSGNQQVAELESAYQ---TLTPLLGQ------------
MNTH_VIBCB       IAMVIAGFVNIAIVAMAAAVFHYSGNQHVAEIETAYM---TLTPLVGK------------
MNTH_CHRSD       LGMAIAGLVNLSMLAMAAAVFHATGRLDVATISDSYL---LLAPVVGQV-----------
MNTH_ACICJ       AALGVAGMVNMAMVAMAAGAFHPAHQGIA-EIGEAYR---TLSPLLGA------------
MNTH_VEREI       VALAIAGLINMAMVIMAAGAFHHGHPEVA-EIETAYH---TLAPLLGI------------
MNTH_GRABC       LALALAGMVNMAMVIMAASAFHIGHSDVA-EIEQAYH---TLTPLLGA------------
MNTH_BURCM       VALGLAGFVNLAMVMMAASAFHASAPGMA-DIGDAYH---TLIPVLGP------------
MNTH_DEIRA       AAMGLAGLINMSMLAVAAATFHGKNVENAGDLTTAYQ---TLTPLLGP------------
MNTH_BACSU       IAMLIAGAINASMLIVAAALFFKNGL-FVEDLDVAFQ---QFGHLVSP------------
MNTH_CLOAB       IAMNIAFVVNAAMVIVSAAVFFKHGI-KVSTIEEAHR---SLQPLLGN------------
MNTH_CALS4       VAMNTAFIINAAMLIVSAAVFYKNGI-VIESIEEAHK---TLEPLLGV------------
NRAM1_ARATH      LALMVAFLINVSVISVSGAVCNAPNLSPEDRANCEDLDLNKASFLLRNVVG---------
NRAM6_ARATH      LALMVAFLINVSVISVSGAVCNASDLSPEDRASCQDLDLNKASFLLRNVVG---------
NRAM3_ORYSJ      FALTIAFLINISIISVSGAVCGSDNLSPEDQMNCSDLDLNKASFLLKNVLG---------
NRAM1_ORYSJ      IALFVALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLG---------
NRAM5_ORYSJ      FALFVALLINIAVVSVSGTACSSANLSQEDADKCANLSLDTSSFLLKNVLG---------
NRAT1_ORYSJ      LAFIVAFLINVSVVVVAGSICNANNLSPADANTCGDLTLQSTPLLLRNVLG---------
NRAM4_ORYSJ      LALFIALLVNVAIVSISGTIC-ANNLSFADTSTCSSLTLNSTYVLLKNILG---------
NRAM3_ARATH      IALFISFLINLFVTTVFAKGFYNTDLANSIGLV-------NAGQYLQEK-----------
NRAM4_ARATH      GALAVSFIINVFVTTVFAKSFYGTEIADTIGLA-------NAGQYLQDK-----------
NRAM2_ARATH      VALFISFMINLFVTTVFAKGFYGTEKANNIGLV-------NAGQYLQEK-----------
NRAM6_ORYSJ      IALAVSFMINLFVTTVFAKGFYGTKEAGNIGLE-------NAGQYLQEK-----------
NRAM5_ARATH      AALFVSFMINLFVTAVFAKGFYGTKQADSIGLV-------NAGYYLQEK-----------
NRAM2_ORYSJ      LALIVSFFINICVTTVFAKGFYGSEQADGIGLE-------NAGQYLQQK-----------
NRAM1_DICDI      FALIISFIINLLLVSVFAKGFYG--ETTEIGLS-------SAADFLMDK-----------
NRAM1_BOVIN      IALSVSFLINLFVMAVFGQAFYKQTNQAAFNICADSSLHDYAPIFPRNN----LTVAVDI
NRAM1_BISBI      IALSVSFLINLFVMAVFGQAFYKQTNQAAFNICANSSLQDYAPIFPRNN----LTVAVDI
NRAM1_BUBBU      IALSVSFLINLFVMAVFGQAFYKQTNQAAFNICAKSSLHDYAPIFPRNN----LTVAVDI
NRAM1_CEREL      IALSVSFLINLFVMAVFGQAFYKQTNQAAFNICANSSLHDYATIFPRNN----LTVAVDI
NRAM1_SHEEP      IALSVSFFINLFVMAVFGQAFYKQTNQAAFNICANSSLHDYATIFPRDN----LTVAVDI
NRAM1_HUMAN      IALSVSFIINLFVMAVFGQAFYQKTNQAAFNICANSSLHDYAKIFPMNN----ATVAVDI
NRAM1_CANLF      IALSVSFFINLFVVAVFGQAFYQQTNEAAFNVCANSSLHDYAKIFPRNN----LTVEVDI
NRAM1_PIG        IALFVSFFINLFVMAVFGQAFYQQTNQAAFNICANSSLHDYAKIFPRNN----LTVAVDF
NRAM1_MOUSE      IALSVSFIINLFVMAVFGQAFYQQTNEEAFNICANSSLQNYAKIFPRDN----NTVSVDI
NRAM1_CHICK      LALFVSFLINLFVMAVFGEAFYHQRNEDVHNKCVNSSVSRYASIFPINN----ETVSVDI
NRAM2_RAT        IALFVSFIINVFVVSVFAEAFFEKTNEQVVEVCRNSS-SPHADLFPNDN----STLAVDI
NRAM2_MOUSE      IALFVSFIINVFVVSVFAEAFFEKTNKQVVEVCKNNS-SPHADLFPSDN----STLAVDI
NRAM2_HUMAN      IALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTS-SPHAGLFPKDN----STLAVDI
MVL_DROME        VALFVSFIINLFVVAVFAHGMYGKTNNDVVEVCKDKSMYEDAKMSFVDNVNGTAIIDADL
NRAMA_CAEEL      IALFLSFFINLFVVAVFAHGLYQKTNADVREMCIARHDIPDADIFPNNT----EPVEVDI
NRAM2_DICDI      LALNCAFFVNIAILMLAASVFWKSNIQVTELSEAYRL----LTKLMDGK-----------
SMF3_YEAST       AELIISLFLIATFVNSAILIVAGATLSGQPE-AEDADLLSIYKLLVHYISP---------
SMF2_YEAST       TELLISLFTVALFVNCAILIVSGATLYGSTQNAEEADLFSIYNLLCSTLSK---------
SMF1_YEAST       VELSITLFTLALFVNCAILVVAGSTLYNSPE-ADGADLFTIHELLSRNLAP---------
PDT1_SCHPO       VEVALSLFTFALFTNSSILIVAGAVFYNTSG-ADTSDLFSIYDLLKEYVSI---------
                   .  :      .                                               

MNTH_BRUME       -------------IAPALFAIALLCCGLNSTITATMAGQIVMEGFIDIRLKPWIRRAITR
MNTH_BRUSU       -------------IAPALFAIALLCCGLNSTITATMAGQIVMEGFIDIRLKPWIRRAITR
MNTH_AGRFC       -------------IAPTLFGVALLCCGINSTVTATLAGQIVMEGFLKMRLAPWLRRLITR
MNTH_LISMO       -------------IASTVFAVALLASGQNSTLTGTLAGQIVMEGFLNIRLKPVVRRLLTR
MNTH_LISMH       -------------IASTVFAVALLASGQNSTLTGTLAGQIVMEGFLNIRLKPVVRRLLTR
MNTH_LISMC       -------------IASTVFAVALLASGQNSTLTGTLAGQIVMEGFLNIRLKPVVRRLLTR
MNTH_LISMF       -------------IASTVFAVALLASGQNSTLTGTLAGQIVMEGFLNIRLKPVVRRLLTR
MNTH_LISW6       -------------IASTVFAVALLASGQNSTLTGTLAGQIVMEGFLNIRLKPVVRRLLTR
MNTH_LISIN       -------------IASTVFAVALLASGQNSTLTGTLAGQIVMEGFLNIRLKPVVRRLLTR
MNTH_NOSS1       -------------AASAIFGIALLASGQSSTLTATLAGQIVMEGFLQFRLPSWLRRLITR
MNTH_BRADU       -------------IASTLFAIALLASGLNSTVTATLAGQIVMEGFLDLRLPSWARRLLTR
MNTH_RHILO       -------------IASILFAVALLASGLNSTVTATLAGQIIMEGFLRLRIPNWARRLLTR
MNTH_XANAC       -------------LASTLFAVALLASGINSTVTATLAGQIVMEGFLQLRLPPWIRRLLTR
MNTH_XANCP       -------------LASTLFAVALLASGVNSTVTATLAGQIVMEGFLRLRLPPWMRRLLTR
MNTH_XYLFA       -------------VAATLFATALLASGINSTVTATLAGQIVMEGFLRLRLRPWLRRVLTR
MNTH_XYLFT       -------------VAATLFATALLASGINSTVTATLAGQIVMEGFLRLRLRPWLRRVLTR
MNTH2_PSEAE      -------------LASLLFAVALLASGLNSTVTTTLAGQIVMEGFLRLRLAPWARRLLTR
MNTH1_PSEAE      -------------LASFLFGFALLAAGQSSTFTGTIAGQVVMEGFLRAKIPCWQRRLITR
MNTH_RALSO       -------------VAGVLFGIALLAAGQSSTFTGTIAGQILMEGFLELRIPCWQRRLATR
MNTH_LACBR       -------------MLSMLFAVALLSSGQSSTITGTLSGQIIMEGFIHLRMPLWAQRLLTR
MNTH_PEDPA       -------------VLSMLFAVALLASGQSSTITGTLSGQIIMEGFIRLRVPLWVQRLVTR
MNTH_LACP3       -------------MLSMLFAVALLASGQSSTITGTLAGQIIMEGFIHLKMPLWAQRLLTR
MNTH_LACCB       -------------MLSMLFAVALLASGQSSTITGTLAGQIIMEGFIHLKMPLWAQRLLTR
MNTH_LACBA       -------------MLSMLFALALLSSGQSSTITGTLAGQIIMEGFINLKMPLWAQRLITR
MNTH_LACPL       -------------LLSMLFAIALLSSGQSSTITGTLSGQIIMEGFIRLKMPLWAQRLLTR
MNTH_LACSS       -------------MLSLLFAVALLASGQNSTITGTLSGQIVMEGFVRMKIPLWARRVITR
MNTH_STAA1       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAM       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAC       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAA2       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAA9       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAS       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAW       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAN       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAA8       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAE       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAA3       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAB       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAAR       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
MNTH_STAES       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLKLSIPNWLRRLITR
MNTH_STAEQ       -------------IMSTLFAVALLASGQNSTITGTLAGQIVMEGFLKLSIPNWLRRLITR
MNTH_STAHJ       -------------IMSTLFAIALLASGQNSTITGTLAGQIVMEGFLKLSIPNWMRRLVTR
MNTH_STAS1       -------------IMSTLFAIALLASGQNSTITGTMAGQIVMEGFINLKIPNWLRRLITR
MNTH_MYCTU       -------------TIAVLFAVGLLASGLASSSVGAYAGAMIMQGLLHWSVPMLVRRLITL
MNTH_MYCLE       -------------TIAMLFAIGLLASSLASASVGAYAGALIMQGLLQRSIPMLIRRLITL
MNTH_SHIB3       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_SHIBS       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO24       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO57       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO5E       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOLU       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOK1       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO45       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOL6       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOL5       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO7I       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO8A       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO81       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_SHISS       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOUT       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ESCF3       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOBW       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECODH       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOSE       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOSM       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO55       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOLC       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOLI       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_SHIF8       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECO27       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_SHIDS       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_ECOHS       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTM
MNTH_CITK8       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_SALTY       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_SALPC       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_SALCH       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_SALEP       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRSITM
MNTH_SALG2       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRSITM
MNTH_SALSV       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_SALTI       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_SALPA       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_SALPK       -------------AAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITM
MNTH_CROS8       -------------AAATIFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFSIPLWVRRAVTM
MNTH_ENT38       -------------AAATIFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRSVTM
MNTH_KLEP3       -------------AAATIFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWFRRAVTM
MNTH_KLEP7       -------------AAATIFGLSLIAAGLSSTVVGTLAGQVVMQGFIRFHIPLWFRRAITM
MNTH_PECCP       -------------AAAVIFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRSVTM
MNTH_BLOPB       -------------TAAIVFGLSLTAAGLSSTVVGTLAGQVVMQGFVRFHIPLLLRRVITM
MNTH_ERWT9       -------------AAALVFGLSLLAAGLSSTVVGTMAGQVVMQGFIHFHIPLLLRRVITM
MNTH_YERPE       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERPP       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERPA       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERPN       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERPS       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERPB       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERP3       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERPY       -------------AAATVFGLSLIAAGLSSTVVGTLAGQVVMQGFVRFYIPMWVRRIVTM
MNTH_YERE8       -------------AAATIFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFYIPIWVRRTVTM
MNTH_AERHH       -------------AAATLFGLSLVASGISSTVVGTLAGQVVMQGFVRFTIPLWLRRAITM
MNTH_VIBCB       -------------AASVLFGVSLIASGLSSTVVGTMAGQVVMQGFVRFSIPMWVRRFITM
MNTH_CHRSD       -------------TASHVFGLALLLAGLSSSIVGTLSGQVIMQGFVNVSIPLWLRRLVTM
MNTH_ACICJ       -------------GAAVIFLISLLASGVSSSVVGTLAGQMVMQGFVGFSIPIWLRRALTM
MNTH_VEREI       -------------GAAGVFLLSLIASGISSSVVGTMAGQIIMQGFVEFRIPLWLRRAVTM
MNTH_GRABC       -------------AAAAIFLISLITSGISSSVVGTMAGQMIMQGFVHIRIPVWLRRLVTM
MNTH_BURCM       -------------AAGVLFLVALLTSGVSSSVVGTMAGQVVMQGFMRRRLSVWMRRAVTI
MNTH_DEIRA       -------------AASVLFAVALLASGLSSSAVGTMAGDVIMQGFMGFHIPLWLRRLITM
MNTH_BACSU       -------------MSAALFGIGLLVAGLSSSSVGTLSGDVIMQGFINYRIPLYVRRFITI
MNTH_CLOAB       -------------LSSGAFGIALLASGLSSSAVGTMAGQTIMKGFVNLSIPINLRRIITM
MNTH_CALS4       -------------FSSWAFGIALLASGFSSSAVGTMAGQTIMKGFVGLNIPLNVRRLVTM
NRAM1_ARATH      ------------KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTR
NRAM6_ARATH      ------------KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTR
NRAM3_ORYSJ      ------------NWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMTPWIRNLLTR
NRAM1_ORYSJ      ------------KSSATVYGVALLASGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTR
NRAM5_ORYSJ      ------------KSSAIVYGVALLASGQSSTITGTYAGQYIMQGFLDIRMRKWLRNLMTR
NRAT1_ORYSJ      ------------RSSSVVYAVALLASGQSTTISCTFAGQVIMQGFLDMKMKNWVRNLITR
NRAM4_ORYSJ      ------------KSSSTVYGVALLVSGQSCMVATSYAGQYIMQGFSGMR--KCIIYLVAP
NRAM3_ARATH      YGGGVF-------PILYIWAIGLLAAGQSSTITGTYAGQFIMGGFLNFKMKKWLRALITR
NRAM4_ARATH      YGGGFF-------PILYIWAIGVLAAGQSSTITGTYAGQFIMGGFLNLKMKKWVRALITR
NRAM2_ARATH      FGGGLL-------PILYIWGIGLLAAGQSSTITGTYAGQFIMGGFLNLRLKKWMRAVITR
NRAM6_ORYSJ      FGGGFF-------PILYIWGIGLLAAGQSSTITGTYAGQFIMGGFLNLKLKKWIRSLITR
NRAM5_ARATH      YGGGVF-------PILYIWGIGLLAAGQSSTITGTYAGQFIMEGFLDLQMEQWLSAFITR
NRAM2_ORYSJ      YGTAFF-------PILYIWAIGLLASGQSSTITGTYAGQFVMGGFLNLRLKKWLRAMITR
NRAM1_DICDI      YGK----------VAKYIWAIGLFSAGQCSTMTGTYSGQFVMEGFLKLKIAPWKRLLITR
NRAM1_BOVIN      YQGGVILGCLFGPPALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLTR
NRAM1_BISBI      YQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLTR
NRAM1_BUBBU      YQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLTR
NRAM1_CEREL      YQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLTR
NRAM1_SHEEP      YQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLTR
NRAM1_HUMAN      YQGGVILGCLFGPAALYIWAIGLLAAGQSSTMTGTYAGQFVMEGFLRLRWSRFARVLLTR
NRAM1_CANLF      YQGGVMLGCVFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLRLRWSRFARVLLTR
NRAM1_PIG        YQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARLLLTR
NRAM1_MOUSE      YQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLTR
NRAM1_CHICK      YQGGVILGCYFGAAALYIWAVGILAAGQSSTMTGTYAGQFVMEGFLQLRWSRFTRVLFTR
NRAM2_RAT        YKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVILTR
NRAM2_MOUSE      YKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVILTR
NRAM2_HUMAN      YKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTR
MVL_DROME        YKGGLFLGCTFGAVAMYIWGVGILAAGQSSTMTGTYAGQFSMEGFLNLQWPRWCRVLVTR
NRAMA_CAEEL      YKGGIYLGCQFGAIAMFIWGIGIFAAGQSSTMTGTYTGQFVMEGFVKIEWPKWKRVLITR
NRAM2_DICDI      -------------LAAVLFGLGLFLAGQSSTITGTMAGQIVMEGFIKLRIKPWLRRFITR
SMF3_YEAST       -------------AAGLIFALAMLCSGQSAGIICTLAGQIVSEGFLQWSLPPWATRLCTR
SMF2_YEAST       -------------GAGTVFVLALLFSGQSAGIVCTLSGQMVSEGFLNWTVSPALRRSATR
SMF1_YEAST       -------------AAGTIFMLALLLSGQSAGVVCTMSGQIVSEGHINWKLQPWQRRLATR
PDT1_SCHPO       -------------SCGRLFAVALLFSGMSAGYVCTIAGQIVSEGYINWNLRPWLRRVITR
                                   :  .:  ..       : :*     *              : 

MNTH_BRUME       FVAIVPAAIVTILYG--SQGTTELLILSQVVLSLQLPFAVIPLVIFTAQKKKMGS-----
MNTH_BRUSU       FVAIVPAAIVTILYG--SQGTTELLILSQVVLSLQLPFAVIPLVIFTAQKKKMGS-----
MNTH_AGRFC       AIAIVPAAGVTIFYG--DSGTGQLLILTQVVLSLQLSFAVFPLVMFTSDKAKMGE-----
MNTH_LISMO       VLAIVPAVIITALYG--ANGINELLIFSQVILSMQLSFAVIPLVMFTSDKQKMGE-----
MNTH_LISMH       VLAIVPAVIITALYG--ANGINELLIFSQVILSMQLSFAVIPLVMFTSDKQKMGE-----
MNTH_LISMC       VLAIVPAVIITALYG--ANGINELLIFSQVILSMQLSFAVIPLVMFTSDKQKMGE-----
MNTH_LISMF       VLAIVPAVIITALYG--ANGINELLIFSQVILSMQLSFAVIPLVMFTSDKQKMGE-----
MNTH_LISW6       VLAIVPAVIITALYG--ANGINELLIFSQVILSMQLSFAVIPLVMFTSDKEKMGE-----
MNTH_LISIN       VLAIVPAVIITALYG--ANGINELLIFSQVILSMQLSFAVIPLVMFTSDKQKMGE-----
MNTH_NOSS1       LLAIIPALITIILFG--ENSTSSLIVLSQVILSLQLPFAVIPLVMFTSNRRLMGE-----
MNTH_BRADU       GIAIIPVIIVTAIYG--ERGTADLLVFSQVVLSMQLPFAVIPLVRFVSDRRKMGK-----
MNTH_RHILO       GLAIVPVVVVTALYG--EKGTGQLLVFSQVILSMQLPFAVVPLVQFVSDKKKMGN-----
MNTH_XANAC       GIAIVPVVIVTWLYG--EAGTARLLVLSQVVLSMQLPFAVIPLVRFVSDRQLMGA-----
MNTH_XANCP       GIAIVPVVVVTWLYG--EAGTARLLVLSQVVLSMQLPFAVIPLVRFVADRGLMGA-----
MNTH_XYLFA       GLAIVPVIVVVALYG--EQGTGRLLLLSQVILSMQLPFAVIPLLRCVADRKVMGA-----
MNTH_XYLFT       GLAIVPVIVVVALYG--EQGTGRLLLLSQVILSMQLPFAVIPLLRCVADRKVMGA-----
MNTH2_PSEAE      GVAVLPVLLVTLLYG--EDGTARLLIFSQVILSMQLPLAVIPLLQFVSDRRLMGP-----
MNTH1_PSEAE      GLALVPALIGVLWLG--EAAVGKLLVLSQVVLSLQLPFALWPLIRFSSDRGLMGE-----
MNTH_RALSO       ALALIPAFVGVAMLG--DHAIGRLLVISQVVLGFQLPFAMFPLIRMTGDRALMGT-----
MNTH_LACBR       LLSVTPVLIFAIYYHGNEAKIENLLTLSQVFLSVALPFAIVPLVKFTSSKELMGE-----
MNTH_PEDPA       VLSVAPVLIFAIYYHGDEAKIENLLTFSQVFLSVALPFAVIPLVIYTSSKKLMGE-----
MNTH_LACP3       LMSVTPVLIFAIYYHGNEAKIENLLTFSQVFLSIALPFAVIPLVLYTSDKKIMGE-----
MNTH_LACCB       LMSVTPVLIFAIYYHGNEAKIENLLTFSQVFLSIALPFAVIPLVLYTSDKKIMGE-----
MNTH_LACBA       LLSVTPVIIFAIIYHGNEAKIEDLLTFSQVFLSIALPFAMIPLVIFTSSKKLMGE-----
MNTH_LACPL       LISVTPVLAFAIYYHGNEAKIEDLLTMSQVFLSIALPFAMIPLVMFTSNRALMGN-----
MNTH_LACSS       GLSILPVIIFTVYYHGNEAQVENLLIYSQVFLSIALPVSMIPLTLFTSDEKIMGP-----
MNTH_STAA1       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAM       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAC       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAA2       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAA9       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAS       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAW       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAN       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAA8       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAE       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAA3       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAB       SLAVIPVIVCLSIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAAR       SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGP-----
MNTH_STAES       SLAVIPVIICLIVFKGNTEKIEQLLVFSQVFLSIALPFSLIPLQLATSNQNLMGP-----
MNTH_STAEQ       SLAVIPVIICLIVFKGNTEKIEQLLVFSQVFLSIALPFSLIPLQLATSNQNLMGP-----
MNTH_STAHJ       SLAVIPVLLCLVIFRGNESKMEQLLVFSQVFLSIALPFSLIPLQLATSNEKLMGP-----
MNTH_STAS1       LIAILPIIICLIVFNSNEAKMEQLLVFSQVFLSLALPFSLIPLQLSTNDKRLMGQ-----
MNTH_MYCTU       GPALAILTLGFDPTR--------TLVLSQVVLSFGIPFAVLPLVKLTGSPAVMGG-----
MNTH_MYCLE       CPAIAILALGFDPTR--------ALVLSQIVLSFGIPFAVLPLVKLTNNRGLMGN-----
MNTH_SHIB3       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_SHIBS       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO24       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO57       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO5E       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOLU       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOK1       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO45       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOL6       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOL5       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO7I       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO8A       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO81       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_SHISS       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOUT       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ESCF3       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOBW       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECODH       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOSE       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOSM       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO55       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOLC       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOLI       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_SHIF8       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECO27       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_SHIDS       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_ECOHS       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDSKLMGD-----
MNTH_CITK8       MPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSDRTLMGD-----
MNTH_SALTY       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALPC       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALCH       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALEP       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALG2       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALSV       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALTI       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALPA       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_SALPK       LPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNATLMGE-----
MNTH_CROS8       APSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLFFTSNKALMAE-----
MNTH_ENT38       MPSFIVILMGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTGNKSLMGD-----
MNTH_KLEP3       LPSFVVILLGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNAQLMGD-----
MNTH_KLEP7       LPSFVVILLGLDPTR--------ILVMSQVLLSFGIALALVPLLIFTSNAKLMGD-----
MNTH_PECCP       LPSFIVILSGMDPTR--------VLVLSQVVLSFGIALALVPLLSFTGNRELMGT-----
MNTH_BLOPB       LPSFIVISFGIDSTR--------ILIMSQVLLSFGIALALIPLLVFTGNVKLMNE-----
MNTH_ERWT9       LPSFIVILAGWEPTR--------ILVMSQVLLSFGIALALIPLLAFTGNPGLMGD-----
MNTH_YERPE       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERPP       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERPA       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERPN       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERPS       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERPB       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERP3       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERPY       LPSFIVILAGMDATQ--------ILVMSQVLLSFGIALALVPLLVFTGNKELMGE-----
MNTH_YERE8       LPSFIVILMGMDATR--------ILVMSQVLLSFGIALALVPLLAFTGNKELMGD-----
MNTH_AERHH       APAFVVIAMGLNTTE--------ILVLSQVVLSFGIALALIPLLILTGDRALMGE-----
MNTH_VIBCB       APSFVVIGLGMNTTD--------ILVMSQVVLSFGIALAIIPLLIFTNSERLMGE-----
MNTH_CHRSD       LPALAVIMLGISEQK--------ALVASQVILSFGIPFALVPLLCFTANRQIMGN-----
MNTH_ACICJ       IPGFVVIGLGVNPTR--------ALVLSQVVLSLALPVPMLALLWFSTRRALMGA-----
MNTH_VEREI       APSFAVVALGVNVTQ--------ALVLSQVVLSLALPLPMAALLWFTCSREVMGA-----
MNTH_GRABC       VPAFIVILAGVNATD--------ALVISQVILSIALPAPMIALIYFSGHRELMGP-----
MNTH_BURCM       APAFAVVACGCDVTR--------AMVASQVVLSFVLPMPMIALLILSARNDVMGR-----
MNTH_DEIRA       LPAFIVILLGMDPSS--------VLILSQVILCFGVPFALVPLLLFTARRDVMGA-----
MNTH_BACSU       IPPILIIASGVNPTT--------ALVLSQVVLSFGIAFALIPLIMFTSNKRIMGS-----
MNTH_CLOAB       LPALIIIALGINPMR--------VLVLSQVALSFILPFPIIQMLLIAGRKDLMGI-----
MNTH_CALS4       VPAITIIALGIDPLK--------SLIVSQVVLSFELPMAIIPLLLITSNKKFMKE-----
NRAM1_ARATH      CLAIIPSLIVALIGG--SAGAGKLIIIASMILSFELPFALVPLLKFTSCKTKMGS-----
NRAM6_ARATH      CLAIIPSLIVALIGG--SAGAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGS-----
NRAM3_ORYSJ      SLAILPSLIVSIIGG--SSAAGQLIIIASMILSFELPFALVPLLKFTSSRTKMGQ-----
NRAM1_ORYSJ      SIAIVPSLIVSIIGG--SSGAGRLIVIASMILSFELPFALIPLLKFSSSSNKMGE-----
NRAM5_ORYSJ      TIAIAPSLIVSIIGG--SRGAGRLIIIASMILSFELPFALIPLLKFSSSKSKMGP-----
NRAT1_ORYSJ      VIAIAPSLIVSIVSG--PSGAGKLIILSSMILSFELPFALIPLLKFCNSSKKVGP-----
NRAM4_ORYSJ      CFTLLPSLIICSIGG--TLRVHRIINIAAIVLSFVLPFALIPLIKFSSSCTNIGP-----
NRAM3_ARATH      SCAIIPTIIVALVFDSSEATLDVLNEWLNVLQSIQIPFALIPLLCLVSKEQIMGS-----
NRAM4_ARATH      SCAIIPTMIVALVFDSSDSMLDELNEWLNVLQSVQIPFAVIPLLCLVSNEQIMGS-----
NRAM2_ARATH      SCAIVPTMIVAIVFNTSEASLDVLNEWLNVLQSVQIPFALLPLLTLVSKEEIMGD-----
NRAM6_ORYSJ      SFAIVPTIIVALFFDKSD-SLDVLNEWLNVLQSIQIPFALIPLITLVSKEKVMGV-----
NRAM5_ARATH      SFAIVPTMFVAIMFNTSEGSLDVLNEWLNILQSMQIPFAVIPLLTMVSNEHIMGV-----
NRAM2_ORYSJ      SFAIIPTMIVALFFDTEDPTMDILNEALNVLQSIQIPFALIPLITLVSKEQVMGS-----
NRAM1_DICDI      CTAIVPAMVVAIL---STSHLDSLDQWLNILQSIQLPFAVVPVLLFTSSEKIMGSK----
NRAM1_BOVIN      SCAILPTVLLAVFRD--LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPALMQE-----
NRAM1_BISBI      SCAILPTVLLAVFRD--LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPALMRE-----
NRAM1_BUBBU      SCAILPTVLLAVFRD--LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPALMQE-----
NRAM1_CEREL      SCAILPTVLVAVFRD--LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPAVMQE-----
NRAM1_SHEEP      SCAIPPTVLLAVFRD--LQDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPALMQE-----
NRAM1_HUMAN      SCAILPTVLVAVFRD--LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPTLMQE-----
NRAM1_CANLF      SCAILPTVLVVVFRD--LKDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPALMQE-----
NRAM1_PIG        SCAILPALLVAVFKE--LQDLSSLNDLLNVLQSLLLPFAVLPILTFTSMPALMQE-----
NRAM1_MOUSE      SCAILPTVLVAVFRD--LKDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPAVMQE-----
NRAM1_CHICK      SLAILPTLFVAAFRD--VSQLTGMNDLLNVLQSILLPFAVLPVLTFTSLRPLMHD-----
NRAM2_RAT        SIAIIPTLLVAVFQD--VEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSE-----
NRAM2_MOUSE      SIAIIPTLLVAVFQD--VEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSE-----
NRAM2_HUMAN      SIAIIPTLLVAVFQD--VEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSD-----
MVL_DROME        CIAIIPTFCLAMFSK--MEDLTSMNDILNAVMSLQLPFAAIPTIAFTSCAAIMGE-----
NRAMA_CAEEL      AIAITPTLVLTFYSQG-VQNLTGMNDFLNCVQMIQLPFALIPIITFTSSRKIMHD-----
NRAM2_DICDI      LLAIIPAAIVIIVLG--DKGTYTLLIISQVLLSIGLPFAVVPLIIFTSSYEIMGE-----
SMF3_YEAST       LIAIVPCLFVTLTMG--EKGISDILNFSQVVLSLILPIVSAPLIYFTANRKLMVVH-DEN
SMF2_YEAST       AVAITPCLILVLVAG--RSGLSGALNASQVVLSLLLPFVSAPLLYFTSSKKIMRVQLNRT
SMF1_YEAST       CISIIPCLVISICIG--REALSKALNASQVVLSIVLPFLVAPLIFFTCKKSIMKTEITVD
PDT1_SCHPO       AIAIIPCLVVSAAVG--QSGLNQVLNASQVCLSILLPFLTFPLVMFTCSRKVMRVVSDST
                    .                             . :.               :       

MNTH_BRUME       -----------------------------------------------LAAAPWVTFLAAI
MNTH_BRUSU       -----------------------------------------------LAAAPWVTFLAAI
MNTH_AGRFC       -----------------------------------------------LRSPLWLSAIAWL
MNTH_LISMO       -----------------------------------------------FVNPTWLKIISWA
MNTH_LISMH       -----------------------------------------------FVNPTWLKIISWA
MNTH_LISMC       -----------------------------------------------FVNPTWLKIISWA
MNTH_LISMF       -----------------------------------------------FVNPTWLKIISWA
MNTH_LISW6       -----------------------------------------------FVNPSWLKIISWA
MNTH_LISIN       -----------------------------------------------FVNSPWLKIVSWS
MNTH_NOSS1       -----------------------------------------------FVNPLWLKSLAWL
MNTH_BRADU       -----------------------------------------------FAISPYVAAIAWI
MNTH_RHILO       -----------------------------------------------LAIPRGVAALAWV
MNTH_XANAC       -----------------------------------------------LVAPAWLVRIAWV
MNTH_XANCP       -----------------------------------------------LVAPAWLVRLAWV
MNTH_XYLFA       -----------------------------------------------LVAPRWLMVVAWL
MNTH_XYLFT       -----------------------------------------------LVAPRWLMVVAWL
MNTH2_PSEAE      -----------------------------------------------LAIGAGTRWLAWA
MNTH1_PSEAE      -----------------------------------------------FVNPRWVSALAWS
MNTH_RALSO       -----------------------------------------------FANGRLTSAVAWC
MNTH_LACBR       -----------------------------------------------FVNKAWVKYSAWV
MNTH_PEDPA       -----------------------------------------------FANRAWVKWCAWT
MNTH_LACP3       -----------------------------------------------FANRAWVKWTAWF
MNTH_LACCB       -----------------------------------------------FANRAWVKWTAWF
MNTH_LACBA       -----------------------------------------------FANRTWSKILGWI
MNTH_LACPL       -----------------------------------------------FTNRVWVKWTAWI
MNTH_LACSS       -----------------------------------------------FVNRPWVKYTAWF
MNTH_STAA1       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAM       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAC       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAA2       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAA9       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAS       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAW       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAN       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAA8       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAE       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAA3       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAB       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAAR       -----------------------------------------------FYNKTWVNIISWT
MNTH_STAES       -----------------------------------------------FKNKTWINIISWL
MNTH_STAEQ       -----------------------------------------------FKNKTWINIISWL
MNTH_STAHJ       -----------------------------------------------FKNKKWVNICAWG
MNTH_STAS1       -----------------------------------------------FKNKLWVNIISWC
MNTH_MYCTU       -----------------------------------------------DTNHRATTWVGWV
MNTH_MYCLE       -----------------------------------------------DTNHPATTVLGWA
MNTH_SHIB3       -----------------------------------------------LVNSKRVKQTGWV
MNTH_SHIBS       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO24       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO57       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO5E       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOLU       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOK1       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO45       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOL6       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOL5       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO7I       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO8A       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO81       -----------------------------------------------LVNSKRVKQTGWV
MNTH_SHISS       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOUT       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ESCF3       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOBW       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECODH       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOSE       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOSM       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO55       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOLC       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOLI       -----------------------------------------------LVNSKRVKQTGWV
MNTH_SHIF8       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECO27       -----------------------------------------------LVNSKRVKQTGWV
MNTH_SHIDS       -----------------------------------------------LVNSKRVKQTGWV
MNTH_ECOHS       -----------------------------------------------LVNSKRVKQTGWV
MNTH_CITK8       -----------------------------------------------LVNTQWVKYIGWM
MNTH_SALTY       -----------------------------------------------LVNTRRVKQVGWI
MNTH_SALPC       -----------------------------------------------LVNTRRVKQVGWI
MNTH_SALCH       -----------------------------------------------LVNTRRVKQVGWI
MNTH_SALEP       -----------------------------------------------LVNTRRVKQIGWI
MNTH_SALG2       -----------------------------------------------LVNTRRVKQIGWI
MNTH_SALSV       -----------------------------------------------LVNTRRVKQIGWI
MNTH_SALTI       -----------------------------------------------LVNTRRVKQIGWI
MNTH_SALPA       -----------------------------------------------LVNTRRVKQIGWI
MNTH_SALPK       -----------------------------------------------LVNTRRVKQIGWI
MNTH_CROS8       -----------------------------------------------LVNTPWVKRTGWA
MNTH_ENT38       -----------------------------------------------LVNTTLVKRIGWM
MNTH_KLEP3       -----------------------------------------------LVNTRWVRVTGWV
MNTH_KLEP7       -----------------------------------------------LVNTRWVRGIGWA
MNTH_PECCP       -----------------------------------------------MVNGKWVQRIGQL
MNTH_BLOPB       -----------------------------------------------LVNSLWIKLIGWL
MNTH_ERWT9       -----------------------------------------------MVNSRLMQNFGRL
MNTH_YERPE       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERPP       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERPA       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERPN       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERPS       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERPB       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERP3       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERPY       -----------------------------------------------LVDTKTTQILGKL
MNTH_YERE8       -----------------------------------------------MVNSKLIQILGKL
MNTH_AERHH       -----------------------------------------------YRNHPVTQAVGRL
MNTH_VIBCB       -----------------------------------------------FKNNKWVSYAGVV
MNTH_CHRSD       -----------------------------------------------LVNRKSVTGVGTV
MNTH_ACICJ       -----------------------------------------------LAVRGITAIAAIG
MNTH_VEREI       -----------------------------------------------YKNRVFIAVIATL
MNTH_GRABC       -----------------------------------------------FVNHRVTQWVASA
MNTH_BURCM       -----------------------------------------------YAMRMPLRIVAGT
MNTH_DEIRA       -----------------------------------------------LVTRRSFTVIGWV
MNTH_BACSU       -----------------------------------------------LINAKWITVVSWL
MNTH_CLOAB       -----------------------------------------------LVNKKFTKIVGFI
MNTH_CALS4       -----------------------------------------------FADTPLERIMGVL
NRAM1_ARATH      -----------------------------------------------HVNPMAITALTWV
NRAM6_ARATH      -----------------------------------------------HANSLVISSVTWI
NRAM3_ORYSJ      -----------------------------------------------HTNSKAISVITWG
NRAM1_ORYSJ      -----------------------------------------------NKNSIYIVGFSWV
NRAM5_ORYSJ      -----------------------------------------------HKNSIYIIVFSWF
NRAT1_ORYSJ      -----------------------------------------------LKESIYTVVIAWI
NRAM4_ORYSJ      -----------------------------------------------YKNATSIIRIAWI
NRAM3_ARATH      -----------------------------------------------FKIGPLYKTIAWL
NRAM4_ARATH      -----------------------------------------------FKIQPLVQTISWI
NRAM2_ARATH      -----------------------------------------------FKIGPILQRIAWT
NRAM6_ORYSJ      -----------------------------------------------FKIGRNTQAVTWT
NRAM5_ARATH      -----------------------------------------------FKIGPSLEKLAWT
NRAM2_ORYSJ      -----------------------------------------------FVVGPITKVISWI
NRAM1_DICDI      -----------------------------------------------FKNHWLNNQFVRF
NRAM1_BOVIN      -----------------------------------------------FANGLVSKVITSS
NRAM1_BISBI      -----------------------------------------------FANGLVSKVITSS
NRAM1_BUBBU      -----------------------------------------------FANGLVSKVITSS
NRAM1_CEREL      -----------------------------------------------FANGLVSKVISSS
NRAM1_SHEEP      -----------------------------------------------FANGLVSKIITSS
NRAM1_HUMAN      -----------------------------------------------FANGLLNKVVTSS
NRAM1_CANLF      -----------------------------------------------FANGRLSKAITSF
NRAM1_PIG        -----------------------------------------------FASGRVNKVITSS
NRAM1_MOUSE      -----------------------------------------------FANGRMSKAITSC
NRAM1_CHICK      -----------------------------------------------FANGLLGQVLMSL
NRAM2_RAT        -----------------------------------------------FSNGIGWRIAGGI
NRAM2_MOUSE      -----------------------------------------------FSNGIGWRIAGGI
NRAM2_HUMAN      -----------------------------------------------FANGLGWRIAGGI
MVL_DROME        -----------------------------------------------FVNGLGNKIVSIL
NRAMA_CAEEL      -----------------------------------------------FRSSKVFQIFALI
NRAM2_DICDI      -----------------------------------------------FKNRLSIIIINSI
SMF3_YEAST       GVVRAPADVNAIADETT-------------------PLNSKHSKIVDFTNSRLLTYTSVF
SMF2_YEAST       KELSRTTDKKPVADRTEDDETIELEEMGIGSSSQERSLVSPAPEYKDMSNGMIVTVLAII
SMF1_YEAST       HTEEDSHNHQNNNDRSAGSVIEQ------DGSSGMEIENGKDVKIVYMANNWIITVIAII
PDT1_SCHPO       NEETGQLIRETH----------------------------------DYSLGWTMTIVTWA
                                                                             

MNTH_BRUME       TAAIIVVLNLKLIYDFFTGAPI--------------------------------------
MNTH_BRUSU       TAAIIVVLNLKLIYDFFTGAPI--------------------------------------
MNTH_AGRFC       IAVVIAALNVKLLMDFMG------------------------------------------
MNTH_LISMO       VAIFIAVLNIYLLFYTLTSL----------------------------------------
MNTH_LISMH       VAIFIAVLNIYLLFYTLTSL----------------------------------------
MNTH_LISMC       VAIFIAVLNIYLLFYTLTSL----------------------------------------
MNTH_LISMF       VAIFIAVLNIYLLFYTLTSL----------------------------------------
MNTH_LISW6       VAIFIAILNIYLLFYTITTL----------------------------------------
MNTH_LISIN       VAIFIAFLNIYLLFYTLTSL----------------------------------------
MNTH_NOSS1       VAIVIVGLNAWLLLQSLWGWLLQVPS----------------------------------
MNTH_BRADU       VAGVIVVLNLKLLADTLLG-----------------------------------------
MNTH_RHILO       VAAIILVLNFKLLYDTLFGVG---------------------------------------
MNTH_XANAC       IAAVIVCLNLKLLWDTALH-----------------------------------------
MNTH_XANCP       IALVIVGLNLKLLWEFALG-----------------------------------------
MNTH_XYLFA       IAGVIVVLNVKLLGDYAVHLMVGVSD----------------------------------
MNTH_XYLFT       IAGVIVVLNVKLLGDYAVHLMVGVSD----------------------------------
MNTH2_PSEAE      VALAIVGLNLQLLADFAFG-----------------------------------------
MNTH1_PSEAE      LFGLISAANLTLLYFWFG------------------------------------------
MNTH_RALSO       LFAVISVANLWLVWQVLAG-----------------------------------------
MNTH_LACBR       ATVVLVSLNIYLILQTVGVIG---------------------------------------
MNTH_PEDPA       ATIVLILLNIYLILQTLGLIK---------------------------------------
MNTH_LACP3       ISGVLIILNLYLIAQTLGFVK---------------------------------------
MNTH_LACCB       ISGVLIILNLYLIAQTLGFVK---------------------------------------
MNTH_LACBA       IAVILIILNIYLILNTLHIVQ---------------------------------------
MNTH_LACPL       VTVILIILNIYLILQTVGLVK---------------------------------------
MNTH_LACSS       VTIVLTLLNIYLILQTVGLAA---------------------------------------
MNTH_STAA1       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAAM       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAAC       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAA2       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAA9       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAAS       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAAW       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAAN       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAA8       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAAE       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAA3       LIIILSILNVYLIVQTFQELQS--------------------------------------
MNTH_STAAB       LIIILSILNVYLIVQTFQELQG--------------------------------------
MNTH_STAAR       LIIILSILNVYLIVQTFQELQG--------------------------------------
MNTH_STAES       LIIVLSGLNVYLIIQTFQEL----------------------------------------
MNTH_STAEQ       LIIVLSGLNVYLIIQTFQEL----------------------------------------
MNTH_STAHJ       LIIILSFLNIYLIIETFKEL----------------------------------------
MNTH_STAS1       LIIILSILNIYLIIQTFQEL----------------------------------------
MNTH_MYCTU       VAVMVSLLNVMLIYLTVTG-----------------------------------------
MNTH_MYCLE       VAILVSLLNVVLIYLTVTS-----------------------------------------
MNTH_SHIB3       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_SHIBS       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO24       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO57       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO5E       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOLU       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOK1       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO45       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOL6       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOL5       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO7I       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO8A       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO81       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_SHISS       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOUT       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ESCF3       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOBW       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECODH       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOSE       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOSM       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO55       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOLC       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOLI       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_SHIF8       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECO27       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_SHIDS       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ECOHS       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_CITK8       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_SALTY       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALPC       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALCH       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALEP       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALG2       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALSV       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALTI       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALPA       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_SALPK       IVVLVVALNIWLLVGTVMGLS---------------------------------------
MNTH_CROS8       IVVLVVALNIWLLVGTALGL----------------------------------------
MNTH_ENT38       IVVLVVALNLWLLIGTLLGL----------------------------------------
MNTH_KLEP3       IVAIVVSLNGWLIVGSLLGVA---------------------------------------
MNTH_KLEP7       IVAIVVSLNGWLIVGSLLGVD---------------------------------------
MNTH_PECCP       IVVLVVSLNMYLLIDTMSGI----------------------------------------
MNTH_BLOPB       ITIVVIILNIYLLIGIII------------------------------------------
MNTH_ERWT9       IVVVVIALNGYLLVAMALNL----------------------------------------
MNTH_YERPE       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERPP       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERPA       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERPN       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERPS       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERPB       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERP3       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERPY       VVLIVVGLNAYLLISLL-------------------------------------------
MNTH_YERE8       IVLVVIGLNAYLLVSLI-------------------------------------------
MNTH_AERHH       IVALVIGLNAYLLVAMI-------------------------------------------
MNTH_VIBCB       IVSLVLSLNAYLMVTLTA------------------------------------------
MNTH_CHRSD       VCTLIVALNVYVLFSTFTGH----------------------------------------
MNTH_ACICJ       GAIVILGLNVILLLQIFGVNVP-LPG----------------------------------
MNTH_VEREI       AACAVLAFNAVLILQTFGVDIPGLPG----------------------------------
MNTH_GRABC       AAAIVLGLNMVLLIQAFGFTIPGLPVAP--------------------------------
MNTH_BURCM       ATVVIVGLNAYLVWAAFN------------------------------------------
MNTH_DEIRA       IAVIIIALNGYLLWELLGG-----------------------------------------
MNTH_BACSU       IAVLIVALNVFLIVDTFR------------------------------------------
MNTH_CLOAB       IATMIILLNIILLYLTFTGQT---------------------------------------
MNTH_CALS4       VASFVMILNGLLLYLTLKGEV---------------------------------------
NRAM1_ARATH      IGGLIMGINIYYLVSSFIKLLIHSHMKLILVVFCGILGFAGIALYLAAIAYLVFRKNR--
NRAM6_ARATH      IGGLIMGINIYYLVSSFIKLLLHSHMNLVAIVFLGVLGFSGIATYLAAISYLVLRKNRES
NRAM3_ORYSJ      IGSFIVVINTYFLITSFVKLLLHNGLSTVSQVFSGIFGFLGMLIYMAAILYLVFRKNRKA
NRAM1_ORYSJ      LGFVIIGINIYFLSTKLVGWILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKD-TV
NRAM5_ORYSJ      LGLLIIGINMYFLSTSFVGWLIHNDLPKYANVLVGAAVFPFMLVYIVAVVYLTIRKDSVV
NRAT1_ORYSJ      LSFALIVVNTYFLVWTYVDWLVHNNLPKYANGLISVVVFALMAAYLVAVVYLTFRKDTVA
NRAM4_ORYSJ      LSLVIIGINIYFFCTSFVAWLVHSDLPRVVNAIISSLVFPFMAAYIAALIYLAFRKV---
NRAM3_ARATH      VAALVIMINGYLLLEFFSNEVS--------GIVYTGFVTLFTASYGAFILYLIARGITFT
NRAM4_ARATH      VAALVIAINGYLMVDFFSGAAT--------NLILLVPVIIFAIAYVVFVLYLISRGLTYT
NRAM2_ARATH      VAALVMIINGYLLLDFFVSEVD--------GFLFGVTVCVWTTAYIAFIVYLISHS-NFF
NRAM6_ORYSJ      VATLLITINGYLLLDFFSSEIR--------GLLSGSILCVAVLAYASFVLYLILRGTELP
NRAM5_ARATH      VAVFVMMINGYLLLDFFMAEVE--------GFLVGFLVFGGVVGYISFIIYLVSYRSSQS
NRAM2_ORYSJ      VTVFLMLINGYLILSFYATEVR--------GALVRSSLCVVLAVYLAFIVYLIMRNTSLY
NRAM1_DICDI      LSLLIIAINIYLIITFSMQISE--------SAWMISIVSISFFFYFIFIVYLSMGQENFN
NRAM1_BOVIN      IMVLVCAVNLYFVISYL-PSLP--------HPAYFSLVALLAAAYLGLTTYLVWTCLITQ
NRAM1_BISBI      IMVLVCAVNLYFVISYV-PSLP--------HPAYFSLVALLAAAYLGLTTYLVWTCLITQ
NRAM1_BUBBU      IMVLVCAVNLYFVISYV-PSLP--------HPAYFSLVALLAAAYLGLTTYLVWTCLITQ
NRAM1_CEREL      IMVLVCAVNLYFVISYV-PSLP--------HPDYFSLVALLAAAYLGLTTYLVWTCLITQ
NRAM1_SHEEP      IMVLVCAVNLYFVISYV-PSLP--------HPAYFSLVALLAAAYLGLTTYLVWTCLITQ
NRAM1_HUMAN      IMVLVCAINLYFVVSYL-PSLP--------HPAYFGLAALLAAAYLGLSTYLVWTCCLAH
NRAM1_CANLF      IMALVCAINLYFVVIYL-PSLP--------HPAYFILVALLAIVYLGLTTYLVWTCFIAH
NRAM1_PIG        IMLLVCAINFYFLVSYL-PSLP--------HPAYFGLVALLAVIYLGLTTYLVWTCLIAH
NRAM1_MOUSE      IMALVCAINLYFVISYL-PSLP--------HPAYFGLVALFAIGYLGLTAYLAWTCCIAH
NRAM1_CHICK      ITGLVCAINVYFVVDFL-PTLR--------GLGYLIPLGLLLVAYVAFVTYLLWTCSIAH
NRAM2_RAT        LVLLVCSINMYFVVVYV-QELG--------HVALYVVAAVVSVAYLGFVFYLGWQCLIAL
NRAM2_MOUSE      LVLIVCSINMYFVVVYV-QELG--------HVALYVVAAVVSVAYLTFVFYLGWQCLIAL
NRAM2_HUMAN      LVLIICSINMYFVVVYV-RDLG--------HVALYVVAAVVSVAYLGFVFYLGWQCLIAL
MVL_DROME        LTIVVIGVNLYFVVVQV-ENMEI-------KGGLLALVCIFAILYILFNLYLVIHMAACM
NRAMA_CAEEL      TSALILSINVYFISDYVFSRLGS-------EWYIIMVLAPITFAYVLFVLYLALYCLVSC
NRAM2_DICDI      IALFIIGLNLATIFQLINDFLHNDSIISKCLTIIFLIPLSIALCCLLLWLIISKINFFTN
SMF3_YEAST       VWALIGSLNCYLVISYLLGADIHF------------------------------------
SMF2_YEAST       VWLIISGLNFYMLLGFTTGKEVHL------------------------------------
SMF1_YEAST       VWLFLSLLNVYAIVQLGMSHGDIS------------------------------------
PDT1_SCHPO       IWLFLTALNLLLIVWLGMGVSF--------------------------------------
                     :   *   .                                               

MNTH_BRUME       --------------------------------------------------
MNTH_BRUSU       --------------------------------------------------
MNTH_AGRFC       --------------------------------------------------
MNTH_LISMO       --------------------------------------------------
MNTH_LISMH       --------------------------------------------------
MNTH_LISMC       --------------------------------------------------
MNTH_LISMF       --------------------------------------------------
MNTH_LISW6       --------------------------------------------------
MNTH_LISIN       --------------------------------------------------
MNTH_NOSS1       --------------------------------------------------
MNTH_BRADU       --------------------------------------------------
MNTH_RHILO       --------------------------------------------------
MNTH_XANAC       --------------------------------------------------
MNTH_XANCP       --------------------------------------------------
MNTH_XYLFA       --------------------------------------------------
MNTH_XYLFT       --------------------------------------------------
MNTH2_PSEAE      --------------------------------------------------
MNTH1_PSEAE      --------------------------------------------------
MNTH_RALSO       --------------------------------------------------
MNTH_LACBR       --------------------------------------------------
MNTH_PEDPA       --------------------------------------------------
MNTH_LACP3       --------------------------------------------------
MNTH_LACCB       --------------------------------------------------
MNTH_LACBA       --------------------------------------------------
MNTH_LACPL       --------------------------------------------------
MNTH_LACSS       --------------------------------------------------
MNTH_STAA1       --------------------------------------------------
MNTH_STAAM       --------------------------------------------------
MNTH_STAAC       --------------------------------------------------
MNTH_STAA2       --------------------------------------------------
MNTH_STAA9       --------------------------------------------------
MNTH_STAAS       --------------------------------------------------
MNTH_STAAW       --------------------------------------------------
MNTH_STAAN       --------------------------------------------------
MNTH_STAA8       --------------------------------------------------
MNTH_STAAE       --------------------------------------------------
MNTH_STAA3       --------------------------------------------------
MNTH_STAAB       --------------------------------------------------
MNTH_STAAR       --------------------------------------------------
MNTH_STAES       --------------------------------------------------
MNTH_STAEQ       --------------------------------------------------
MNTH_STAHJ       --------------------------------------------------
MNTH_STAS1       --------------------------------------------------
MNTH_MYCTU       --------------------------------------------------
MNTH_MYCLE       --------------------------------------------------
MNTH_SHIB3       --------------------------------------------------
MNTH_SHIBS       --------------------------------------------------
MNTH_ECO24       --------------------------------------------------
MNTH_ECO57       --------------------------------------------------
MNTH_ECO5E       --------------------------------------------------
MNTH_ECOLU       --------------------------------------------------
MNTH_ECOK1       --------------------------------------------------
MNTH_ECO45       --------------------------------------------------
MNTH_ECOL6       --------------------------------------------------
MNTH_ECOL5       --------------------------------------------------
MNTH_ECO7I       --------------------------------------------------
MNTH_ECO8A       --------------------------------------------------
MNTH_ECO81       --------------------------------------------------
MNTH_SHISS       --------------------------------------------------
MNTH_ECOUT       --------------------------------------------------
MNTH_ESCF3       --------------------------------------------------
MNTH_ECOBW       --------------------------------------------------
MNTH_ECODH       --------------------------------------------------
MNTH_ECOSE       --------------------------------------------------
MNTH_ECOSM       --------------------------------------------------
MNTH_ECO55       --------------------------------------------------
MNTH_ECOLC       --------------------------------------------------
MNTH_ECOLI       --------------------------------------------------
MNTH_SHIF8       --------------------------------------------------
MNTH_ECO27       --------------------------------------------------
MNTH_SHIDS       --------------------------------------------------
MNTH_ECOHS       --------------------------------------------------
MNTH_CITK8       --------------------------------------------------
MNTH_SALTY       --------------------------------------------------
MNTH_SALPC       --------------------------------------------------
MNTH_SALCH       --------------------------------------------------
MNTH_SALEP       --------------------------------------------------
MNTH_SALG2       --------------------------------------------------
MNTH_SALSV       --------------------------------------------------
MNTH_SALTI       --------------------------------------------------
MNTH_SALPA       --------------------------------------------------
MNTH_SALPK       --------------------------------------------------
MNTH_CROS8       --------------------------------------------------
MNTH_ENT38       --------------------------------------------------
MNTH_KLEP3       --------------------------------------------------
MNTH_KLEP7       --------------------------------------------------
MNTH_PECCP       --------------------------------------------------
MNTH_BLOPB       --------------------------------------------------
MNTH_ERWT9       --------------------------------------------------
MNTH_YERPE       --------------------------------------------------
MNTH_YERPP       --------------------------------------------------
MNTH_YERPA       --------------------------------------------------
MNTH_YERPN       --------------------------------------------------
MNTH_YERPS       --------------------------------------------------
MNTH_YERPB       --------------------------------------------------
MNTH_YERP3       --------------------------------------------------
MNTH_YERPY       --------------------------------------------------
MNTH_YERE8       --------------------------------------------------
MNTH_AERHH       --------------------------------------------------
MNTH_VIBCB       --------------------------------------------------
MNTH_CHRSD       --------------------------------------------------
MNTH_ACICJ       --------------------------------------------------
MNTH_VEREI       --------------------------------------------------
MNTH_GRABC       --------------------------------------------------
MNTH_BURCM       --------------------------------------------------
MNTH_DEIRA       --------------------------------------------------
MNTH_BACSU       --------------------------------------------------
MNTH_CLOAB       --------------------------------------------------
MNTH_CALS4       --------------------------------------------------
NRAM1_ARATH      -------VATSLLISRDSQN-----VETLPRQDIVNMQLPCRVST-SDVD
NRAM6_ARATH      -------SSTHFLDFSNSQT-----EETLPREDIANMQLPNRVAVIGDLN
NRAM3_ORYSJ      TLPLLEGDSTVRIVGRDTATEGEGSLGHLPREDISSMQLPQQRTA-SDLD
NRAM1_ORYSJ      KFVS--RRELQAGDDTEKAQ-----VATCVADEHSKEPPV----------
NRAM5_ORYSJ      TFVA--DSSLAAVVDAEKAD-----AGDLAVDDDEPLPYRDDLADIPLPR
NRAT1_ORYSJ      TYVPVPERAQAQVEAGGTPV-----VDASAADEDQPAPYRKDLADASM--
NRAM4_ORYSJ      --------NLSDPFPTNSVS------GEIEVQHIQIQEKQEDLGVHL---
NRAM3_ARATH      PWPFKAESSH----------------------------------------
NRAM4_ARATH      PWQLVASSHKEPQRDDE---------------------------------
NRAM2_ARATH      PSPWSSSSIELPKRVSVSNS------------------------------
NRAM6_ORYSJ      NQIITTIRKSFS--------------------------------------
NRAM5_ARATH      SSWSSLEMSERVVSTET---------------------------------
NRAM2_ORYSJ      SRLRSAMTKST---------------------------------------
NRAM1_DICDI      SMTKKIKNLFNNNSNQTYNNINY---------------------------
NRAM1_BOVIN      G-ATLLAHSSHQRFLYGLPEEDQEKGRTSG--------------------
NRAM1_BISBI      G-ATLLAHSSHQRFLYGLPEEDQEKGRTSG--------------------
NRAM1_BUBBU      G-ATFLAHNSHQRFLYGLPEEDQEKGRTSG--------------------
NRAM1_CEREL      G-ATLLAHSSHQRFLYGLPEEDQENGRTSG--------------------
NRAM1_SHEEP      G-ATRLAHSSHQRFLYGLPGEDQEEGRTSG--------------------
NRAM1_HUMAN      G-ATFLAHSSHHHFLYGLLEEDQ-KGETSG--------------------
NRAM1_CANLF      G-VTLLAHSSHQHFLYGLPDVEE-KGKISG--------------------
NRAM1_PIG        G-ATLLVHSSHQHFLYGLLE------------------------------
NRAM1_MOUSE      G-ATFLTHSSHKHFLYGLPNEEQGGVQGSG--------------------
NRAM1_CHICK      G-ARFLARGRYNRFSFDVTADVPGLAGPH---------------------
NRAM2_RAT        G-LSFLDCGRSYHLGLTARPEIYLLNTVDAVSLVSR--------------
NRAM2_MOUSE      G-LSFLDCGRSYRLGLTAQPELYLLNTVDADSVVSR--------------
NRAM2_HUMAN      G-MSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR--------------
MVL_DROME        GNQRLMNSRWVQRFVLPSQNSFSIKNANSTYARIATSSDQEPEGLAGEDA
NRAMA_CAEEL      EIIPDTVSIRGFSFNKSYENDAPWLAVDSSAVHDNAGYQ-----------
NRAM2_DICDI      LLSKIFNNNNNNNNKNIINNNNNYSGNTINNQTIQ---------------
SMF3_YEAST       --------------------------------------------------
SMF2_YEAST       --------------------------------------------------
SMF1_YEAST       --------------------------------------------------
PDT1_SCHPO       --------------------------------------------------