CLUSTAL format seed alignment for MF_00222

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AROE_NOSS1       -------MITGKTKLLGVIGHPVEHSLSPVMHNAAIA--QLGLDYVYLPFPIAP---DNL
AROE_SYNY3       -----MPSITGKTKLLGVIGYPVGHSLSPVMHNAALQ--AMASDYAYVAFPIAP---EDL
AROE_THEEB       -----MPKISGQTQLLGVIGDPIEHTLSPAMHNAALE--YLGLNYVYVPFWVKP---QQL
AROE_AQUAE       -------MINAQTQLYGVIGFPVKHSLSPVFQNALIR--YAGLNAVYLAFEINP---EEL
AROE_METAC       -----------MKRVFGVFGDPVGHSLSPAMHNSAFS--ALGMDCIYHAFRVRP---ENL
AROE_METMA       -----------MKQVFGVFGDPVGHSLSPAMHNAAFS--ALGMDCIYHAFRVTP---EKL
AROE_HALSA       ------------MDVYGLIGNPVGHSLSPPLHAAAYD--ECGLDARYVTFEPAP---DDA
AROE_ARCFU       ------------MLYLGVIGYPIKHSVSPAMHNAALQ--HEGIEGIYLAFEVKP---DRL
AROE_METKA       --MSVSVSVDAETNVVGLIGHPVEHSLSPAMHNAAFK--ELGLNYVYLAFDVPP---ERL
AROE_METTH       -------MITGKTHVTGIMGHPLGHSLSPIMHNAAFR--SLGMDWIYVPFPVKP---ENL
AROE_METJA       -------MINAKTKVIGLIGHPVEHSFSPIMHNAAFK--DKGLNYVYVAFDVLP---ENL
AROE_PYRAB       ------------MKVYGLIGKPVSHSLSPVMHNALFR--KYGIDAVYVTFEVE-----EL
AROE_PYRFU       -------MINGETKIYGIIGNPVKHSLSPIMHNALFK--KFGINAIYVPFEVKK----DL
AROE_THEKO       -------MADAETRLYGVIGFPARHSLSPVMHNAAFR--ALGINAVYLAFEVPP---EEL
AROE_CHLTE       ------MSNSQSKKIFGLIGKHVDYSWSPLIHNTGFE--ALGLPCVYTIFNIPSP--EMI
AROE_STRPN       ------MKLDGYTRLAAVVANPIKHSISPFIHNRAFE--ATATNGAYVAWEIEA---SDL
AROE_STRR6       ------MKLDGYTRLAAVVANPIKHSISPFIHNRAFE--ATATNGAYVAWEIEA---SDL
AROE_LACLA       ------MNINGYTRMAAVVANPIKHSLSPFIHNLAFD--LTNENGVYLAWEVEA---EKL
AROE_LISMF       MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFA--KLGLDYVYLAFEVGD---KEL
AROE_LISMO       MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFA--KLGLDYVYLAFEVGD---KEL
AROE_LISIN       MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFA--KLGLDYVYLAFEVGD---KEL
AROE_STRP1       ----MSERLSGHTLLVSLLATPIRHSLSPKMHNEAYA--KLGLDYAYLAFEVGT---EQL
AROE_STRP3       ----MSERLSGHTLLVSLLATPIRHSLSPKMHNEAYA--KLGLDYAYLAFEVGT---EQL
AROE_STRP6       ----MSERLSGHTLLVSLLATPIRHSLSPKMHNEAYA--KLGLDYAYLAFEVGT---EQL
AROE_STRP8       ----MSERLSGHTLLVSLLATPIRHSLSPKMHNEAYA--KLGLDYAYLAFEVGT---EQL
AROE_BACHD       -----------MKKLFGLLGHPVGHSLSPLMHNQMFQ--LLDFDGYYHAFDVEP---SQL
AROE_BACSU       -----------MKKLYGVIGNPIGHSMSPDIHNASLK--DLGLDGHYHAFKVEE---NDL
AROE_CLOPE       ------------MKLFGLIGEKLGHSLSPEIHNKVFK--DNNIDGLYNLFSVKK---DFE
AROE_CALS4       ------MKIDSTTKVFGLIGHPVKHSLSPLIHNSSFE--KLNFNGVYVVFDVAP---ELL
AROE_STAAM       -------------MKFAVIGNPISHSLSPVMHRANFN--SLGLDDTYEALNIPI---EDF
AROE_STAAN       -------------MKFAVIGNPISHSLSPVMHRANFN--SLGLDDTYEALNIPI---EDF
AROE_STAAC       -------------MKFAVIGNPISHSLSPVMHRANFN--SLGLDDTYEALNIPI---EDF
AROE_STAAS       -------------MKFAVIGNPISHSLSPVMHRANFN--SLGLDDTYEALNIPI---EDF
AROE_STAAW       -------------MKFAVIGNPISHSLSPVMHRANFN--SLGLDDTYEALNIPI---EDF
AROE_STAAR       -------------MKFAVIGNPISHSLSPVMHRANFN--SLGLDDTYEALNIPI---EDF
AROE_STAES       ----------MIKVKFAVIGNPISHSLSPLMHHANFQ--SLNLENTYEAINVPV---NQF
AROE_STAEQ       -------------MKFAVIGNPISHSLSPLMHHANFQ--SLNLENTYEAINVPV---NQF
AROE_THEVO       --------MMPPDYVFGLIGHPVSHSIGQIVYNRYFQ--KKGLNAIYLSIDIFP----ET
AROE_THEAC       ---------MNGNSIIGLIGHPVSHSIGQILYNRIFQ--DMGIDAFYLAMDVHM----NV
AROE_PYRAE       ------------MYFAVIGAHVRGKSASPAMHTASFK--ALGINAVYIAVDVPK----EE
AROE_HELPH       ----------MKLKSFGVLGNPIKHSKSPLIHNACFLTFQKKLGFLGHYHPILL---PLE
AROE_HELPY       ----------MKLKSFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPILL---PLE
AROE_HELPJ       ----------MKLKSFGVFGNPIKHSKSPLIHNACFLTFQKELGFLGHYHPILL---PLE
AROE_HELAH       ----------MGLKSFGVLGNPIKHSKSPLIHNACFLTFQKELGFLGHYHPILL---PLE
AROE_HELHP       -----------MLGFFAVYGNPITHSKSPFLHNYAF----TKLGLSGYYSRILL---DKG
AROE_LEPIC       ----MKTKTNQSVKTFGIVGFPLSHSLSPLIHNSIYK--DRNINASYLVFETQN---LNV
AROE_LEPIN       ----MKTKTNQSVKTFGIVGFPLSHSLSPLIHNSIYK--DRNINASYLVFETQN---LNV
ARODE_CHLMU      ------<NLSPQSQICALIGD-TSRSIGHLTHNPFFS--QLSIPCPYVKLPLTP---QEL
ARODE_CHLTR      ------<SLSAQSPICALIGD-TSRSIGHLTHNPFFS--QLGVACPYIKLPLTP---QEL
ARODE_CHLPN      ------<KLSEKSHIYGLIGDPVDRSISHLSHNFLLS--KLSLNATYIKFPVTI---GEV
AROE_BUCAI       -------MFKCKNFNYAVFGNPINHSKSPEIHSLFSK--QTGISHFYKSCNVPLNSLYAV
AROE_BUCAP       -------MCKLEKFNYALFGNPIDHSQSPKIHNFFAT--QTGILHIYKAINIPLDQFSSV
AROE_BUCBP       -------MVKHCIDQFCVFGNPINHTQSPYIHSLFSK--QTGIVYEYSARLVPFKEFNSY
AROE_BUCCC       ---MQNSKYCEKKIHIALFGNPIEHSLSPLIHKNFSK--EIKINYNYNSFLCTKSNFFVI
AROE_ECOLI       ------------METYAVFGNPIAHSKSPFIHQQFAQ--QLNIEHPYGRVLAPINDFINT
AROE_ECO57       ------------METYAVFGNPIAHSKSPFIHQQFAQ--QLNIEHPYGRVLAPINDFVNT
AROE_ECOL6       ------------METYAVFGNPIAHSKSPFIHQQFAQ--QLNIEHPYGRVLAPINDFINT
AROE_SALTI       ------------MEAYAVFGNPIAHSKSPFIHQQFAQ--QLDIVHPYGRVLAPINNFINT
AROE_SALTY       ------------METYAVFGNPIAHSKSPFIHQQFAQ--QLDIVHPYGRVLAPINNFINT
AROE_YERPE       -----------MDQKFAVFGNPISHSKSPRIHTLFSE--QTGIEHRYGKVLAPSEAFENT
AROE_HAEIN       ------------MDLYAVWGNPIAQSKSPLIQNKLAA--QTHQTMEYIAKLGDLDAFEQQ
AROE_PASMU       ------------MDKYAVWGNPIAQSKSPQIHQIFAN--QTQQQMEYVAMLGDEQDFEQQ
AROE_HAEDU       -----------MARQYAVWGNPIAHSKSPYIHQLFAQ--QSNRRIEYAAKLGDKIAFEKQ
AROE_NEIFL       ---------MTTLPRYAVFGNPVAHSKSPQIHRQFAL--QEGVDIEYERICADIGGFAQA
AROE_NEIPO       ---------MTALPRYAVFGNPVAHSKSPQIHQQFTL--QEGVDIEYGRICADIDGFAQA
AROE_NEICI       ---------MTTISRYTVFGNPVAHSKSPQIHQQFAL--QEGVDIEYGRICADIGGFAQA
AROE_NEIMA       -------MTMHALPRYAVFGNPVAHSKSPQIHQQFAL--QEGVDIEYERICADIGGFAQA
AROE_NEIMB       ---------MTALPRYAVFGNPVAHSKSPQIHQQFAL--QEGVDIEYERICADIGGFAQA
AROE_NEIGO       ---------MHALPRYAVFGNPAAHSKSPQIHQQFAL--QEGVDIEYGRICADIGGFAQA
AROE_NEILA       ---------MTALPRYAVFGNPVAHSKSPQIHRQFAL--QEGVEIEYGRICADIGSFAQA
AROE_NEIMU       ---------MNTVPRYAVFGNPVAHSKSPQIHRQFAL--QEGVEIEYERICADTGGFAQA
AROE_NEIPH       ---------MNTIPRYAVFGNPVAHSKSPQIHRQFAL--QEGVEIEYERICADIGGFAQA
AROE_VIBVU       --------MTQQIDRYAVFGNPIEHSKSPFIHTLFAR--QTNQPLIYTAETAPKEGFVEA
AROE_VIBVY       --------MTQQIDRYAVFGNPIEHSKSPFIHTLFAR--QTNQPLIYTAETAPKEGFVEA
AROE_VIBPA       --------MTPQIDRYAVFGNPIGHSKSPFIHTLFAR--QTNQSLTYTAECAPVGGFIEA
AROE_VIBCH       --------MASQIDQYAVFGNPINHSKSPFIHTLFAR--QTQQSMIYTAQCVPVDGFTEA
AROE_PSEAE       ------------MDRYCVFGNPIGHSKSPLIHRLFAE--QTGEALVYDAQLAPLDDFPGF
AROE_XANAC       ----------MPVSRYAVFGHPVAHSLSPAIHADFGK--QTGIALDYTAIDASLEDFSAA
AROE_XANCP       ----------MPVSRYAVFGHPVAHSLSPAIHADFGK--QTGIALDYTAIDAAPEEFTAA
AROE_XYLFA       ----------MPVSRFAVFGHPIAHSLSPRIHTEFGR--QMGVALNYLAFDVAPDAFRVS
AROE_XYLFT       ----------MPVSRFAVFGHPIAHSLSPRIHTEFGR--QMGVVLDYLAFDVAPDAFRVS
AROE_AGRFC       ----MADSRETLTINAFVVGYPIKHSRSPIIHSYWLK--KFGIAGSYTAVEVSPDDFPKF
AROE_RHIME       ----MHDSRETFVNHAFVTGYPVKHSRSPLIHGHWLK--QFGIRGSYRAHEVTPEAFPDF
AROE_BRUME       ----MDDKSMARGRKAFVTGFPIRHSRSPLIHGFWLK--ELGIDGSYEAVEVKPEDFSSF
AROE_BRUSU       ----MDDKSMARGRKAFVTGFPIKHSRSPLIHGFWLK--ELGIDGSYEAVEVKPEDFSSF
AROE_RHILO       --------MVEATKKAFVTGHPIKHSRSPKIHGHWLA--QHGIDGSYEAIDVAPQDFAEF
AROE_CAUVC       ----MTNAITGAAIVGGVCGQPIKHSMSPVIHNAWIA--AAGLDAAYVPFAPAADRFETF
AROE_CORGL       ---------MNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGSRASGQDL
AROE_THEMA       -------------MKFCIIGYPVRHSISPRLYNEYFK--RAGMNHSYGMEEIPP----ES
                                  : .     :                                  

AROE_NOSS1       EAAIALLATIGVVGFSVTIPHKQAIIP-LLSEISPVAQAIGAVNTVTRQN--NQWVGTNT
AROE_SYNY3       TIAIAGLGASGVQGLSVTIPHKQVVMP-LLTQITETARQVGAVNTLWRDG--HGWQGTNT
AROE_THEEB       GVAIAGLEALNVVGFNVTIPHKETILP-YLADVSDLAQQVGAVNTVYRSE--KGWVGTNT
AROE_AQUAE       KKAFEGFKALKVKGINVTVPFKEEIIP-LLDYVEDTAKEIGAVNTVKFEN--GKAYGYNT
AROE_METAC       RKAILGAEAMGFGGLNLTVPLKEEALKLDFIRPDPLAERIGAVNTVVFSE-TGEIRGYNT
AROE_METMA       EKAILGAEAMGFGGINLTVPLKEKALKLDFVKPDPLAKRIGAVNTLVFGK-KGDIQGYNT
AROE_HALSA       AAAIRGAGALGVAGLNVTAPFKQSAA--SAVATDSMAARVGAVNTIDFSG-AAP-RGYNT
AROE_ARCFU       RDAVFGAKALGFRGLNVTIPFKESVV--EFVELEGEAAKIKTVNTIDLVE-MV---GYNT
AROE_METKA       EGAVRGAADLGIVGLNVTIPHKEAVME-LCDELDRDAELIGAVNTVRF-S-RGKIEGFNT
AROE_METTH       KAAVEGLRALGVEGVNVTIPHKEAVLE-YIDDIHGTAALIGAVNTLKF-D-DGTVRGYNT
AROE_METJA       KYVIDGAKALGIVGFNVTIPHKIEIMK-YLDEIDKDAQLIGAVNTIKI-E-DGKAIGYNT
AROE_PYRAB       GKAIDGVRALGISGLNVTMPYKEVVTK-FLDELSEDAREINSVNTIIN-L-EGSLIGYTT
AROE_PYRFU       KNAINGVKALDIQGVNVTMPYKEEVIK-FLDELSEDSQNIGSVNTVVN-L-EGKLVGYTT
AROE_THEKO       GEAIGGAKALGISGLNVTMPHKEAVIH-FLDSLSEDSGEIGSVNTVVN-R-KGRLEGHTT
AROE_CHLTE       GDALKGSRALGIAGFSVTIPYKKTVVP-FLDELSPEALSIGAVNTIVN-D-NGRLLGYNT
AROE_STRPN       VETVANIRRYQMFGINLSMPYKEQVIP-YLDKLSDEARLIGAVNTVVNEN--GNLIGYNT
AROE_STRR6       VETVANIRRYQMFGINLSMPYKEQVIP-YLDKLSDEARLIGAVNTVVNEN--GNLIGYNT
AROE_LACLA       PAIVDNVRTLDMYGLNISMPYKTEITP-FMDELSPAAELIGAVNTVVNQS--GKLIGHNT
AROE_LISMF       KDVVQGFRAMNLRGWNVSMPNKTNIHK-YLDKLSPAAELVGAVNTVVNDD--GVLTGHIT
AROE_LISMO       KDVVQGFRAMNLRGWNVSMPNKTNIHK-YLDKLSPAAELVGAVNTVVNDD--GVLTGHIT
AROE_LISIN       KDVVQGFRAMNLRGWNVSMPNKTNIHK-YLDKLSPAAELVGAVNTVVNDD--GVLTGHIT
AROE_STRP1       ADAVQGIRALGIRGSNVSMPNKEAILP-LLDDLSPAAELVGAVNTVVNKDGKGHLVGHIT
AROE_STRP3       ADAVQGIRALGIRGSNVSMPNKEAILP-LLDDLSPAAELVGAVNTVVNKDGKGHLVGHIT
AROE_STRP6       ADAVQGIRALGIRGSNVSMPNKEAILP-LLDDLSPAAELVGAVNTVVNKDGKGHLVGHIT
AROE_STRP8       ADAVQGIRALGIRGSNVSMPNKEAILP-LLDDLSPAAELVGAVNTVVNKDGKGHLVGHIT
AROE_BACHD       EKAVEGARALQMQGFNVTIPHKVTIMD-YLDMVDEEAQEIGAVNTVVMKD--GQLFGSNT
AROE_BACSU       EDAVKGIRALGVQGINVTVPHKVSIMD-YLDHIDESAKVLGAVNTVRREG--DKLVGYNT
AROE_CLOPE       NNIVESLKCLGVKGANVTIPYKEKVMD-QLDIISHEAKVIGAVNTILIKD--GKSYGYNT
AROE_CALS4       ENAVKGLKALGIKGFNVTVPHKESVMN-YLDFVTEEAEKIGAVNTVVNEN--GILKGYNT
AROE_STAAM       HLIKEIISKKELDGFNITIPHKERIIP-YLDYVDEQAINAGAVNTVLIKD--GKWIGYNT
AROE_STAAN       HLIKEIISKKELDGFNITIPHKERIIP-YLDYVDEQAINAGAVNTVLIKD--GKWIGYNT
AROE_STAAC       HLIKEIISKKELEGFNITIPHKERIIP-YLDYVDEQAINAGAVNTVLIKD--GKWIGYNT
AROE_STAAS       HLIKEIISKKELDGFNITIPHKERIIP-YLDHVDEQAINAGAVNTVLIKD--DKWIGYNT
AROE_STAAW       HLIKEIISKKELDGFNITIPHKERIIP-YLDHVDEQAINAGAVNTVLIKD--DKWIGYNT
AROE_STAAR       HLIKEIISKKELDGFNITIPHKERIIP-YLDHVDEQAINAGAVNTVLIKD--GKWIGYNT
AROE_STAES       QDIKKIISEKSIDGFNVTIPHKERIIP-YLDDINEQAKSVGAVNTVLVKD--GKWIGYNT
AROE_STAEQ       QDIKKIISEKSIDGFNVTIPHKERIIP-YLDDINEQAKSVGAVNTVLVKD--GKWIGYNT
AROE_THEVO       LKYFMSYA-SKMDGFNVTIPHKISIMD-YLDQIDWEARSIGSVNLVKTED--GLLKGFNT
AROE_THEAC       LPAFLKNS-FFLKAFNVTIPHKVSIIP-FLDDLDEIASQTRSVNLVIREQ--SRMKGYNT
AROE_PYRAE       LGCFAQIARLNFRGFNVTIPHKEEVVK-FLDALSAEARAIGAVNTVLVER--NLMVGYNT
AROE_HELPH       SHIKNEFLHLGLSGANVTLPFKERAFQ-ICDKIKGIALECGAVNTLVLED--DELVGYNT
AROE_HELPY       SHIKSEFLHLGLSGANVTLPFKERAFQ-VCDKIKGIALECGAVNTLVLEN--DELVGYNT
AROE_HELPJ       SRIKNEFLHLGLSGANVTLPFKERAFQ-ICDKIKGIALECASVNTLVLEN--DELVGYNT
AROE_HELAH       SHIKNEFLNLGLSGANVTLPFKERAFQ-VCDKIKGIALECGAVNTLVLEN--DELVGYNT
AROE_HELHP       ANLRQNFLSNGLSGANITLPFKEEAFN-QCDEVRGVAQNIGACNTWVLEDK-NHLVGYNT
AROE_LEPIC       EKI-QEFRNSGILGLSVTIPHKETAFT-LADKADDTSRIMKASNTLLIGP--DSTYAYNT
AROE_LEPIN       EKI-QEFRNSGILGLSVTIPHKETAFT-LADKADDTSRIMKASNTLLIGP--DSTYAYNT
ARODE_CHLMU      PEFFSSIRALPFLGISVTSPLKTAIIP-FLDKQDSSVKLSGSCNTLVIRQ--GEIIGYDT
ARODE_CHLTR      PKFFSTIRTQPFLGVSVTSPLKTAVLP-FLDKQAPSVKASGSCNTLVIRQ--GEIEGHDT
ARODE_CHLPN      VTFFSAIRDLPFSGLSVTMPLKTAIFD-HVDALDASAQLCESINTLVFRN--QKILGYNT
AROE_BUCAI       LQDFFKKDG---RGANITAPFKQEAYF-FCNKLTKRAEVAQSVNTLKKIDN-CNILGDNT
AROE_BUCAP       VSDFFKKNI---KGANVTAPFKKEAYF-FSDKLTERAKIAQSVNTLKKISD-KCILGDNT
AROE_BUCBP       VLNFFLNKG---KGANITVPFKENAYV-ISNNLTIRAKMSRAVNTFKKLHN-NKILGDNT
AROE_BUCCC       VKNFFQNGG---FGCNITVPFKKKSFQ-ISNKNTKYVKISNSVNVLKKSSN-NNIIGYNT
AROE_ECOLI       LNAFFSAGG---KGANVTVPFKEEAFA-RADELTERAALAGAVNTLMRLED-GRLLGDNT
AROE_ECO57       LNAFFSAGG---KGANVTVPFKEEAFA-RADELTERAALAGAVNTLKRLED-GRLLGDNT
AROE_ECOL6       LNTFFSAGG---KGANVTVPFKEEAFA-RADELTERAALAGAVNTLKRLED-GRLLGDNT
AROE_SALTI       LDAFFAAGG---KGANITVPFKEEAFA-RSDELTERASLAGAVNTLKRLED-GRLLGDNT
AROE_SALTY       LDAFFAAGG---KGANITVPFKEEAFA-RSDELTERASLAGAVNTLKRLED-GRLLGDNT
AROE_YERPE       LVSFFADGA---QGANITTPFKERAYD-QCDELTDRASLAGAVNTIKRLED-GRLLGDNT
AROE_HAEIN       LLAFFEEGA---KGCNITSPFKERAYQ-LADEYSQRAKLAEACNTLKKLDD-GKLYADNT
AROE_PASMU       LRVFFEKGA---KGCNITAPFKERAFQ-LADLHSERCLTAEACNTLKKLDD-GRLYGDNT
AROE_HAEDU       LVQFFTDGA---NGVNITSPFKARAFR-LADVCSESCLLAGAANTLKRLDD-GRLFADNT
AROE_NEIFL       VSTFFETGG---CGANVTVPFKQEAFD-LADEHSERALAAGAVNTLILLKN-GKLRGDNT
AROE_NEIPO       VSTFFETGG---CGANVTVPFKQEAFA-LADEHSDRALAAGAVNTLILLKN-GKLRGDNT
AROE_NEICI       VSIFFETGG---CGANVTVPFKQEAFA-LADEYSERASAAGAVNTLILLEN-GKLRGDNT
AROE_NEIMA       VSTFFETGG---CGANVTVPFKQEAFH-LADEHSERALAAGAVNTLIFLKN-GKLRGDNT
AROE_NEIMB       VSTFFETGG---CGANVTVPFKQEAFH-LADEHSERALAAGAVNTLIPLKN-GKLRGDNT
AROE_NEIGO       VSTFFETGG---CGANVTVPFKQEAFH-LADEHSDRALAAGAVNTLVWLED-GRIRGDNT
AROE_NEILA       VSTFFGTGG---CGANVTVPFKQEAFD-LADEHSERASAAGAVNTLILLEN-GKLRGDNT
AROE_NEIMU       VEAFFADGG---RGANVTVPFKQEAFA-LSDEHSERALAAGAVNTLILLEN-GKIRGDNT
AROE_NEIPH       VEAFFANGG---RGANVTVPFKQEAFA-LSDEHSERALAAGAVNTLILLEN-GKIRGDNT
AROE_VIBVU       VKAFFAEGG---KGCNVTLPFKEEAYQ-FASRLTERAQLAGAVNTLKKLDD-GDIIGDNT
AROE_VIBVY       VKAFFAEGG---KGCNVTLPFKEEAYQ-FASRLTERAQLAGAVNTLKKLDD-GDIIGDNT
AROE_VIBPA       AKAFFADGG---KGCNVTLPFKEDAYQ-FASRLTERAQLAGAVNTLKKLDD-GEIIGDNT
AROE_VIBCH       AKHFFAQGG---RGCNVTVPFKEEAYR-FADRLTERARLAGAVNTLKKLDD-GEILGDNT
AROE_PSEAE       ARRFFEQG----KGANVTVPFKEEAYR-LVDELSERATRAGAVNTLIRLAD-GRLRGDNT
AROE_XANAC       LQRFADEGG---KGANVTLPLKEAAYA-LASSLSDRARLAGAVNTLVR-ND-GQWQGDNT
AROE_XANCP       LERFAADGG---KGANVTLPLKEAAFA-LSASLSDRARVAGAVNTLVR-ND-GQWQGDNT
AROE_XYLFA       LERFVAEGG---CGANVTLPLKEAAFE-VCTTLSARARRAGAVNTLSR-VD-GVWHGENT
AROE_XYLFT       LEHFVAEGG---CGANVTLPLKEAAFE-VCTTLSARARRAGAVNTLSR-VD-GVWHGENT
AROE_AGRFC       IATLKEGKPGAAVGGNATIPHKEAAYR-LADHPDALAEELGAANTIWM-EE-GKLHATNT
AROE_RHIME       MRQIKEGR-TDFCGGNVTIPHKEAAFR-LADRPDELSAELGAANTLWL-EN-GKIRATNT
AROE_BRUME       AASLAANG---FAGGNVTIPHKEAAYA-AAESLDEAARAIGAVNTLWL-EN-GRLCGGNT
AROE_BRUSU       AASLAANG---FAGGNVTIPHKEAAYA-AAESLDEAACAIGAVNTLWL-EN-GRLCGGNT
AROE_RHILO       IAALQANG---FRGGNVTIPHKEAAFA-VAQRRDQAAEEIGAVNTLWF-ED-GVLRGGNT
AROE_CAUVC       VDGLRGGA---VRGLNVTIPFKERALA-VADTASDLARMAGAANLLVFNED-GSVHADNT
AROE_CORGL       KTLLDAALYLGFNGLNITHPYKQAVLP-LLDEVSEQATQLGAVNTVVIDAT-GHTTGHNT
AROE_THEMA       FDTEIRRILEEYDGFNATIPHKERVMR--YVEPSEDAQRIKAVNCVFRGK------GYNT
                              . . : * *                   : *            .  *

AROE_NOSS1       DIEGFIAPLQ-TTYKRDWSQQIAVILGNGGAARAVVAGCYQLGF--AEIHVVGRNVQRLE
AROE_SYNY3       DVEGFLAPLL-E-LKQDWSGRTAVILGYGGAARAVVVGLTQLGC--PEIIVVGRSQEKLA
AROE_THEEB       DVHGFLAPLR-Q-QSCLWSEIAVLVLGYGGAARAVVTACYDLGC--RQIYISGRQRERLG
AROE_AQUAE       DWIGFLKSLK-S-LIPEVKEKSILVLGAGGASRAVIYALVKEG---AKVFLWNRTKEKAI
AROE_METAC       DGLGARQALL--EAAVEIRGSKVVVAGAGGAARAVAFQLAADG---AEITVVNRTEERAV
AROE_METMA       DGPGAKQALL--DTGVEIRGSRMVVAGAGGAARAVAFQLAADG---ADITVINRTEERAV
AROE_HALSA       DVAGVKRAFA--HHDVSLSGAQAVVVGAGGAGRAAAFALADAG---ATVRIANRT----R
AROE_ARCFU       DVYGVKAALS--GTE--LGGKTALVVGAGGAGKAAALALLDMG---STVIVANRTEEKGR
AROE_METKA       DGEGFLRALR-EETYFDPRGTKSVILGAGGAARAVSFKLATEGA--DEIVIANRTVDRAE
AROE_METTH       DASGCLRALE-EVTSVE--GSSVLILGAGGAARACAFQLAEKGA--SDITILNRTPEKAR
AROE_METJA       DGIGARMALE-EEIGRVK-DKNIVIYGAGGAARAVAFELAKD----NNIIIANRTVEKAE
AROE_PYRAB       DGVGARKALE-RFTEIE--GRNVLILGAGGAGKAIAYELSKI----ANIVVLNRTPSKAK
AROE_PYRFU       DGIGARRALE-RFTQVD--GANILILGAGGAGKAIAYELSKV----ANVVVLNRTIEKAK
AROE_THEKO       DGLGARRALE-RAIELG--GRRILIIGAGGAGKAIAYELSRD----NEVVVLNRTPEKAK
AROE_CHLTE       DIDGFAAPLL-PMAESIR-NRPVCIFGNGGAALAAVEAFRLRFNPSSVLLVVRDTQKAED
AROE_STRPN       DGKGFFKCLP-S--FTIS-GKKMTLLGAGGAAKSILAQAILDGV--SQISVFVR-SVSME
AROE_STRR6       DGKGFFKCLP-S--FTIS-GKKMTLLGAGGAAKSILAQAILDGV--SQISVFVR-SVSME
AROE_LACLA       DGIGFFNSLE-KYHFNIQ-NKQMLILGGGGAAIAIIAQAALSGA--KKIVVAARKSASYI
AROE_LISMF       DGTGYMRALK-EAGHDII-GKKMTICGAGGAATAICIQAALDGV--KEISIFNRKDDFYA
AROE_LISMO       DGTGYMRALK-EAGHDII-GKKMTICGAGGAATAICIQAALDGV--KEISIFNRKDDFYA
AROE_LISIN       DGTGYMRALK-EAGHDII-GKKMTICGAGGAATAICIQAALDGV--KEISIFNRKDDFYA
AROE_STRP1       DGIGALRALA-DEGVSVK-NKIITLAGVGGAGKAIAVQLAFDGA--KEVRLFNRQATRLS
AROE_STRP3       DGIGALRALA-DEGVSVK-NKIITLAGVGGAGKAIAVQLAFDGA--KEVRLFNRQATRLS
AROE_STRP6       DGIGALRALA-DEGVSVK-NKIITLAGVGGAGKAIAVQLAFDGA--KEIRLFNRQATRLS
AROE_STRP8       DGIGALRALA-DEGVSVK-NKIITLAGVGGAGKAIAVQLAFDGA--KEIRLFNRQATRLS
AROE_BACHD       DGQGYLESLM-DVVTTPFPTQDVLIIGAGGAARAIGTVLKREKV--RSITIANRTLAKAE
AROE_BACSU       DGEGFVKSLM-KVLDKPISELSFLMIGAGGAARAIFTTIVRNTP--KKFDICNRTLEKAK
AROE_CLOPE       DYYGFGKML--ERAKVNIEGNSFFVLGAGGAARSILKYLEDSKA--KKIVLVSR--DKEK
AROE_CALS4       DVQGFIDSL--KELKEDVRGRKAFVLGAGGASKAICFALAREGV--ESIVIANRTLNKAK
AROE_STAAM       DGIGYVKGL--HSVYPDLENAYILILGAGGASKGIAYELAKFVK--PKLTVANRTMARFE
AROE_STAAN       DGIGYVKGL--HSVYPDLENAYILILGAGGASKGIAYELAKFVK--PKLTVANRTMARFE
AROE_STAAC       DGIGYVKGL--HSVYPDLENAYILILGAGGASKGIAYELAKFVK--PKLTVANRTMARFE
AROE_STAAS       DGIGYVKGL--HSVYPDLENAYILILGAGGASKGIAYELAKFVK--PKLTVANRTMARFE
AROE_STAAW       DGIGYVKGL--HSVYPDLENAYILILGAGGASKGIAYELAKFVK--PKLTVANRTMARFE
AROE_STAAR       DGIGYVKGL--HSVYPDLENAYILILGAGGASKGIAYELAKFVK--PKLTVANRTMARFE
AROE_STAES       DGIGYVNGL--KQIYEGIEDAYILILGAGGASKGIANELYKIVR--PTLTVANRTMSRFN
AROE_STAEQ       DGIGYVNGL--KQIYEGIEDAYILILGAGGASKGIANELYKIVR--PTLTVANRTMSRFN
AROE_THEVO       DYYGIEYMFK-KGGVDVS-GKSIVVAGSGGIARTVIHYLIKNNA--KSVTVKARDVKLAK
AROE_THEAC       DYYGLDYALS-FNQVEIE-EKRIVIAGSGGIARTVIRYMLDHGA--HRVDVLTRNAQNAR
AROE_PYRAE       DAHAV---YK-LAGGHME-GAEVLILGAGGAARAALFAAIKAGA--KKIYVKNRTAERAE
AROE_HELPH       DALGFWLSLG-DEG--YQS---ALILGSGGSAKALACELKKQGLK-VSVLNRSARGLDFF
AROE_HELPY       DALGFYLSLK-QKN--YQN---ALILGAGGSAKALACELKKQGLQ-VSVLNRSSRGLDFF
AROE_HELPJ       DALGFYLSLK-HQN--YQNDQNALILGAGGSAKALACGLQKQGLK-VSVLNRSARGLDFF
AROE_HELAH       DALGFYLSLK-QKN--YQS---ALILGSGGSAKALACELKKRGLK-VSVLNRSTKGLDFF
AROE_HELHP       DAQGFYECIK-EYK--IKN---ALIIGAGGSAKAVAMILQSHNIP-TTLINRSVQNLSFF
AROE_LEPIC       DGEGAYHSIL-EFSPESLKTGKVVILGSGGSARGIAFSLAVSGKI-QNLLVCSRNEITAK
AROE_LEPIN       DGEGAYHSIL-EFSPESLKTGKVVILGSGGSARGIAFSLAVSGKI-QNLLVCSRNEITAK
ARODE_CHLMU      DGEGLFSVLT-QHN-MDLSNQRVAILGAGGAARSIAARLSRTG---CELLIFNRTKIHAE
ARODE_CHLTR      DGEGLFSVLM-QHQ-IPLNNQRVAIIGAGGAAQSIATRLSRAN---CELLIFNRTKAHAE
ARODE_CHLPN      DGEGVAKLLK-QKN-ISVNNKHIAIVGAGGAAKAIAATLAMQG---ANLHIFNRTLSSAA
AROE_BUCAI       DGIGLLSDLI-RLNFIKKNYS-ILIIGAGGAARGVLFPLLSYG---CSICIFNRTVLNAE
AROE_BUCAP       DGIGLLSDLV-RLNFIKKNFS-ILILGAGGAVKGVLLPLLSLG---CSVYILNRTILNAK
AROE_BUCBP       DGIGVLHDLK-RIKFIKSKFNRVLLIGAGGAARGIIFSLLSYG---CSIVVLNRTITRAL
AROE_BUCCC       DGIGLIYDLN-RLKYITENSF-ILILGSGGAVYSIVYHLLKKK---CCIFILNRTISKSC
AROE_ECOLI       DGVGLLSDLE-RLSFIRPG-LRILLIGAGGASRGVLLPLLSLD---CAVTITNRTVSRAE
AROE_ECO57       DGVGLLSDLE-RLSFIRPG-LRILLIGAGGASRGVLLPLLSLD---CAVTITNRTVSRAE
AROE_ECOL6       DGIGLLSDLE-RLSFIRPG-LRILLIGAGGASRGVLLPLLSLD---CAVTITNRTVSRAE
AROE_SALTI       DGIGLLSDLE-RLNFIRPG-LRILLIGAGGASRGVLLPLLSLD---CAVTITNRTASRAE
AROE_SALTY       DGIGLLGDLE-RLNFIRPG-LRILLIGAGGASRGVLLPLLSLD---CAVTITNRTASRAE
AROE_YERPE       DGIGLLSDLE-RQNLIRTT-DHILLVGAGGAARGVILPLLSYG---CTVVVTNRTHTRAQ
AROE_HAEIN       DGIGLVTDLQ-RLNWLRPN-QHVLILGAGGATKGVLLPLLQAQ---QNIVLANRTFSKTK
AROE_PASMU       DGAGLVSDLQ-RLGWLKPE-QTILILGAGGATKGVLLPLLQAK---QHIVLANRTLSKAE
AROE_HAEDU       DGKGFCADLA-RLEWLIPE-QRVLILGAGGVTKGVLLPLLLAK---QKVTLSNRTHIKAV
AROE_NEIFL       DGIGLANDIT-QVKNIAIEDKTILLLGAGGAVRGVIPVLKEHRP--ARIVITNRTHAKAE
AROE_NEIPO       DGIGLVNDIT-QVKNIAIEGKTILLLGAGGAVRGVIPVLKEHRP--ARIVIANRTHAKAE
AROE_NEICI       DGIGLSNDIT-QVKNIAIECKTILLLGAGGAVRGVIPVLKEHRP--ARIVIANRTHAKAE
AROE_NEIMA       DGIGLANDIT-QVKNIAIEGKTILLLGAGGAVRGVIPVLKEHRP--ARIVIANRTRAKAE
AROE_NEIMB       DGIGLTNDIT-QVKNIAIEGKTILLLGAGGAVRGVIPVLKEHRP--ARIVIANRTRAKAE
AROE_NEIGO       DGIGLANDIT-QVKNIAIEGKTILLLGAGGAVRGVIPVLKEHRP--ARIVIANRTRAKAE
AROE_NEILA       DGLGLVGDIV-KVQNTEVEGKNILLLGAGGAVRGVIPVLLAQNP--ARIVIANRTRAKAE
AROE_NEIMU       DGIGLTDDIS-KRLGVELSGKTVLLLGAGGAVRGVIPVLKEYRP--ARIVIANRTHTKAA
AROE_NEIPH       DGLGLTDDIA-KRLGVEISDKTVLLLGAGGAVRGVIPVLKEYHP--ARIVIANRTHAKAA
AROE_VIBVU       DGAGLVQDLL-QHQ-VVLAGARILVIGAGGAARGVLKPLLDQKP--TSLTITNRTFSKAE
AROE_VIBVY       DGAGLVQDLL-QHQ-VVLAGARILVIGAGGAARGVLKPLLDQKP--TSLTITNRTFSKAE
AROE_VIBPA       DGAGLVQDLL-QHQ-VVLEGARILIIGAGGAARGVIKPLLDQKP--TSLTITNRTFSKAE
AROE_VIBCH       DGEGLVQDLL-AQQ-VLLKGATILLIGAGGAARGVLKPLLDQQP--ASITVTNRTFAKAE
AROE_PSEAE       DGAGLLRDLT-ANAGVELRGKRVLLLGAGGAVRGVLEPFLGECP--AELLIANRTARKAV
AROE_XANAC       DGAGLVRDLT-ERQGLDLRGRRVLLLGAGGAARGVAPALLEAGI--TAMVVVNRSPERAD
AROE_XANCP       DGAGLVRDLT-ERHGLDLRGRRVLLLGAGGAARGVAPALLEAGI--TEMVVVNRSPERAD
AROE_XYLFA       DGTGLVRNLT-ERHGLDLRGRRALLLGAGGAARGVAPALLDAGI--TEMVIVNRSPERAD
AROE_XYLFT       DGTGLVRNLT-ERHGLDLRGRRALLLGAGGAARGVAPALLDAGI--TEMVIVNRSPERAD
AROE_AGRFC       DGYGFVSNLDERHPGWD-KTQRAVVFGAGGASRAVIQSLRDRDV--AEIHVVNRTVERAR
AROE_RHIME       DGRGFVANLDERAKGWD-RISAAVILGAGGASRAVIQAIRDRGV--KTIHVVNRTPERAR
AROE_BRUME       DAYGFAANLDASAPGWD-KADRALVLGAGGASRAVVHALLSRGV--CHVSVVNRTLSRAE
AROE_BRUSU       DAYGFAANLDASAPGWD-KADRALVLGAGGASRAVVHALLSRGV--CHVSVVNRTLSRAE
AROE_RHILO       DGHGFAANLDDCAPGWA-NTGPAVVLGAGGASRAVIQALKQRGF--SDIRIVNRTLARAQ
AROE_CAUVC       DGPGLLGAIAIQAPGFDVTAAPVVILGAGGAARGAVAALLLAGA--PRIAVVNRTVARAQ
AROE_CORGL       DVSGFGRGME--EGLPNAKLDSVVQVGAGGVGNAVAYALVTHGV--QKLQVADLDTSRAQ
AROE_THEMA       DWVGVVKSLE-----GVEVKEPVVVVGAGGAARAVIYALLQMGV--KDIWVVNRTIERAK
                 *  .                      * **                  .           

AROE_NOSS1       EFRHSWENSPIAENLQVHTWD------YLAKLIPQANLLVNTTPIGMYPQ-VDESPLSAE
AROE_SYNY3       QFANSWTDPKIKQALQVLPWE------ALSTVIPKASLLINSTPVGMAPH-PKQSPLDQS
AROE_THEEB       AFVASWP----QITLHPLLWS------ERATCLAKISLVVNTTPIGMSPH-TGATPLTAE
AROE_AQUAE       KLAQKFP---------LEVVN------SPEEVIDKVQVIVNTTSVGLKDK-DPE----IF
AROE_METAC       ELAKDV-AAASLPGKINGTGL-----SGLKELLRDADILINTTTLGMHPN----TDTTIA
AROE_METMA       GLAREI-SAADLPGKIRGTGL-----SGLKELLRDADVLINTTTLGMHPN----TDATIV
AROE_HALSA       AAADEL-AAD---VGGTAVGL-----GDLPRSLADATVLVHATTVGMDD-----PDTSPV
AROE_ARCFU       EAVEML-RRY---GECIFWPL-----SRVEELKGKVDVVVNATPLGMRGF----KAEIPV
AROE_METKA       RLAEELKEKVGVKARAIGLDG-----DEIERELRDADLLVDATPVGMYPNE---DEPPLV
AROE_METTH       LLAEDMADKLGFEASYGGYE-------LIQGSVKSADILIDTTPVGMHPHT---DDRPLV
AROE_METJA       ALAKEIAEKLNKKFGE-EVKF-----SGLDVDLDGVDIIINATPIGMYPNI---DVEPIV
AROE_PYRAB       SL-----EKFGVKGGS--L-------DELPNYVGWADVLINATSVGMGTN------ESLV
AROE_PYRFU       RL-----EKFGIVGDS--L-------EALPYYVEWADILINATSVGMNEE------KSLV
AROE_THEKO       AL-----ERFGITGDA--LNR-----ENLGEYLEWAEVLINATSVGMNSW------ETPV
AROE_CHLTE       MLEEYAYRDLVTIHAGREIDQ-----PACSKLIRDCRVLVNATPVGTAGRNDHIHSILPT
AROE_STRPN       KTRPYLDKLQEQTGFKVDLCALEYV-SELQARIAESDLLVNATSVGMD-----GQSSPVP
AROE_STRR6       KTRPYLDKLQEQTGFKVDLCALEYV-SELQARIAESDLLVNATSVGMD-----GQSSPVP
AROE_LACLA       PLKEKLEKLSVKTGIEILLTDLSEA-DRLQKELKQTDLLVNATSVGMD-----GESLPLE
AROE_LISMF       NAEKTVEKINSKTDCKAQLFDIEDH-EQLRKEIAESVIFTNATGVGMKPF---EGETLLP
AROE_LISMO       NAEKTVEKINSKTDCKAQLFDIEDH-EQLRKEIAESVIFTNATGVGMKPF---EGETLLP
AROE_LISIN       NAEKTVEKINTKTNCKAQLFDMEDH-EQLRKEIAESVIFTNATGVGMKPF---EGETLLP
AROE_STRP1       SVQKLVTKLNQLTRTKVTLQDLEDQ-TAFKEAIRESHLFIDATSVGMKPL---ENLSLIT
AROE_STRP3       SVQKLVTKLNQLTRTKVTLQDLEDQ-TAFKEAIRESHLFIDATSVGMKPL---ENLSLIT
AROE_STRP6       SVQKLVTKLNQLTRTKVTLQDLEDQ-TAFKEAIRESHLFIDATSVGMKPL---ENLSLIT
AROE_STRP8       SVQKLVTKLNQLTRTKVTLQDLEDQ-TAFKEAIRESHLFIDATSVGMKPL---ENLSLIT
AROE_BACHD       EFSGVLESSETSCSALSLKEA--------EQQLERFSVIINTTSVGMSPR----VDDMPL
AROE_BACSU       RLTEATPSF-HNKEVLSIKEA--------EERLEQYDVIIHTTSVGMYPN----VDDVPL
AROE_CLOPE       AFKKFK----DFNINFMSYGE--------LEEINEEFALINTTPCGMYPN----TNSVAV
AROE_CALS4       ALAEYIREEFKMKCDYCSIEE--------VEKFNEIDILINTTSVGMHPE----VGNSPV
AROE_STAAM       SWNLNI-------NQISLADA--------EKYLAEFDIVINTTPAGMAGN----NES-II
AROE_STAAN       SWNLNI-------NQISLADA--------EKYLAEFDIVINTTPAGMAGN----NES-II
AROE_STAAC       SWNLNI-------NQISLADA--------EKYLAEFDIVINTTPAGMAGN----NES-II
AROE_STAAS       SWNLNI-------NQISLADA--------EKYLAEFDIVINTTPAGMAGN----NES-II
AROE_STAAW       SWNLNI-------NQISLADA--------EKYLAEFDIVINTTPAGMAGN----NES-II
AROE_STAAR       SWNLNI-------NQISLADA--------EKYLAEFDIVINTTPAGMAGN----NES-II
AROE_STAES       NWSLNI-------NKINLSHA--------ESHLDEFDIIINTTPAGMNGN----TDS-VI
AROE_STAEQ       NWSLNI-------NKINLSHA--------ESHLDEFDIIINTTPAGMNGN----TDS-VI
AROE_THEVO       NKLNAYDVDIKEYANN------------------DYDIYINCTPLGTEAV------GDPF
AROE_THEAC       RNLDIPGIGLHENIDE------------------DYDIYVNCTPLGTLGD------GDPF
AROE_PYRAE       ALAREFREKFERPIEAI-----------------PWSGAVKADVVINATP------IHDA
AROE_HELPH       QRLGCDCFMEP---PKSAFDLIIN--------ATSASLN-NELPLNKE-----------V
AROE_HELPY       QRLGCDCFMEP---PKSAFDLIIN--------ATSASLH-NELPLNKE-----------V
AROE_HELPJ       QRLGCDCFMEP---PKSAFDLIIN--------ATSASLH-NELPLNKE-----------V
AROE_HELAH       QNLGCACFTTT---PKGAFDLIIN--------ATSASLN-NELPLDKE-----------V
AROE_HELHP       VHKGFECYVNSEFKPTCSYDILIN--------TTSAGLNDNLLPCDES-----------Q
AROE_LEPIC       EICLLVTKNSNVKAEPISQDVLLTRKEEISLVIHTTPLGMKGQSPGPY-----------L
AROE_LEPIN       EICLLVTKNSNVKAEPISQDVLLTRKEEISLVIHTTPLGMKGQSPGPY-----------L
ARODE_CHLMU      AIA------SRYQAQAFDIKDLP---------LHSVSLIINCLPPSSI-----------I
ARODE_CHLTR      DLA------SRCQAKAFSLEELP---------LHRVSLIINCLPPSCT-----------I
ARODE_CHLPN      ALA------TCCKGKAYPLGSLEN--------FKTIDIIINCLPPEVT-----------F
AROE_BUCAI       KLVLQFHKYGNINVFNTNSLHVKS-----------FDLIINATSHFIQDKDNFIPF--SC
AROE_BUCAP       ILVKQFNKYGKIFVFDRQNFKQQN-----------FDLVINAMSRNTE-KKNFLPL--SL
AROE_BUCBP       QLVEDFKNVGSISIFKEKFASNYS-----------FNLIINATTINICQNSNLSTIK-SL
AROE_BUCCC       ILVNKFKKFGKIFVFD-KNLYTKK-----------FDIIINATSCGLYNFSPKFPK--NL
AROE_ECOLI       ELAKLFAHTGSIQALSMDELEGHE-----------FDLIINATSSGISGDIPAIPSS-LI
AROE_ECO57       ELAKLFAHTGSIQALGMDELEGHE-----------FDLIINATSSGISGDIPAIPSS-LI
AROE_ECOL6       ELAKLFAHTGSIHALGMDELEGHE-----------FDLIINATSSGISGDIPAIPPS-LI
AROE_SALTI       ALAKIFAHTGSVHAMDMDKLDGCE-----------FDLIINATSSGIRGEIPAIPAS-LI
AROE_SALTY       ALAKIFAHTGSVHATDMDKLDGCE-----------FDLIINATSSGIRGEIPAIPAS-LI
AROE_YERPE       QLAKVFNHIGDIDVCEMSELAGQR-----------FDLVINATASGLHGEVPNLPAA-IL
AROE_HAEIN       ELAERFQPYGNIQAVSMDSIPLQT-----------YDLVINATSAGLSGGTASVDAE-IL
AROE_PASMU       DLAQKFAQYGQIQAVELDNIPVQS-----------FDLIINATSSGLHGQTVQMNPE-IL
AROE_HAEDU       ELAQQFAKYGDIQAVSLSEIVQHPP----------FDLIINATSLGLQGGYIALPNH-LF
AROE_NEIFL       ELARLFG----IEAVPMADLNGGF------------DIIINGTSGGLSGQLPAVSPE-IF
AROE_NEIPO       ELARLFG----IEAVPMADLNGGF------------DIIINGTSGGLSGQLPAVNPE-IF
AROE_NEICI       ELARLFG----IEAVPMADLNGGF------------DIIINGTSGSLSGQLPAVSPE-IF
AROE_NEIMA       ELAQLFG----IEAVPMADVNGGF------------DIIINGTSGGLNGQIPDIPPD-IF
AROE_NEIMB       ELAQLFG----IEAVPMADVNGGF------------DIIINGTSGGLNGQIPDIPPD-IF
AROE_NEIGO       ELARLFG----IEAVPMADVNGGF------------DIIINGTSGGLSGQLPAVSPK-IF
AROE_NEILA       EVAARFG----IEAVPMADLNGGF------------DIIINGTSGGLNGQIPDIPPD-IF
AROE_NEIMU       EMAAHFG----IEAIPLDELEGGF------------DIIINGTSGGLSGQLPAVSPK-VF
AROE_NEIPH       EMAVHFD----IDAVPLDELEGGF------------DIIINGTSGGLSGQLPAVSPK-IF
AROE_VIBVU       KLAVLFAAYGSVTAKEMNTVTEEY------------DVIINSTSASLSGELPALSSS-IF
AROE_VIBVY       ELAVLFAAYGSVTAKEMNTVTEEY------------DVIINSTSASLSGELPALSSS-IF
AROE_VIBPA       ELAELFSVYGPVTAKEMNIVAEEF------------DIIINSTSASLSGELPAISSS-VF
AROE_VIBCH       QLAELVAAYGEVKAQAFEQLKQSY------------DVIINSTSASLDGELPAIDPV-IF
AROE_PSEAE       DLAERFADLGAVHGCGFAEVEGPF------------DLIVNGTSASLAGDVPPLAQS-VI
AROE_XANAC       ALCDALGEPARVTSRYIEDLRELGD----------FELIVNATAAGRDRDAGAFALPLGL
AROE_XANCP       ALCDALGEPGRVVSRYLEDLRELGD----------FELIVNATAAGRDRDAGAFALPLGL
AROE_XYLFA       MLCDALGEPGRVSARYWGDLGDLGN----------FELIVNATSIGNTSDMRTFSLPRSL
AROE_XYLFT       MLCDALGEPGKVSARYWGDLGDLGN----------FELIINATSIGNTSDMRTFSLPRSL
AROE_AGRFC       ELADRFGPRVFSHPQAALQEVMHG-----------AGLFVNTTSLGMNGT---EAPHLDF
AROE_RHIME       ELADRFGTAVHAHSMAALPEVVSG-----------AGLFVNTTSLGMDGE---PAPAIDF
AROE_BRUME       ELAAHFGARVYAHGWDEAQALVSN-----------AGLIVNTTALGMSGHGEGQDFPIDL
AROE_BRUSU       ELAAHFGARVYAHGWDEAQALVSN-----------AGLIVNTTALGMSGHGEGQDFPIDL
AROE_RHILO       ELRDRFGAGVSAHGTAATDELLAD-----------AGLLVNTTALGMVGN-EG--LAADP
AROE_CAUVC       DLADTFGEKVVAKGEDALPALLPE-----------AGLIINATSLGLGGG---AGPSADL
AROE_CORGL       ALADVINNAVGREAVVGVDARGIED------VIAAADGVVNATPMGMPAH-----PGTAF
AROE_THEMA       ALDFPVKIFSLDQLDEVVKKA---------------KSLFNTTSVGMKGE------ELPV
                                                         .                   

AROE_NOSS1       ELVNLQTGTIAYDLIYIP-KPTQFLQKAQQQGAI-IIDGLEMLVQQGVAALKIWLQQDDI
AROE_SYNY3       LVEKLPPTAIAYDLIYTP-RPTRFLQHAQERGLV-TIDGAEMLVQQGAAALKIWLQQE-V
AROE_THEEB       DLAKLPATAIVYDLIYKP-RPTLLLQLAMARGLQ-TFDGLAMLLHQGAAALEYWLGQP-A
AROE_AQUAE       NYDLIKKDHVVVDIIY---KETKLLKKAKEKGAK-LFDGLPMLLWQGIEAFKIWNGCE-V
AROE_METAC       TAEELHSGLTVFDIVYNP-LETRLLKEAKVAGAK-TVSGVLMLVYQGAEAFKLWTGVE-A
AROE_METMA       TAEELHSGLTVFDIVYNP-LETRLLREARTSGAK-TISGVLMLVYQGAEAFRLWTGVE-P
AROE_HALSA       SADALHDDLAVLDAVYSP-VETRLLRDAAAAGAT-TIDGAWMLLYQGAEAFERWTGLD-A
AROE_ARCFU       PPSMLDGVELVFDTVYNP-METPLIREAKKRGCK-VVYGIEMLVHQGAKAFEIWTGIE-P
AROE_METKA       TADQMHEDLIVNDLVYNP-PRTRLLEEAEKAGAT-PVSGVGMLVYQGALAFELWTGEE-A
AROE_METTH       GAELMHEGLVVHDLVYNP-QRTVLLREAERASAI-PVSGIRMLLYQGVEAFRIWTGRD-P
AROE_METJA       KAEKLREDMVVMDLIYNP-LETVLLKEAKKVNAK-TINGLGMLIYQGAVAFKIWTGVE-P
AROE_PYRAB       PRRLLRRELIVMDIVYKP-LKTRLLRDAESVGCR-VIDGLWMLIYQGAESFKLWTGIY-P
AROE_PYRFU       PKNLLRPGLVVMDIVYKP-LNTLLLRYAQEKGCI-AIDGLWMLVYQGAESFRLWTGEE-G
AROE_THEKO       PAELLRRDLVVMDIVYKP-LKTRLLTEAELRGCK-TVDGLWMLVYQGIESFRLWTGFK-P
AROE_CHLTE       GHGLLHDGQIVYDMVYNP-PETPLLAEARAAGAT-VIAGIEMLIAQAARAFSIWTGQE-L
AROE_STRPN       ENIVLPETLLVADIIYQP-FETPFLKWARSQGNP-AVNGLGMLLYQAAEAFQLWTGKE-M
AROE_STRR6       ENIVLPETLLVADIIYQP-FETPFLKWARSQGNP-AVNGLGMLLYQAAEAFQLWTGKE-M
AROE_LACLA       KSLVLPEKLLVVDAIYKV-RETPFLRWAKGQGAQ-TENGLGMLIGQAAESFYLWTGKK-M
AROE_LISMF       SADMLRPELIVSDVVYKP-TKTRLLEIAEEQGCQ-TLNGLGMMLWQGAKAFEIWTHKE-M
AROE_LISMO       SADMLRPELIVSDVVYKP-TKTRLLEIAEEQGCQ-TLNGLGMMLWQGAKAFEIWTHKE-M
AROE_LISIN       SADMLRPELIVSDVVYKP-TKTRLLEIAEEQGCQ-TLNGLGMMLWQGAKAFEIWTHKE-M
AROE_STRP1       DPELIRPDLVVFDIVYSP-AETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQD-M
AROE_STRP3       DPELIRPDLVVFDIVYSP-AETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQD-M
AROE_STRP6       DPELIRPDLVVFDIVYSP-AETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQD-M
AROE_STRP8       DPELIRPDLVVFDIVYSP-AETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQD-M
AROE_BACHD       SLERLSRETVVSDLIYNP-LETKFLREAKQKGAK-TVDGLGMFVNQGALAFELWTGLR-P
AROE_BACSU       SLQRAASSAVVCDIVYNP-IQTALLKEASQKGLK-TLDGVGMFVEQAALSFQLWTGQE-P
AROE_CLOPE       SEKVIKKFKVAVDIVYNP-LETKFLKMAKDNGLK-TVDGLFMLVGQGVKAEEIWNGIK-V
AROE_CALS4       SEEVVAKANFVYDLIYNP-SETLFLKYARKNGVK-SANGLSMLVNQASYAFYLWTGEF-F
AROE_STAAM       NLKHLSPNTLMSDIVYIP-YKTPILEEAERKGNH-IYNGLDMFVYQGAESFKIWTNKD-A
AROE_STAAN       NLKHLSPNTLMSDIVYIP-YKTPILEEAERKGNH-IYNGLDMFVYQGAESFKIWTNKD-A
AROE_STAAC       NLKHLSPNTLMSDIVYIP-YKTPILEEAERKGNH-IYNGLDMFVYQGAESFKIWTNKD-A
AROE_STAAS       NLKHLSPNTLMSDIVYIP-YKTPILEEAERKGNH-IYNGLDMFVYQGAESFKIWTNKD-A
AROE_STAAW       NLKHLSPNTLMSDIVYIP-YKTPILEEAERKGNH-IYNGLDMFVYQGAESFKIWTNKD-A
AROE_STAAR       NLKHLSPNTLMSDIVYIP-YKTPILEEAERKGNH-IYNGLDMFVYQGAESFKIWTNKD-A
AROE_STAES       SLNRLASHTLVSDIVYNP-YKTPILIEAEQRGNP-IYNGLDMFVHQGAESFKIWTNLE-P
AROE_STAEQ       SLNRLASHTLVSDIVYNP-YKTPILIEAEQRGNP-IYNGLDMFVHQGAESFKIWTNLE-P
AROE_THEVO       PEVQFGKGKIAVDVVYNP-PVTPFLKRAGISGSK-TLSGLDLYIGQAIKTLDILTSGC-D
AROE_THEAC       STVDFRSGRTGIDLVYNP-PDTPFLKRMRNAGGR-TVSGLDVFIGQGLRTLELVFGIR-P
AROE_PYRAE       VIADLTGASLYVEFVYTPTPRTKMVEEAERLGVK-VVDGVDLLVEQGAQAEKIWLGVE-P
AROE_HELPH       LKGYFKEGKLAYDLAY--GFLTPFLSLAKELKTP-FQDGKDMLIYQASLSFEKFSASQ--
AROE_HELPY       LKGYFKEGKLAYDLAY--GFLTPFLSLAKELKTP-FQDGKDMLIYQAALSFEKFSASQ--
AROE_HELPJ       LKGYFKESKLAYDLAY--GFLTPFLSLAKELKIP-FQDGKDMLIYQASLSFEKFSDSQ--
AROE_HELAH       LKGYFKESRLAYDLAY--GFLTPFLSLAKELKLP-FQDGKGMLIYQASLSFEKFSSSQ--
AROE_HELHP       LKELCSCGKYAFDLIY--GKCTPFLALAQSFHLS-CSDGKEMLINQAALSFELFCKQKYN
AROE_LEPIC       PEDFFNSNMTLFDIVYN-PLETPLVKAAQKAGAK-IIPGSEMLLYQAMKQFELFTEISPN
AROE_LEPIN       PEDFFNSNMTLFDIVYN-PLETPLVKTAQKAGAK-IIPGSEMLLYQAMKQFELFTGISPN
ARODE_CHLMU      PQAL---APLIVDINTL-PKHNSFTQYARLKGCS-IIYGHEMFAQQALLQFRLWFPTHSF
ARODE_CHLTR      PKAV---APCVVDINTI-PKHSTFTQYARSQGSS-IIYGHEMFTQQALLQFRLWFPTLSF
ARODE_CHLPN      PWRF---PPIVMDINTK-PHPSPYLERAQKHGSL-IIHGYEMFIEQALLQFALWFPDFLT
AROE_BUCAI       VSSKTCFYDMNYQTDN-----TFFFDWSRKTGSNFFSNGIGMLVFQAAHSFFLWHNVLPE
AROE_BUCAP       ITSKTFFYDMNYSTRN-----TPFINWCSKAGGSFISNGIGMLVFQAAYSFLEWHNVLPE
AROE_BUCBP       IHKDVYCYDINYSIKHKY---TEFLLWCIKNGAICVSNGIGMLVSQAAHSFYLWYGILPE
AROE_BUCCC       IFPNTKCYDISYSKNKKL---TPFLSTCRDLGSRKYSDGLGMLVAQAAYSCYIWFNILPN
AROE_ECOLI       HPG-IYCYDMFYQKGK-----TPFLAWCEQRGSKRNADGLGMLVAQAAHAFLLWHGVLPD
AROE_ECO57       HPG-IYCYDMFYQKGK-----TPFLAWCEQRGSKPTADGLGMLVAQAAHAFLLWHGVLPD
AROE_ECOL6       HPG-IYCYDMFYQKGK-----TPFLAWCEQRGSKRTADGLGMLVAQAAHAFLLWHGVLPD
AROE_SALTI       HPS-LCCYDMFYQKGN-----TPFLSWCVQQGAKRYADGLGMLVGQAAHAVLLWHGVLPQ
AROE_SALTY       HPS-LCCYDMFYQKGN-----TPFLSWCVQQGAKRYADGLGMLVGQAAHAVLLWHGVLPQ
AROE_YERPE       TSQ-TRCYDMFYQAGT-----TPFLAWAQRLGLADYADGLGMLVGQAAHAFKLWHGVMPE
AROE_HAEIN       KLG-SAFYDMQYAKGTD----TPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPD
AROE_PASMU       QNA-TALYDMQYAKQAD----TPFVALCKQLGKQNVSDGFGMLVAQAAHAFHLWRGVMPE
AROE_HAEDU       EK--SAVYDMEYASNMC----TPFLNYVRTQGVTRYQDGLGMLVNQAAFSFQLWEGELPK
AROE_NEIFL       R-DCRLAYDMVYGEAA-----LAFLNFAQSNGAAEVSDGLGMLVGQAAASYHIWRGFTPD
AROE_NEIPO       R-SCRLAYDMVYGDAA-----QTFLNFAQSNGAAEVSDGLGMLVGQAAASYHIWRGFTPD
AROE_NEICI       R-NCRLAYDMVYGDAA-----QAFLNFAQSNGAAEVSDGLGMLVGQAAASYSLWRGFTPD
AROE_NEIMA       Q-NCALAYDMVYGCAA-----KPFLDFARQSGAKKTADGLGMLVGQAAASYALWRGFTPD
AROE_NEIMB       Q-NCALAYDMVYGCAA-----KPFLDFARQSGAKKTADGLGMLVGQAAASYALWRGFTPD
AROE_NEIGO       R-DCRLAYDMVYREAA-----KPFLDFARQSGAKKTADGLGMLVGQAAASYALWRGFKPD
AROE_NEILA       Q-NCALAYDMVYGEAA-----KPFLDFARQSGAKQTADGLGMLVGQAAASYALWRGFKPD
AROE_NEIMU       E-HCTLAYDMVYGEAA-----EPFLAFARQSGAKQTADGLGMLVGQAAASYRLWRGFAPD
AROE_NEIPH       E-HCTLAYDMVYGEAA-----EPFLAFARQSGAKQTADGLGMLVGQAAASYRLWRGFAPD
AROE_VIBVU       A-ANSTSYDMMYGKGD-----TTFNQWAKQHGAAHAYDGLGMLVGQAAESFMLWRGLRPG
AROE_VIBVY       A-ANSTSYDMMYGKGD-----TTFNQWAKQHGAAHAYDGLGMLVGQAAESFMLWRGLRPG
AROE_VIBPA       A-ANSTSYDMMYGKGD-----TTFNQWAKQHGAAHAYDGLGMLVGQAAESFMLWRGLRPG
AROE_VIBCH       S-SRSVCYDMMYGKGY-----TVFNQWARQHGCAQAIDGLGMLVGQAAESFMLWRGLRPG
AROE_PSEAE       EPGRTVCYDMMYAKEP-----TAFNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPA
AROE_XANAC       VNSLTAAVDLNYGDTA-----IAFLAWARAAQCRYAIDGLGMLVEQAAESFALWHGVRPD
AROE_XANCP       VNSLTAAVDLNYGATA-----IAFLAWARSAQCRYAIDGLGMLVEQAAESFALWHGVRPQ
AROE_XYLFA       LDSMTAAVDLNYGSAA-----VPFLAWAHAVETRYVIDGLGMLVEQAAESFSLWHGRRPD
AROE_XYLFT       LDSMTAAVDLNYGSAA-----VPFLAWAHAVETRYAIDGLGMLVEQAAESFSLWHGRRPD
AROE_AGRFC       SHLAANAVVTDIVYVPLK---TPILNMAQEQG-IATVDGLGMLLHQAKPGFRRWFGRIPE
AROE_RHIME       SGLAPDAVVTDIVYVPLK---TPLLRQAEEQG-FRIVDGLGMLLHQAVPGFEKWFGLRPV
AROE_BRUME       TCAPKEAVATDIVYVPLR---TAFLNKAEKAG-LKTVDGLGMLLHQAVPGFERWFGQRPQ
AROE_BRUSU       TCAPKEAVATNIVYVPLR---TAFLNKAEKAG-LKTVDGLGMLLHQAVPGFERWFGQRPQ
AROE_RHILO       ALLPDHAIVTDLVYVPLE---TPLLAAARARG-LKTVDGLGMLLNQAVPGFEHWFGVRPQ
AROE_CAUVC       TLTPKTAVVMDMVYKPLR---TEFLRRAEAAG-RRTVDGLEMLLRQAIPTFETIYGQAPS
AROE_CORGL       DVSCLTKDHWVGDVVYMP-IETELLKAARALGCE-TLDGTRMAIHQAVDAFRLFTGLEPD
AROE_THEMA       SDDSLKNLSLVYDVIYFD---TPLVVKARKLGVKHIIKGNLMFYYQAMENLKIWGIYDEE
                                                       *  :   *.             

AROE_NOSS1       PVDVMRQALIKHLGLK------
AROE_SYNY3       PVDVMRQALLHHLEKSA-----
AROE_THEEB       PTAIMATALETALGTEK-----
AROE_AQUAE       PYSVAERSVRDLRG--------
AROE_METAC       PAELMKKTVLEALQA-------
AROE_METMA       PLELMKKTVLEALQA-------
AROE_HALSA       PVAAMR-AALRARL--------
AROE_ARCFU       DVGVMREAALRALRF-------
AROE_METKA       PVEVMREAVLEHLR--------
AROE_METTH       PLDVMEDALKRVLNRD------
AROE_METJA       NIEVMKNAIIDKITK-------
AROE_PYRAB       DVELMRRVSLERLGKG------
AROE_PYRFU       DVELMRRVALAWLRERK-----
AROE_THEKO       DEGLMRGAALEGISE-------
AROE_CHLTE       PVDLVRKTVLAAIEKSEG----
AROE_STRPN       PTEEIWQSLTEKYQ--------
AROE_STRR6       PTEEIWQSLTEKYQ--------
AROE_LACLA       PVAEITLEMEKEA---------
AROE_LISMF       PVDYIKEILF------------
AROE_LISMO       PVDYIKEILF------------
AROE_LISIN       PVDYIKEILF------------
AROE_STRP1       PVDAIKPLLGDE----------
AROE_STRP3       PVDAIKPLLGDE----------
AROE_STRP6       PVDAIKPLLGDK----------
AROE_STRP8       PVDAIKPLLGDK----------
AROE_BACHD       DREKMRRCVLEQLGG-------
AROE_BACSU       NIEKMRSIVIGKLGGTEC----
AROE_CLOPE       DKS-TEEEIYEELKCRF-----
AROE_CALS4       DK----DFVYEKIRGEM-----
AROE_STAAM       DINSMKTAVLQQLKGE------
AROE_STAAN       DINSMKTAVLQQLKGE------
AROE_STAAC       DINSMKTAVLQQLKGE------
AROE_STAAS       DINSMKTAVLQQLKGE------
AROE_STAAW       DINSMKTAVLQQLKGE------
AROE_STAAR       DINSMKTAVLQQLKGE------
AROE_STAES       DIKAMKNIVIQKLKGEL-----
AROE_STAEQ       DIKAMKNIVIQKLKGEL-----
AROE_THEVO       IDTLINSVRVAVNEVR------
AROE_THEAC       DSIFREYAVEALNEIRKG----
AROE_PYRAE       DRAVMKKAVLEFLGL-------
AROE_HELPH       ----IPYSKAFEVMRSVF----
AROE_HELPY       ----IPYSKAFEVMRSVF----
AROE_HELPJ       ----IPYSKAFEVMRSVF----
AROE_HELAH       ----ISYSKAFEIMRSVF----
AROE_HELHP       KGN-LEIQRIASFMNEIL----
AROE_LEPIC       AEDIIKTRERLSKALENR----
AROE_LEPIN       AEDIIKTRERLSKALENR----
ARODE_CHLMU      NHLEKNFSRRAAVLASLFSIAA
ARODE_CHLTR      KHLEKTFIRRAAVLASLFSIAP
ARODE_CHLPN      PESCDSFRNYVKNFMAKV----
AROE_BUCAI       IDYIIDLLNK------------
AROE_BUCAP       INYIINILNIK-----------
AROE_BUCBP       TNSIICKLNRQFYML-------
AROE_BUCCC       IKKNINLLKSII----------
AROE_ECOLI       VEPVIKQLQEELSA--------
AROE_ECO57       VEPVIKQLQEELSA--------
AROE_ECOL6       VEPVIKLLQQELSA--------
AROE_SALTI       VEPVIKLLQQELLA--------
AROE_SALTY       VEPVIEQLQQELLA--------
AROE_YERPE       ITPVLAQLRSELGK--------
AROE_HAEIN       FVSVYEQLKKAML---------
AROE_PASMU       FEALLEQEWL------------
AROE_HAEDU       VENVLKQLRAEMGYVK------
AROE_NEIFL       IRPVIEYMKAL-----------
AROE_NEIPO       IRPVIEYMKAL-----------
AROE_NEICI       IRPVIEYMKAL-----------
AROE_NEIMA       IRPVIEYMKAL-----------
AROE_NEIMB       IRPVIEYMKAL-----------
AROE_NEIGO       IRPVIEHMKAL-----------
AROE_NEILA       IRPVIEYMKAL-----------
AROE_NEIMU       VLPVVQYMREL-----------
AROE_NEIPH       VLPVVQYMREL-----------
AROE_VIBVU       SKQILRELRKNLEGL-------
AROE_VIBVY       SKQILRELRKNLEGL-------
AROE_VIBPA       AKQILRELRKNLEGQ-------
AROE_VIBCH       TKQILRELRKNLEGAL------
AROE_PSEAE       SAPVLETLRRQLATV-------
AROE_XANAC       TDPVYAALRAREAVLISAD---
AROE_XANCP       TDPVYDALRARDAVLVSAD---
AROE_XYLFA       TDPVYTVLHSEYGAPGRS----
AROE_XYLFT       TDPVYTVLHSEYGVPGRS----
AROE_AGRFC       VDETLRSLIIADMEKH------
AROE_RHIME       VDETLRQIIISDMDRHA-----
AROE_BRUME       VTQALREHILADMAKAGAL---
AROE_BRUSU       VTQALREHILADMAKAGAL---
AROE_RHILO       VTAELRALIVADLVPKP-----
AROE_CAUVC       PKIDVRVLALKLLGEV------
AROE_CORGL       VSRMRETFLSL-----------
AROE_THEMA       VFKEVFGEVLK-----------