CLUSTAL format seed alignment for MF_00223

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GCH1_HELPY       ---------------------------------------------------MENFFNQFF
GCH1_HELPJ       ---------------------------------------------------MEKFFNQFF
GCH1_FUSNN       ------------------------------------------MEEKMDSKRIENAFFEVI
GCH1_SYNE7       ------------------------MTSPSLNGSNSLVDAIRPETEAVSQAEMEAAVRTLL
GCH1_SYNY3       MTIASSHSIN--NGMNTGKLVNQLSSLPDRNTHNGQEVKYHPENVELNKEKMMDAVRVML
GCH11_NOSS1      MTIASSNGSNRAQSPLITDLAEAINTRPDRNTHNGREPELHQPSEED-MESMMGAVRSIL
GCH12_NOSS1      --------------------MTLSIRPDTVSAAQMVSSLSTQQTPTVTEAEMVQAVRTLL
GCH11_PSEAE      -----------------------------------------------MNPALSQHYREIL
GCH12_PSEAE      -------------------------------------------------MSLEQHYSSIL
GCH1_CHLTE       --------MKQEKTVSPTVENNRSAESRLSQCDLDECFDESHDRDEEVLGSMTDAVYSLL
GCH1_CAMJE       -----------------------------------------------MQKKFEDCVKTML
GCH1_DEIRA       --------------------MPQARGEGATPPTSLPNPSLKGVPLPDNPNNLEPLTREWL
GCH1_STRP3       --------------------------------------MKRERLMSINKEKAEAAIYQFL
GCH1_STRP1       --------------------------------------MKRERLMSINKEKAEAAIYQFL
GCH1_BACHD       -------------------------------------------MSKVDHEKIQQAVVMIL
GCH1_BACSU       -------------------------------------------MKEVNKEQIEQAVRQIL
GCH1_LISIN       -------------------------------------------MEQIDKQKIADAVKVIL
GCH1_LISMO       -------------------------------------------MEQIDKQKIADAVKVIL
GCH1_CLOPE       ---------------------------------------------MIDKEKIKEGMKLIL
GCH1_STRPN       ----------------------------------------------MDTQKIEAAVKMII
GCH1_CALS4       ---------------------------------------------MIDKEKIKKAVREIL
GCH1_MYCLE       ----------------------------MALLDLGLESTAVPRIRVFDQQRAEAAIRELL
GCH1_MYCTU       ----------------------------MSQLD---SRSASARIRVFDQQRAEAAVRELL
GCH1_CORGL       -------------------------------------MDNHAAVREFDEERATAAIRELL
GCH1_STRCO       -------------------------------MTDPVTLDGEGQIGEFDEKRAENAVRELL
GCH1_AQUAE       --------------------------------------------MAIDKEKIKQAVRLFL
GCH1_ECOLI       ------------MPSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIM
GCH1_SALTY       ------------MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIM
GCH1_YERPE       ------------MSSLSKEAELVHQALLARGLETPLRKP--ELDAETRKTRIQAHMTEVM
GCH1_VIBCH       ------------MSGLSESAKLVKDALERRGLETPMQPNL--ATPAEKKEKIEQHMREIL
GCH1_HAEIN       ------------MSKISLDALNVRNALIEKGIETPMIDP--TQAKNERRESIAKHMHEVM
GCH1_PASMU       ------------MNKISPEAEKVRNALLSKGIETPMITP--EQDRDTRRAGIEQHMREVM
GCH1_BUCAP       ------------MIKITKEANIARNVLLLKGLENPILKEYNDIKEKERELLIAEYLYKIM
GCH1_CLOAB       --------------------------------------------MSIDTKAIEKHIRGIL
GCH1_SACS2       -------------------------------------MQKTELDDQKLVEEIARRIREIL
GCH1_SULTO       --------------------------------------MEETLNQEKMVEEIAKRIREIL
GCH1_PYRAE       -----------------------------------------MITDRKAKAKPERGVEELL
GCH1_AGRFC       -------------------------MDAIVKNFPGAGAKPDVAEARPSQAEAEEAVRVLL
GCH1_RHIME       -------------------------MDAIVKNFPVLDDT-----GRPTQKEAEEAVRVLL
GCH1_BRUME       -------------------MDARILQDNDDTSLPVNQASVTRIHKKPGKAEAEAAVRTLL
GCH1_RHILO       --------------------------------------MEKPVTDRPSEAEVEAAVRTLL
GCH1_CAUVC       --------------------MDALTRERTLIGSDDTTGLDLEPVQRPSKDEAMAAVRTLL
GCH1_XANAC       ------------------------------------MSQSNQPDSPVTQTQAEEAVRTLL
GCH1_XANCP       ------------------------------------MSQSDQPDSSVTQAQAEEAVRTLL
GCH1_XYLFA       ------------------------------------MDHSKQQNASITQAQAEEAVRTLL
GCH1_RICCN       -------------------------------------------MSKPTREEAKEAVRTLL
GCH1_RICPR       -------------------------------------------MSKPTREEAKEAVRTLL
GCH1_RALSO       ----------------------MLCSHDDDDPIRTAASHGIRRVRAFDAQRFELAVQSLL
                                                                            :

GCH1_HELPY       ESIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGV--CDE-------MI
GCH1_HELPJ       ENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGV--CDE-------MI
GCH1_FUSNN       EALGDVEYKEELKDTPKRIADSYKEIFYGIDIDP-KEVLTKTFEVN--SNE-------LI
GCH1_SYNE7       LGVGEDPEREGLLKTPKRVAEAYRFLTSGYSQSL-DDLVNGAIFDE-GHNE-------MV
GCH1_SYNY3       ESVGEDPEREGLLKTPKRVAEAMQFLTQGYDQSL-EKLVNGAIFDE-GHNE-------MV
GCH11_NOSS1      VGVGEDPEREGLLKTPKRVAEAMRFLTSGYNQSL-EELLNGAVFDE-GHNE-------MV
GCH12_NOSS1      IGLGENPDREGLLDTPKRVVKALQFLTKGYNESL-DELLNGAVFTE-DANE-------MV
GCH11_PSEAE      VGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTL-EEIVNGALFAS-DNDE-------MV
GCH12_PSEAE      TQLGEDVNREGLLDTPKRAAKAMKYLCRGYQQSL-EEVVNGALFSS-DNSE-------MV
GCH1_CHLTE       KGVGEDPEREGLLLTPERVAKSLRFLTKGYRQDP-EQLLKKAVFTE-SYDE-------MV
GCH1_CAMJE       EIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNV-KEILNDALFES-SNNE-------MV
GCH1_DEIRA       AAIGEDPDREGLQRTPQRVAKAWAYMTEGYGQTL-AQVVGEGVFAA-EGSE-------MV
GCH1_STRP3       EAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDP-KEEFTAVFK-E-HHED-------VV
GCH1_STRP1       EAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDP-KEEFTAVFK-E-QHED-------VV
GCH1_BACHD       EAIGEDPAREGLEDTPKRVAKMYEEVFAGLNQDP-KEHFATIFG-E-DHEE-------LV
GCH1_BACSU       EAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDP-KEHFQTIFG-E-NHEE-------LV
GCH1_LISIN       EAVGENPEREGLIDTPMRVARMYEEVFAGLKKDP-SVHFDTIFE-E-QHEE-------LV
GCH1_LISMO       EAVGENPDREGLIDTPMRVARMYEEVFAGLKKDP-SVHFDTIFE-E-QHEE-------LV
GCH1_CLOPE       EAIGEDVNREGLIETPDRIARMYEEIFSGIGMNA-KEHLSKTFE-V-HSND-------LV
GCH1_STRPN       EAVGEDANREGLQETPARVARMYQEIFSGLGQTA-EEHLSKSFE-I-IDDN-------MV
GCH1_CALS4       EAIGEDPDREGLLETPDRVARMYEEIFSGLHTDV-KDVIKIFQE-D-EHQE-------II
GCH1_MYCLE       YAIGEDPDREGLADTPARVARACRELFSGLYTDP-QTVLNTMFD-E-EHNE-------LV
GCH1_MYCTU       YAIGEDPDRDGLVATPSRVARSYREMFAGLYTDP-DSVLNTMFD-E-DHDE-------LV
GCH1_CORGL       IAVGEDPDREGLLETPARVARAYKETFAGLHEDP-TTVLEKTFS-E-GHEE-------LV
GCH1_STRCO       IAVGEDPDREGLRETPARVARAYREIFAGLWQEP-EDVLTTTFD-L-GHDE-------MV
GCH1_AQUAE       EGIGEDPDREGLKETPERVARMWEEFERMRNFDM-KLFEEFG-----GYNE-------MV
GCH1_ECOLI       QLLNLDLADDSLMETPHRIAKMYVDEIFSGLDYA-NFPKITLIENKMKVDE-------MV
GCH1_SALTY       QLLNLDLSDDSLMETPHRIAKMYVDEIFAGLDYA-NFPKITLIENKMKVDE-------MV
GCH1_YERPE       HLLNLDLTDDSLADTPRRIAKMYVDEIFSGLDYE-NFPKITLIQNKMKVDE-------MV
GCH1_VIBCH       NLLGLDLTDDSLEETPQRIAKMYVDEIFSGLDYA-NFPKITVIENKMKVSE-------MV
GCH1_HAEIN       KLIGLDLRDDSLEETPNRLAKMFIDEIFSGMDYA-NFPKMTKIKNQMKVSE-------MV
GCH1_PASMU       KLIGLDLRDDSLEETPVRLAKMFVDEIFSGLDYA-NFPKITNIENRMKVSE-------MV
GCH1_BUCAP       SLLNLDLKNESLKDTPIRISKMYVNEIFSGLDYK-NFPKIMLMDNKIKFHE-------MI
GCH1_CLOAB       IALGDDPDREGLKETPKRVAKMY-EEVFKGMEYS-NDDIAEMFNKTFEEDLKESEEDNIV
GCH1_SACS2       ELLGENPEREGLKETPERVAKALLEMTSGLRTPP-PQIKVFNLGDDGEVYE---K-NQIV
GCH1_SULTO       EILGENPDREGLRETPLRVARALLEMTSGLRTPQ-PQIKTFNLSEDGISEV---E-DQII
GCH1_PYRAE       EYLGEDLTKPGVLNTPKRFVKAMEELTRGLREPP-PEVVFFPLEYD----V---E-LGPV
GCH1_AGRFC       RWAGENPAREGLLDTPKRVAKAYRELFAGYELNV-QDVLGTTFEEVGGYDD-------VV
GCH1_RHIME       RWAGEDPAREGLKDTPSRVAKAYREIFGGYDLVA-EDVLGRTFEEVSGYDD-------IV
GCH1_BRUME       LWAGEDPDREGLLETPKRVAKAYQELFGGYSESP-EEVLGTTFEEVAGYDD-------MV
GCH1_RHILO       RWTGDNPDREGLIDTPKRVAKAFREMFGGYDMCP-AEELGRTFEEVAGYDD-------LV
GCH1_CAUVC       AWAGDNPEREGLIDTPKRVVEAFDEWFAGYHGDP-AKELSRTFEDVQGYDD-------MV
GCH1_XANAC       RWAGEDPTREGLLDTPRRVAEAYGDWFSGYRDEP-REYLERTFEEVAGYDE-------LI
GCH1_XANCP       RWAGEDPAREGLLDTPRRVAEAYGDWFSGYREEP-RAYLERTFEEVAGYDE-------LI
GCH1_XYLFA       RWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDP-HDYLQRTFEEISGYDE-------LI
GCH1_RICCN       KFIGEDPSREGLLQTPDRVINSYVEIFSGYGKDV-AEILNTKFYETCNFRD-------FI
GCH1_RICPR       KFIGEDPNREGLLKTPDRVINSYTEIFSGYGKDA-QEILNTKFYDICNFQD-------LI
GCH1_RALSO       EASGIEIDTAHTGKTAQRVRELWQRRLLDGYDIDPAEALGHGFEDPRRD---------MV
                    .          *. *                                         :

GCH1_HELPY       VAQNIEFYSTCEHHLLPF-LGNISVGYIP--KEKIVGISAIAKLIEIYSRRLQIQERLTI
GCH1_HELPJ       VAQNIEFYSTCEHHLLPF-FGNISVGYIP--KEKIVGISAIAKLIEIYSKRLQIQERLTT
GCH1_FUSNN       MEKNMDFYSMCEHHFLPF-FGTVCIAYVP--NKKIFGFGDILKLIEILSRRPQLQERLTE
GCH1_SYNE7       LVRDITAFSLCEHHMLPF-MGKVHVAYIP--NQKVVGLSKLARIVEMYSRRLQVQERLTR
GCH1_SYNY3       LVRDIDFFSLCEHHMLPF-MGKAHLAYIP--NQKVVGLSKLARIVEMFSRRLQVQERLTR
GCH11_NOSS1      LVRDINFFSLCEHHMLPF-MGRAHVAYIP--NQKVVGLSKLARIVEMYSRRLQVQERLTR
GCH12_NOSS1      LIRDIDIFSSCEHHILPI-IGRAHVAYIP--NGKVIGLSKIARVCEMYARRLQVQERLTL
GCH11_PSEAE      IVRDIELYSLCEHHLLPF-IGKAHVAYIP--TGKVLGLSKVARIVDMFARRLQIQENLTR
GCH12_PSEAE      LVKDIELYSLCEHHLLPF-IGKAHVAYIP--NGKVLGLSKVARIVDMYARRLQIQENMSR
GCH1_CHLTE       LVKDIDIYSMCEHHMLPF-FGKAHVAYIP--DGKIVGLSKIPRVVEVFARRLQVQERLTQ
GCH1_CAMJE       LVRDIEFYSLCEHHLLPF-FGRAHVAYIP--NKKVVGLSKIPRLVEVFARRLQIQEQLTE
GCH1_DEIRA       IVKDIEFYSMCEHHMLPF-YGRAHVAYIP--GTRILGLSKFARIVDLYSRRLQVQERITT
GCH1_STRP3       IVKDISFYSVCEHHLVPF-YGKAHIAYLPS-DGRVTGLSKLARAVEVASKRPQLQERLTS
GCH1_STRP1       IVKDISFYSICEHHLVPF-YGKAHIAYLPS-DGRVTGLSKLARAVEVASKRPQLQERLTS
GCH1_BACHD       LVKDIPFFSMCEHHLVPF-FGKAHVGYIPK-GGKVTGLSKLARAVEAVARRPQLQERITS
GCH1_BACSU       LVKDIAFHSMCEHHLVPF-YGKAHVAYIPR-GGKVTGLSKLARAVEAVAKRPQLQERITS
GCH1_LISIN       LVKDIRFSSMCEHHLVPF-FGVAHVAYLPQ-NGRVAGLSKLARVVDDVSRRPQLQERITT
GCH1_LISMO       LVKDIRFSSMCEHHLVPF-FGVAHVAYLPQ-NGRVAGLSKLARVVDDVSRRPQLQERITT
GCH1_CLOPE       LEKDITFYSMCEHHLVPF-YGKVHIAYIP--NGRVVGLSKLARCVEVYSKKPQLQERLTK
GCH1_STRPN       VEKDIFFHTMCEHHFLPF-YGRAHIAYIP--DGRVAGLSKLARTVEVYSKKPQIQERLNI
GCH1_CALS4       LVKDIPLYSMCEHHLLPF-IGVAHVAYLPR-KGRILGLSKVARIVDVLSKRPQLQERLTS
GCH1_MYCLE       IVKEIPMYSTCEHHLVSF-HGVAHIGYLPGADGRVTGLSKIARLVDLYAKRPQVQERLTS
GCH1_MYCTU       LVKEIPMYSTCEHHLVAF-HGVAHVGYIPGDDGRVTGLSKIARLVDLYAKRPQVQERLTS
GCH1_CORGL       LVREIPIYSMCEHHLVPF-FGVAHIGYIPGKSGKVTGLSKLARLADMFAKRPQVQERLTS
GCH1_STRCO       LVKDIEVFSTCEHHLVPF-RGVAHVGYIPSTSGKITGLSKLARLVDVYARRPQVQERLTT
GCH1_AQUAE       LVKDIKFYSLCEHHLLPF-FGKVHIAYIP--DKKISGLSKLVRTVRAFALRPQVQERLTE
GCH1_ECOLI       TVRDITLTSTCEHHFVTI-DGKATVAYIPKDS--VIGLSKINRIVQFFAQRPQVQERLTQ
GCH1_SALTY       TVRDITLTSTCEHHFVTI-DGKATVAYIPKDS--VIGLSKINRIVQFFAQRPQVQERLTQ
GCH1_YERPE       TVRDITLTSTCEHHFVTI-DGKATVAYIPKDS--VIGLSKINRIVQFFAQRPQVQERLTQ
GCH1_VIBCH       KVKDITLTSTCEHHLVTI-DGTAAVAYIPRGK--IIGLSKINRIVRFFAQRPQVQERMTQ
GCH1_HAEIN       QVNDITLTSTCEHHFVTI-DGKVCVAYYPKDW--VIGLSKINRIVSFFAQRPQVQERLTE
GCH1_PASMU       LVNDVTLTSTCEHHFVTI-DGMVSVAYYPKKW--VIGLSKINRIVAFFAQRPQVQERLTE
GCH1_BUCAP       IVRDILLISTCEHHFITI-NGQATIAYIPENK--IIGLSKINRIAQFFAKRPQIQERLTK
GCH1_CLOAB       LVKDIEIFSHCEHHLTLMYNMTVAVAYIPNKR--LIGLSKIARIADMVSRRLQLQERIGK
GCH1_SACS2       LIKDVNFSSLCEHHMLPI-IGKIHVAYIVSNSGKVAGFSKIIRIVNYYSSRLQIQERLVE
GCH1_SULTO       LVKNIGFSSLCEHHLLPI-IGKVHVAYIVGQERKVAGFSKIIRIVNYYASRPQIQERLVQ
GCH1_PYRAE       VIENIGAVSLCEHHLLPI-LLRISVAYVPGDG--VPGLSKVIRLVKWAAARPIMQERFTE
GCH1_AGRFC       LVRDIPFFSHCEHHMVPI-VGKAHVAYLP--AGRVLGLSKIARVVEIFGRRLQTQENMTA
GCH1_RHIME       LEKDIPFYSHCEHHMVPI-IGKAHIAYLP--NGRVLGLSKIARVVDIYARRLQTQEAMTA
GCH1_BRUME       LVKDISFFSHCEHHMVPI-IGKAHVAYLP--EGRVVGLSKIARVVDIFARRLQTQESITA
GCH1_RHILO       IVKDIHFHSHCEHHMVPI-IGKAHVGYLP--DGKVVGLSKIARVVDIFAHRLQTQEALTA
GCH1_CAUVC       MLRGIDVQSHCEHHMAPF-LGKAWIAYMP--TGKVVGLSKLARLVEIFAKRLQTQETMTM
GCH1_XANAC       VLRDISYESHCEHHMAPI-IGKVHVGYLP--RGKVVGISKLARVVESYARRFQVQEKMTA
GCH1_XANCP       VLRDISYESHCEHHMAPI-IGKVHVGYLP--RGKVVGISKLARVVESYARRFQVQEKMTA
GCH1_XYLFA       VLRNITYESHCEHHMAPI-IGKVHIGYLP--NGKVVGISKLARVVESYARRFQIQEKMTA
GCH1_RICCN       LLN-IKFTSFCEHHILPF-NGTVDIAYVP--DNCIVGISKLARIVNIFARRLQIQEKMTV
GCH1_RICPR       SLEGIKFTSFCEHHILPF-NGTVHIAYIP--DNCIIGVSKLARIVNIFARRLQIQEKMTL
GCH1_RALSO       IIRSIAVHGVCPHHLLPF-RGVAHVAYLP--DGRLHGFGRIARMIDAISHRYTYQEWVTN
                   . :     * **:  :      :.*       : *.. . :     . :   ** .  

GCH1_HELPY       QIAETFDE-IIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDSKTRAEFMQ
GCH1_HELPJ       QIAETFDE-IIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQ
GCH1_FUSNN       EIAKYIYE-ILNCQGVYVVVEAKHLCVTMRGQKKENTKILTTSAKGVFETDSNKKLEVLT
GCH1_SYNE7       QIAESVQE-ILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFQEDQRTREEFLS
GCH1_SYNY3       QIAEAVQE-ILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMIGSFQNEQKTREEFLN
GCH11_NOSS1      QIAEAVQT-ILEPQGVAVVMEASHMCMVMRGVQKPGSWTVTSAMLGVFQEEQKTREEFFN
GCH12_NOSS1      QIADALQG-LLKPQGVAVVIEATHMCMVMRGVQKPGSWTVTSAMRGVFAEDARTREEFMN
GCH11_PSEAE      QIAEAVRQ-VTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRDSNTTRQEFLQ
GCH12_PSEAE      QIAEAVQQ-VTGALGVAVVIQAQHMCMMMRGVEKQNSSMVTSVMLGEFRDNAATRSEFLS
GCH1_CHLTE       QIRDAIQN-VLNPRGVAVVIEATHMCMVMRGVEKQNAVTTTSAMSGDFMTSQSTRSEFLR
GCH1_CAMJE       QIAQALME-NVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFS
GCH1_DEIRA       QVADAVEE-LLAPKGVAVLMEGIHLCMAMRGVQKQNSSTTTSAMRGLFRSDPRTRAEFMS
GCH1_STRP3       QIADALVE-ALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVIS
GCH1_STRP1       QIADALVE-ALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQEVIS
GCH1_BACHD       TVADALVE-TLEPHGVIVVVEAEHMCMTMRGVKKPGAATVTSAVRGTFANDAAARAEVLS
GCH1_BACSU       TIAESIVE-TLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARAEVLE
GCH1_LISIN       TVAEIMMD-KLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLA
GCH1_LISMO       TVAEIMME-KLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLA
GCH1_CLOPE       EIADSIME-YLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVFR
GCH1_STRPN       EVADALMD-YLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYR
GCH1_CALS4       EIADTIME-AVNPLGVAVVIEAEHLCMTMRGVKKPGSKTVTSALRGIFRTDQKARAEVMA
GCH1_MYCLE       QIADALVS-KLDPRGVIIVVEAEHLCMAMRGVRKPGAITTTSAVRGQFKTDAASRAEALG
GCH1_MYCTU       QIADALMK-KLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALD
GCH1_CORGL       QIADALVE-KLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGFKNNAASRAEVFS
GCH1_STRCO       QIADSLME-ILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQLR-DVATRNEAMS
GCH1_AQUAE       EIADFLEK-ELEPKGVGVVIEAEHLCMSMRGVMSPGHLTVTSALRGVFLKDIKTREEFLK
GCH1_ECOLI       QILIALQT-LLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLR
GCH1_SALTY       QILTALQT-LLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLR
GCH1_YERPE       QILLALQT-LLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLR
GCH1_VIBCH       QILVALQT-LLESDDVAVTIDATHYCVKSRGVMDATSVTTTTALGGIFKSNPATRAEFLH
GCH1_HAEIN       QLLTAFQT-ILETDDVAVYVKATHFCVKARGIRDTNSYTVTSAYGGVFLEDRDTRKEFLA
GCH1_PASMU       QILLAFQT-ILETDDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLT
GCH1_BUCAP       QILLVLQV-LLQTKNVAIIIHMDHFCVKARGVCDTSSSTVTSCLDGLFKSDKNIREEFFF
GCH1_CLOAB       DIAEIMEK-VTASKDIAVIIKGEHGCMTSRGIKKPGALTTTMTLKGRFKNDDSLVTKLMA
GCH1_SACS2       QIADAIMNSEIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFR
GCH1_SULTO       QIADAIMNSDIHPKGVMVIGDALHMCAYVRGVKDREASLLSVATRGLFKNNVSLRNYVFR
GCH1_PYRAE       WLADLLME-KLRAKGVQVKVCGVHMCSFIRGVKDEHHNMITEARRGEIDVKLSCKRPLGC
GCH1_AGRFC       QIARSIEE-TLKPRGVAVMIDAEHMCMSMRGVNKQGSTTLTTSFTGTFKNDPAEQVRFMT
GCH1_RHIME       QIAKAIDE-TLMPRGVAVMIEAEHLCMAMRGIKKQGATTLTTTFTGAFKSEPAEQVRFMT
GCH1_BRUME       QIADSIQR-ILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMT
GCH1_RHILO       QIAGVIQD-VLNPRGVAVMIEAEHMCMAMRGIRKQGSTTLTSTFTGVFKDTPEEQVRFVT
GCH1_CAUVC       QIADAIED-HLSAAGVAVLIDAEHQCMSTRGVHHHDVSTITTQFRGVFKTDKVLQQRFMD
GCH1_XANAC       QIAQCIQD-VLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAEFLQ
GCH1_XANCP       QIAQCIQD-VLQPRGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAEFLQ
GCH1_XYLFA       QIAACIQE-TLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAEFLQ
GCH1_RICCN       QIAESVQE-NLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRHEFLN
GCH1_RICPR       EIAESVQE-NLKPLGVAVKISALHSCMSMRGVMHDNSVMNTMYYTGIFAEQQKYRYEFLN
GCH1_RALSO       EVAHALVA-HGQARGAACLIEAEQLCLLMGENRRGDERVITQCYVGEFEQNMQARTEFLR
                  :   .                 : *              :    *              

GCH1_HELPY       LLKS-------
GCH1_HELPJ       LLKS-------
GCH1_FUSNN       LLK--------
GCH1_SYNE7       LIRHQPAAFA-
GCH1_SYNY3       LIRHQPNFY--
GCH11_NOSS1      LIRHQPAFF--
GCH12_NOSS1      LVRHNANFH--
GCH11_PSEAE      LIGRSK-----
GCH12_PSEAE      LIR--------
GCH1_CHLTE       LIGNH------
GCH1_CAMJE       LINSAKQVRF-
GCH1_DEIRA       AVQGTLRGR--
GCH1_STRP3       LMTKD------
GCH1_STRP1       LMTKD------
GCH1_BACHD       LIKG-------
GCH1_BACSU       HIKRQD-----
GCH1_LISIN       LIKHN------
GCH1_LISMO       LIKHN------
GCH1_CLOPE       MISM-------
GCH1_STRPN       LMGL-------
GCH1_CALS4       LINSKR-----
GCH1_MYCLE       LILRK------
GCH1_MYCTU       LILRK------
GCH1_CORGL       LIRGH------
GCH1_STRCO       LIMAR------
GCH1_AQUAE       LVKGV------
GCH1_ECOLI       AVRHHN-----
GCH1_SALTY       AVRHHP-----
GCH1_YERPE       AVRHHG-----
GCH1_VIBCH       GLR--------
GCH1_HAEIN       TVQK-------
GCH1_PASMU       LINK-------
GCH1_BUCAP       KK---------
GCH1_CLOAB       LYKA-------
GCH1_SACS2       LLDNANKVNLL
GCH1_SULTO       LLETSKKTSLL
GCH1_PYRAE       R----------
GCH1_AGRFC       MVRNR------
GCH1_RHIME       MLRGFK-----
GCH1_BRUME       LIRT-------
GCH1_RHILO       MVRGGGA----
GCH1_CAUVC       LVKK-------
GCH1_XANAC       FIEVGGKR---
GCH1_XANCP       FIEVGGKR---
GCH1_XYLFA       FIEVGTNVMDL
GCH1_RICCN       LTAKR------
GCH1_RICPR       LIAKR------
GCH1_RALSO       AIKG-------