CLUSTAL format seed alignment for MF_00225

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRD_PSEAE      -----------------MYTLARQLLFKLSPETSHELSIDLIGAGGRLGLN---------
PYRD_PSEPK      -----------------MYTLARQLLFKLSPETSHDLSLDLIGAGGRLGLN---------
PYRD_PSESM      -----------------MYNLARQLLFKLSPETSHDLSLDLIGAGGRLGLN---------
PYRD_METCA      ---------------MIYENLLRPLLFRLDPETAHELSLSALRLAAKLGPA---------
PYRD_AROAE      ----------------MLYNIARPLLFSLDPETAHELSLAALHFFGRVLPA---------
PYRD_NITEU      ----------------MMYNLLRPLLFLLDPETAHTVTLDTLNLLKRTGL----------
PYRD_ACIAD      ----------------MLYSLARPMLFSLAPERAHELTLSMLKTAHKMGM----------
PYRD_BORBR      -----------MSILFHAYPLARPALFAMDAETAHEVTLAQLQRAYDCGLT---------
PYRD_BORPE      -----------MSILFHAYPLARPALFAMDAETAHEVTLAQLQRAYDCGLT---------
PYRD_BORPA      -----------MSILFHAYPLARPALFAMDAETAHEVTLAQLQRAYDCGLT---------
PYRD_RALSO      -------------MLNALYPLARPLLFSMDPEDAHHFTLNQLKRAHALGLS---------
PYRD_BURMA      -------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLA---------
PYRD_BURPS      -------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLA---------
PYRD_CHRVO      ----------------MLYPLLRPLLFKFDAETAHEHTLKMLDRAHRLHLT---------
PYRD_NEIMA      -----------------MYPLARRILFALDAEKAHHFTLDALYTVYKLGLI---------
PYRD_NEIMB      -----------------MYPLARRILFALDAEKAHHFTLDALYTVYKLGLI---------
PYRD_NEIG1      -----------------MYPLARRILFALDAEKAHHFTLDALNTVYKLGLI---------
PYRD_FLALU      -----------------MYSLLRPALFCMDAERAHGAGLRALDLAYRSGTL---------
PYRD_XANAC      -----------------MYSLARPFLFSLDAERAHALALRSIDTAYRTGTT---------
PYRD_BUCAI      ----------------MFYYFIRKLLFLLEPEKAHFLTLKYLNIKNIQFFD---------
PYRD_BUCAP      ----------------MFYYLIRKLLFLIDPEKAHTLVLMYLNSKKIQILR---------
PYRD_HAEIN      -----------------MYQLFRHGIFQMDAEKAHNFTIQCLKLAGNPLFQ---------
PYRD_MANSM      ----------------MLYPLIRKGIFALEPENAHDLAIKMLHLAGNPILN---------
PYRD_PASMU      -----------------MYALIRKALFSLDAEQAHDLTIKTLKTLGRSPFN---------
PYRD_HAEDU      -----------------MYSLIRKALFSMEAETAHYFSIQALKLMGKLPFS---------
PYRD_ECOLI      ----------------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPFE---------
PYRD_ECO57      ----------------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPFE---------
PYRD_ECOL6      ----------------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPFE---------
PYRD_SALPA      ----------------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPLE---------
PYRD_SALTY      ----------------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPLE---------
PYRD_SALCH      ----------------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPLE---------
PYRD_SALTI      ----------------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPLE---------
PYRD_PECAS      ----------------MFYPVIKKALFQLDPERAHELTFQQLRRITNTPFE---------
PYRD_PHOLL      ----------------MCYPLARKALFQLDPEHAHELTFRQLKRITGTPFE---------
PYRD_VIBVU      ----------------MLYRLARAGFFQLDAEKAHDLAIQNFKRFTGTPID---------
PYRD_VIBVY      ----------------MLYRLARAGFFQLDAEKAHDLAIQNFKRFTGTPID---------
PYRD_VIBPA      ----------------MLYRLARTGFFQLDAEKAHDLAIKNFQRFNGTPLD---------
PYRD_VIBCH      ----------------MLYRLARAGFFQLDAEKAHDLAISNFKRFTGTPFD---------
PYRD_ALIF1      ----------------MLYRIARAGIFKLDAEKAHDLAIQNFKRFNGTPLD---------
PYRD_PHOPR      ----------------MIYRLARSVFFQLDAEKAHDLAIQNFSRFTGTPLD---------
PYRD_SHEON      ----------------MFYKIAQKVMFQMDPERAHNLAIGSLRMTGNGPLN---------
PYRD_IDILO      -----------------MYNLIKPLLFRQDPEKTHELMLGILSKWHRTPLS---------
PYRD_LEGPA      -----------------MYSLLRPLLFRLDAEKAHSLTLSLLHYLPGFYF----------
PYRD_LEGPH      -----------------MYSLLRPLLFRLDAEKAHSLTLSLLHYLPGFYF----------
PYRD_LEGPL      -----------------MYSLLRPLLFRLDAEKAHSLTLSLLHYLPGFYF----------
PYRD_COXBU      ----------------MIYRYLRPWLFKLEPETAHALTLNCLKWFYCYWLI---------
PYRD_DEIRA      -----------------MYQTVRPLLFRLDAEDAHHLTLRGLELASGVPLL---------
PYRD_HELPY      ----------------MLYSLVKKYLFSLDAEDAHEKVCKILRMLSSSPFL---------
PYRD_HELPJ      ----------------MLYSLVKKYLFSLDAEIAHEKVCQILRTLSSSPFL---------
PYRD_NOSS1      --------------MDIYKFAVRPLLFDLVKADPEWLHQQTMRSLSWLSHTSDRTSTKWV
PYRD_THEEB      ------------MAIDPYRHLLRPLLFSGLQADPELLHQQFLSLCGWLNQ--DRSLCTWL
PYRD_SYNY3      --------------MLRFARSLYPLILSVTKSDPERGHQRLIQTLKKVDTM-HRNGFAVA
PYRD_SYNP6      --------------MDFYRPLLRPLLLSQLNVDPEWLTRNALGFLATLARS-RSPLAANL
PYRD_GLOVI      --------------MDLYR-LARPLLF---RADPEDAHRRALGALAWAAEQ-------LW
PYRD_PROMM      --MAEPSPAKVYSTGGLYRRWLGAILANDQGLDPEQLTQAALSALSQTSLRRDWPGVSAV
PYRD_SYNPX      ---MPPSP---LSSGAFYQRWLGPVLANDEGLDAEQLSCTALTALGQASLRRQWPLVSTV
PYRD_COREF      MSSSSPAGTARTIRKKVYDASLKAMFTLR-PERIHGIIADGLGVLQMATP---------V
PYRD_CORGL      MSKQSP---TRKLRQTVYDASLKVMFTLR-PERIHGIMNKALGVVDGVAP---------L
PYRD_CORDI      ------------MRTKAYALALKGMFTMS-PERIHHIITRGMQLVQAISP---------L
PYRD_CORST      --------------MTLYDRALKLMFLLP-PERIHGIISGALQTLHLATP---------V
PYRD_MYCBO      ----------------MYPLVRRLLFLIP-PEHAHKLVFAVLRGVAAVAP---------V
PYRD_MYCTU      ----------------MYPLVRRLLFLIP-PEHAHKLVFAVLRGVAAVAP---------V
PYRD_MYCLE      ----------------MYRVVRRLLFLTP-PERIHTLVFAMLRCVTSIAV---------L
PYRD_MYCPA      --MSGAPPAPRGGGHRWYGVARQLFFLVP-AERIHTLVFALLRGVTAVGW---------P
PYRD_NOCFA      ----------------MYALLLRVMFLVP-PERIHHLAFAAMRVAARFAP---------T
PYRD_STRAW      ----------------MYKLFFRLVFKRMDPEQAHYLAFRWIRLAARIPV---------L
PYRD_STRCO      ----------------MYKTFFKLVFSRMDPERAHHLAFRWIRLAVRVPV---------L
PYRD_LEIXX      ----------------MYRTLFSLVLSRFDPERAHRLAFAAIR-ALPVIG---------L
PYRD_THET2      --------------------MHRFLFALD-PEAAHGLALGLLAFWSERGP---------L
PYRD_THET8      --------------------MHRFLFALD-PEAAHGLALGLLALWSERGP---------L
PYRD_HALMA      ---------------MRPYDIAKPFLFSLPAETANKSVHRLLETVDGTRVA---------
                                         :        .      :                  

PYRD_PSEAE      -RLLTPKPAS---------------LPVSVLGLEFPNPVGLAAGLDKNGDAIDGFGQLGF
PYRD_PSEPK      -GMLCKQPAS---------------LPVSVMGLNFANPVGLAAGLDKNGAAIDGFAQLGF
PYRD_PSESM      -GLLGKSAAK---------------LPVSVMGLEFPNPVGLAAGLDKNGAAIDGFAQLGF
PYRD_METCA      -NPLKQSLPT---------------SPRTVMGLEFPNPIGLAAGLDKNGDCIDGLAALGF
PYRD_AROAE      -ATPTESD------------------PVDVMGLHFPNRIGLAAGLDKNGEAIDGLARLGF
PYRD_NITEU      --LPDRTIDC---------------TPVRVMELDFPNPVGLAAGLDKNGTCISALASLGF
PYRD_ACIAD      ---LRQTIQP---------------KPVTCMGIEFPNPVGLAAGLDKNGAYIDALAGLGF
PYRD_BORBR      -RKLLHAQPE---------------APATLMGLSLRNPVGLAAGLDKNGAHIDALGNLGF
PYRD_BORPE      -RKLLHAQPE---------------APATLMGLSLRNPVGLAAGLDKNGAHIDALGNLGF
PYRD_BORPA      -RKLLHAQPE---------------APATLMGLSLRNPVGLAAGLDKNGAHIDALGNLGF
PYRD_RALSO      -GCIGARVAP---------------QPRTVMGIAFPNPVGLAAGLDKDGAYIDALGALGF
PYRD_BURMA      -CALSPRVPD---------------APRTVMGLSFRNPVGLAAGLDKDGAAIDGFAALGF
PYRD_BURPS      -CALSPRVPD---------------APRTVMGLSFRNPVGLAAGLDKDGAAIDGFAALGF
PYRD_CHRVO      -PLAASPAAR---------------QPVQAMGLTFPNPVGLAAGLDKNGAHIDALAALGF
PYRD_NEIMA      -PVTDNRTK-----------------PVKLMGMDLPNPVGLAAGLDKNGEYIDALGALGF
PYRD_NEIMB      -PVTDNRTK-----------------PVKLMGMDLPNPVGLAAGLDKNGEYIDALGALGF
PYRD_NEIG1      -PVTDNRTK-----------------PIKLMGMDLPNPVGLAAGLDKNGEYIDALGALGF
PYRD_FLALU      -GLLASRPAP---------------LPTRAFGLEFPNPVGLAAGLDKNGEHIDALFALGF
PYRD_XANAC      -ALLARRPVP---------------LPTPAFGLMFPNPVGLGAGLDKNGEHIDALFALGF
PYRD_BUCAI      -FFFYKTIILS--------------KKIKCMGLIFDNKLGTAAGIDKNGEYIDALSKLGF
PYRD_BUCAP      -KIFIKPIPL---------------KQIKCMGLTFNNKIGLAAGMDKNGDYIDSLSKIGF
PYRD_HAEIN      -PILKSLIHAPKG------------FPKTVMGVNFPNPIGLAAGADKNGDAIDGFGALGF
PYRD_MANSM      -KLLKALLACPSG------------NEKTVMGIKFKNPIGLAAGADKNGDAIDGFGAMGF
PYRD_PASMU      -PLLKTLFACPTG------------SPKTIMGLHFKNPIGLAAGADKNGEAIEGFAAMGF
PYRD_HAEDU      -LCSTTL------------------NPVEVMGLKFKNPIGLAAGADKNGEAIDGFAKLGF
PYRD_ECOLI      -ALVRQKVPA---------------KPVNCMGLTFKNPLGLAAGLDKDGECIDALGAMGF
PYRD_ECO57      -ALVRQKVPA---------------KPVNCMGLTFKNPLGLAAGLDKDGECIDALGAMGF
PYRD_ECOL6      -ALVRQKVPA---------------KPVNCMGLTFKNPLGLAAGLDKDGECIDALGAMGF
PYRD_SALPA      -ALVRQKVPT---------------KPVTCMGLTFKNPLGLAAGLDKDGECIDALGAMGF
PYRD_SALTY      -ALVRQKVPT---------------KPVTCMGLTFKNPLGLAAGLDKDGECIDALGAMGF
PYRD_SALCH      -ALVRQKVPT---------------KPVTCMGLTFKNPLGLAAGLDKDGECIDALDAMGF
PYRD_SALTI      -ALVRQKVPT---------------KPVTCMGLTFKNPLGLAAGLDKDGECIDALGAMGF
PYRD_PECAS      -FLVRQSVPT---------------KPVTCMGLSFKNPLGLAAGLDKDGECIDALGAMGF
PYRD_PHOLL      -FFIRQSIAT---------------KPVTCMGLSFKNPLGLAAGLDKDGDCIDAFGAMGF
PYRD_VIBVU      -LFYRQQLPN---------------RPVECMGLTFRNPVGLAAGLDKNGECIEAFDAMGF
PYRD_VIBVY      -LFYRQQLPN---------------RPVECMGLTFRNPVGLAAGLDKNGECIEAFDAMGF
PYRD_VIBPA      -LFYRQQLPN---------------RPVECMGLTFRNPVGLAAGLDKNGECIEAFDAMGF
PYRD_VIBCH      -LFYRQQLPH---------------RPVQCMGLTFKNPVGLAAGLDKNGECIEAFGAMGF
PYRD_ALIF1      -IFYRQNLAS---------------KPVEVMGIKFKNPVGLAAGLDKNGECIEAFGAMGF
PYRD_PHOPR      -LFYRQHVPD---------------RPVEVMGIKFKNPVGLAAGLDKNGECIDAFGAMGF
PYRD_SHEON      -AFYAQNITP---------------APVSFMGLTFPNPVGLAAGMDKDGESIDAFHAMGF
PYRD_IDILO      -LFWKQNVAS---------------KPVRVMGIDFPNPVGLAAGLDKNAECIDAFSQMGF
PYRD_LEGPA      -----RKIAG---------------QPVHAMGLVFPHQVGLAAGLDKNGEHLDALAKLGF
PYRD_LEGPH      -----RKIAG---------------QPVHAMGLVFPHQVGLAAGLDKNGEHLDALAKLGF
PYRD_LEGPL      -----RKMAG---------------QPVHAMGLVFPHQVGLAAGLDKNGEHLDALAKLGF
PYRD_COXBU      -NRRLQRFPQ---------------KPTVVFGIEFPNPVGLAAGLDKNGEYMDELLGLGF
PYRD_DEIRA      -PRLARTLTVPGTQGPGDAALRRTLWGQTPSEQTFESPLGLAAGLDKNAQAVPAFTAFGF
PYRD_HELPY      -CNLIDSQWGYQNPK----------LENEILGLHFPNPLGLAAGFDKNASMLRALMAFGF
PYRD_HELPJ      -CRLIHSQWGYKNPK----------LENEILGLNFPNPLGLAAGFDKNASMLRALIAFGF
PYRD_NOSS1      QNILQKSLCLED-----------SRLEQNLFGLRFPNPVGLAAGFDKDGVAARIWSSLGF
PYRD_THEEB      RQQLQQWYALSD-----------PRLERQVWGLRFPNPIGLAAGFDKNGVARSVWSAFGF
PYRD_SYNY3      MEQLEQAFTHAD-----------PRLQQTCWGLNFPNVLGLSAGCDKEGEAAAVWPALGF
PYRD_SYNP6      RSYLRQTYGFQD-----------PRLAMSLWGLTFATPVGLAAGFDKDGIAAPLWSDLGF
PYRD_GLOVI      AGWLDSVFGYPD-----------PRLEVKLWGLSFANPLGLAAGFDKNAEAVGAWEHLGF
PYRD_PROMM      LAAIALDLQRHD-----------LRLEQVLFGCRFLNPVGLAAGFDKNGVAASIWDRFGF
PYRD_SYNPX      LEGLAGDLQRRD-----------LRLEQVLFGCRFPNPVGLAAGFDKNGVAAGLWDRFGF
PYRD_COREF      NRAMGRVIGVND-----------PVLSQEVFGVTFPRPLGLAAGFDKNATAADTWTALGF
PYRD_CORGL      NRTMEKIIAVHD-----------DSLSQEVFGVTFPRPLGLAAGFDKNASMADAWGAVGF
PYRD_CORDI      RRAVGSILPVND-----------PILRQEVFGVTFPQPLGLAAGFDKNGEAPDVWAAFGF
PYRD_CORST      NRVMEKAVRVHD-----------PVLRQTVFGVDFPAPLGLAAGFDKNAEAIDSWGAIGF
PYRD_MYCBO      RRLLRRLLGPTD-----------PVLASTVFGVRFPAPLGLAAGFDKDGTALSSWGAMGF
PYRD_MYCTU      RRLLRRLLGPTD-----------PVLASTVFGVRFPAPLGLAAGFDKDGTALSSWGAMGF
PYRD_MYCLE      RRLLRWVLGPTD-----------PVLASTVFGVRFPGPLGLAAGFDKDGMGLLAWGALGF
PYRD_MYCPA      RRLLRRLLAPTD-----------PVLASTVFGVRFPGPLGLAAGFDKDGLGLHAWGALGF
PYRD_NOCFA      RALVRRLAVVDD-----------PILHSTVFGVPFRAPLGLAAGFDKNAEGVDVWGPFGW
PYRD_STRAW      RTFVAAALAPRF-----------KELRTEAFGLRMHGPFGLAAGFDKNAVAVDGMSMLGF
PYRD_STRCO      RTFVAAALAPRH-----------KELRTEALGLRMHGPFGLAAGFDKNAVAIDGMAMLGF
PYRD_LEIXX      GSLLRRFTAPD------------PSLAVEALGLRFDSPFGIAAGFDKDGEGVIGLGALGF
PYRD_THET2      LEVPARLLRVED-----------PRLRVEAFGVSFPNPLGLAAGMDKDARALGAWWALGF
PYRD_THET8      LEVPARLLRVED-----------PRLRVEAFGVSFPNPLGLAAGMDKDARALGAWWALGF
PYRD_HALMA      -DVMADRYTVADE-----------RLAVEAFGHTFDNPVGVAAGFDKNATIPETLASLGF
                                                  :   .* .** **:.        .*:

PYRD_PSEAE      GFIEIGTVTPRPQPGNPRPRLFRLPQANAIINRMGFNNHGVDHLLARVRAAKYR------
PYRD_PSEPK      GFVEIGTVTPRPQPGNPKPRLFRLPEATAIINRMGFNNLGVDHLLGRVRASRYK------
PYRD_PSESM      GFVEIGTVTPRPQPGNPKPRIFRLPNAEAIINRMGFNNLGVDNLVSRVEAAKYR------
PYRD_METCA      GFLEIGTVTPRPQPGNPRPRLFRVPEAGALVNRMGFNNSGVAHLIARVRQTRYR------
PYRD_AROAE      GFLEIGTITPRPQPGNPRPRMFRLPEVRAIINRMGFNNHGVDALVANVRAAKYR------
PYRD_NITEU      GFIEVGTITPRPQVGNPRPRLFRIPQAEAIINRMGFNNVGVDKLIENVQQSGYR------
PYRD_ACIAD      GFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNEGVDQLVENVKAAKFR------
PYRD_BORBR      GFVEVGTVTPRAQPGNPKPRMFRLPRANALINRLGFNNQGLDAFIANVQRSQWRS---QG
PYRD_BORPE      GFVEVGTVTPRAQPGNPKPRMFRLPRANALINRLGFNNQGLDAFIANVQRSQWRS---QG
PYRD_BORPA      GFVEVGTVTPRAQPGNPKPRMFRLPRANALINRLGFNNQGLDAFIANVQRSQWRS---QG
PYRD_RALSO      GFIEVGTVTPRAQPGNPRPRMFRLPAASALINRMGFNNGGVDAFIRNVQASKWRE---AG
PYRD_BURMA      GFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQFVKNVQAARYR------
PYRD_BURPS      GFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQFVKNVQAARYR------
PYRD_CHRVO      GFIEIGTVTPRPQDGNPKPRLFRLPEHEAIINRMGFNNHGVAALLDNVRRSKFK------
PYRD_NEIMA      GFIEIGTVTPKPQPGNPQPRLFRVPEHQGIINRMGFNNHGIDTMIRNIEKSKFS------
PYRD_NEIMB      GFIEIGTVTPNPQPGNPQPRLFRVPEHQGIINRMGFNNHGIDTMIRNIEKSKFS------
PYRD_NEIG1      GFLEIGTVTRNPQPGNPQPRLFRVPEHQGIINRMGFNNHGIDAMIRNIEKSKYQ------
PYRD_FLALU      GYVEIGTVTPRPQAGNPQPRLFRVPEHLGVINRMGFNNAGVDALVANVRAARRD-----R
PYRD_XANAC      GFVEIGTVTPRAQEGNPKPRMFRLPEYQAVINRMGFNNLGVDALVANVQRARRT-----G
PYRD_BUCAI      GFIEVGTVTPLPQVGNPKPRMFRIVSMEGIINRMGFNNLGIDNLIRNIKKSNFK------
PYRD_BUCAP      GFIEVGTVTPLPQYGNPKPRIFRVPSIEGIINRMGFNNLGIDYLVNNVKKSKFK------
PYRD_HAEIN      GFLELGTVTPVAQDGNAKPRQFRLIEAEGIINRNGFNNNGIDYLIENVKNARYK------
PYRD_MANSM      GFIEVGTVTPLAQDGNAKPRQFRIVEAEGIVNRNGFNNYGVDYLVENVKKAKFD------
PYRD_PASMU      GFIEVGTVTPLAQEGNPKPRQFRLPEAEGIINRNGFNNYGIDYLIENVKHANYD------
PYRD_HAEDU      GFIEVGTVTPLAQDGNNKPRQFRILEAEGIINRNGFNNQGVDVLVENVKKASYD------
PYRD_ECOLI      GSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKAHYD------
PYRD_ECO57      GSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKAHYD------
PYRD_ECOL6      GSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKAHYD------
PYRD_SALPA      GSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKAHFD------
PYRD_SALTY      GSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKAHFD------
PYRD_SALCH      GSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKAHFD------
PYRD_SALTI      GSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNLVENVKKAHFD------
PYRD_PECAS      GFIEVGTVTPRPQSGNDKPRLFRVVEAEGLINRMGFNNKGVDYLVENVKKTRFG------
PYRD_PHOLL      GFIEIGTVTPRAQAGNDKPRLFRIVEAEGLINRMGFNNLGVDNLVENVKKAKYG------
PYRD_VIBVU      GFVEVGTVTPRAQSGNDKPRLFRLVGAEGIINRMGFNNLGVDNLIENVKKAKYS------
PYRD_VIBVY      GFVEIGTVTPRAQSGNDKPRLFRLVGAEGIINRMGFNNLGVDNLIENVKKAKYS------
PYRD_VIBPA      GFVEVGTVTPRPQPGNDKPRLFRLVEAEGIINRMGFNNLGVDHLVENVKKAKFN------
PYRD_VIBCH      GFVEVGTVTPRPQAGNDKPRLFRLVHAEGIINRMGFNNLGVDHLVENVKRAKYD------
PYRD_ALIF1      GFVEVGTVTPRPQSGNDKPRLFRLIEAEGIINRMGFNNLGVDNLVENVKKAKYD------
PYRD_PHOPR      GFVEVGTVTPRPQSGNEKPRLFRVLPAEGLINRFGFNNLGVDNLVENVKKSKYD------
PYRD_SHEON      GHVEVGTVTPRPQPGNDLPRLFRLKPAKAIINRMGFNNKGVDNLVKNLIAKKTD------
PYRD_IDILO      GFIEVGTVTPVAQPGNDKPRLFRLTEDEAIINRMGFNNDGVDELVKNVKASSYK------
PYRD_LEGPA      SFIELGTVTPKGQAGNPKPRLFRIAEANAIINRMGFNNSGVDVLVENVKRANYK------
PYRD_LEGPH      SFIELGTVTPKGQAGNPKPRLFRIAEANAIINRMGFNNSGVDVLVENVKRANYK------
PYRD_LEGPL      SFIELGTVTPKGQTGNPKPRLFRIAEANAIINRMGFNNSGVDVLVENVKSANYK------
PYRD_COXBU      GFIEVGAVTPKPQPGNSKPRIFRLPQARALINRMGFNNLGVDYLVEQLKRRKVK------
PYRD_DEIRA      GFVEVGTVTPLAQSGNERPRLFRLPEDEALINRMGFNNGGTAAMHARLAVLTDR-----A
PYRD_HELPY      GYLEAGTLTNEAQVGNERPRLFRHIEEESLQNAMGFNNYGAILGVRSFKRFAPY-----K
PYRD_HELPJ      GYLEAGTLTNIAQSGNEKPRLFRHIEEESLQNAMGFNNYGAILGVRAFNRFAPY-----K
PYRD_NOSS1      GFAELGTVTFVGQPGNPPPRLFRLPLDQAALNRMGFNNHGAAVMAARLADEKG----QFS
PYRD_THEEB      GFAELGTVTWHPQPGNPRPRLFRLGSDRAVINRMGFNNAGAEAMAASLERSP-----PAS
PYRD_SYNY3      GFAELGAVTKYAQPGNDRPRLFRLPQDQAVLNRLGANNEGAVAMAAKLKHTWDY--YPRT
PYRD_SYNP6      GFAELGTVTALAQPGNPRPRLFRIPQDLAAFNRMGFNNASAEALADTLRGYFPE--GQRS
PYRD_GLOVI      GFAEVGTVTRHAQPGNPRPRLFRLPADQAAINRMGFNNDGADALALRLAGRR------WG
PYRD_PROMM      GFAELGTVTWHGQTGNPRPRLFRLAAEQAALNRMGFNNNGAEVMRRTLEKQALPSPGQRP
PYRD_SYNPX      GFAEVGTVTWHGQPGNPRPRLFRLAQEQAALNRMGFNNDGAQALRRTLERQRLAPPGRRP
PYRD_COREF      GYAELGTVTASPQAGNPTPRLFRLPADRAILNRMGFNNAGAADVADNL---RRR---KSR
PYRD_CORGL      GYAELGTVTASPQPGNPTPRLFRLPADKAILNRMGFNNLGAAEVAKNL---RNR---KST
PYRD_CORDI      GYAELGTVTASPQPGNPTPRLFRLPADKAILNRMGFNNLGAAEVAKNL---KRR---KSD
PYRD_CORST      GYAEMGTVTPKSQPGNPTPRLFRLPEDKAILNRMGFNNKGALVVADNL---RAR---RSR
PYRD_MYCBO      GYAEIGTVTAHPQPGNPAPRLFRLADDRALLNRMGFNNHGARALAIRL---ARH---RPE
PYRD_MYCTU      GYAEIGTVTAHPQPGNPAPRLFRLADDRALLNRMGFNNHGARALAIRL---ARH---RPE
PYRD_MYCLE      GYAEVGTVTAYPQPGNPAPRMFRLPADRALLNRMGFNNNGAGALAIQL---AHH---RPE
PYRD_MYCPA      GYAEIGTVTAGPQPGNPAPRLFRLPADRALLNRMGFNNLGAGALAVRL---ARR---QPD
PYRD_NOCFA      GFAEIGTVTAQAQPGNPAPRLFRLPADRALINRMGFNNHGAARAAEQL---RAR---TAT
PYRD_STRAW      DHVEIGTVTGEPQPGNPKKRLFRLVPDRALINRMGFNNEGSAAVAARL-AAREA---VFR
PYRD_STRCO      DHVEIGTVTGEPQPGNPKKRLFRLVADRALINRMGFNNDGSLAVAARL-ASRTP---VFR
PYRD_LEIXX      GHVEVGTITARPQPGNDKPRLFRLLPDRAVINRMGFNNHGAGAAANRLLRVRRA---RRR
PYRD_THET2      GFAEVGTLTPRPQVGNPKPRLFRLVEDRALINRMGFNNRGAEEAARCLKRFRQR---GLP
PYRD_THET8      GFAEVGTLTPRPQVGNPKPRLFRLVEDRALINRMGFNNRGAEEAARRLKRSRQR---GLP
PYRD_HALMA      GFAEVGGVTAEPQAGNARPRMFRLKADEAIINRMGLNNDGAIVIGERLKNVDAP------
                .  * * :*   * **   * **     .  *  * ** .       .            

PYRD_PSEAE      GVLGINIGKNFDTPVERAVDDYLICLDKVYADASYVTVNVSSPNTPGLRSLQFGDSLKQL
PYRD_PSEPK      GVLGINIGKNFDTPVERAVDDYLICLDKVYTAASYITVNVSSPNTPGLRSLQFGDSLKQL
PYRD_PSESM      GILGINIGKNFDTPVERAVDDYLICLDKAYAHASYVTVNVSSPNTPGLRSLQFGDSLKQL
PYRD_METCA      GILGINIGKNLTTPVERALDDYREGLKAVYPYAHYVTLNVSSPNTPGLRSLQFGALLDEL
PYRD_AROAE      GILGINIGKNFDTPIDRAADDYLACLDKVYALASYVTVNISSPNTKNLRQLQGESELDDL
PYRD_NITEU      GILGINIGKNADTPLQNAIDDYLICLRKVYLHASYVTVNISSPNTQQLRQLQNETELEHL
PYRD_ACIAD      GILGINIGKNADTPVENAVDDYLICLEKVYNYASYITVNISSPNTKNLRSLQSGDALTEL
PYRD_BORBR      GILGLNIGKNADTPIERAAEDYLIGLAGVYPHADYVTVNISSPNTKNLRALQGGDELSAL
PYRD_BORPE      RILGLNIGKNADTPIERAAEDYLIGLAGVYPHADYVTVNISSPNTKNLRALQGGDELSAL
PYRD_BORPA      GILGLNIGKNADTPIERAAEDYLISLAGVYPHADYVTVNISSPNTKNLRALQGGDELSAL
PYRD_RALSO      GVLGLNIGKNADTPIERAVDDYLHCLERVYPYASYVTVNISSPNTKNLRQLQGASELDSL
PYRD_BURMA      GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRQLQGAGELDAL
PYRD_BURPS      GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRQLQGAGELDAL
PYRD_CHRVO      GVLGINIGKNAITPIENAVDDYLACLDQVYAAASYVTVNISSPNTKNLRQLQQGDELGRL
PYRD_NEIMA      GVLGINIGKNAVTPIENAADDYLICLEKAYAHASYITVNISSPNTKNLRALQGGDELSAL
PYRD_NEIMB      GVLGINIGKNAVTPIENAADDYLICLEKAYAHASYITVNISSPNTKNLRALQGGDELSAL
PYRD_NEIG1      GVLGINIGKNAVTPIQNAADDYLICLEKAYAHASYITVNISSPNTKNLRALQGGGELGAL
PYRD_FLALU      GILGINIGKNKDTPNELAHTDYLTCLEKVYALADYITVNISSPNTAGLRELQEEQALREL
PYRD_XANAC      GLLGINIGKNKDTSNEEATSDYRYCMERVYPLADYITVNISSPNTAGLRELQEEQSLRRL
PYRD_BUCAI      GIIGVNIGKNKSTSLENSVDDYLICIEKIYCYAGYIAINISSPNTTNLRNLQYGILFKKL
PYRD_BUCAP      GIIGINIGKNKDTKIEDAIKDYLICIEKIYFYASYIAINISSPNTINLRKLQYGILFENL
PYRD_HAEIN      GVIGINIGKNKFTSLEQGKDDYIFCLNKAYNYAGYITVNISSPNTPDLRQLQYGDYFDDL
PYRD_MANSM      GVIGINIGKNKVTPVERGKDDYIFCLNKAYNYAGYITVNISSPNTPGLRQLQYGDALDDL
PYRD_PASMU      GILGINIGKNTFTSVENGKADYLICLNKAYHYADYITINISSPNSPGLRQLQYGEALEDL
PYRD_HAEDU      GILGINIGKNATTPIENALDDYQICLHKVYSYADYITVNISSPNTHNLRALQYGEALDHL
PYRD_ECOLI      GVLGINIGKNKDTPVEQGKDDYLICMEKIYAYAGYIAINISSPNTPGLRTLQYGEALDDL
PYRD_ECO57      GVLGINIGKNKDTPVEQGKDDYLICMEKIYAYAGYIAINISSPNTPGLRTLQYGEALDDL
PYRD_ECOL6      GVLGINIGKNKDTPVEQGKDDYLICMEKIYAYAGYIAINISSPNTPGLRTLQYGEALDDL
PYRD_SALPA      GILGINIGKNKDTPVENGKDDYLICMEKVYAYAGYIAINISSPNTPGLRTLQYGDALDDL
PYRD_SALTY      GILGINIGKNKDTPVENGKDDYLICMEKVYAYAGYIAINISSPNTPGLRTLQYGDALDDL
PYRD_SALCH      GILGINIGKNKDTPVENGKDDYLICMEKVYAYAGYIAINISSPNTLGLRTLQYGDALDDL
PYRD_SALTI      GILGINIGKNKDTPVENGKDDYLICMEKVYAYAGYIAINISSPNTPGLRTLQYGDALDDL
PYRD_PECAS      GVLGINIGKNKDTPVEQGKDDYLICMDKVYPHAGYIAINISSPNTPGLRSLQYGEALDDL
PYRD_PHOLL      GVIGINIGKNKDTPVEHGKDDYLICMDKIYPHAGYITINISSPNTPGLRTLQYGEALDDL
PYRD_VIBVU      CVLGINIGKNKDTPIEKGAEDYLICMEKVYEYAGYIAVNISSPNTPGLRTLQYGEALDEL
PYRD_VIBVY      CVLGINIGKNKDTPIEKGAEDYLICMEKVYEYAGYIAVNISSPNTPGLRTLQYGEALDEL
PYRD_VIBPA      CVLGINIGKNKDTPIENGAEDYLICMEKVYEYAGYIAVNISSPNTPGLRSLQYGEALDEL
PYRD_VIBCH      GIIGINIGKNKDTPIEKGAEDYLICMDKVYPYAGYIAVNISSPNTPGLRSLQYGEALDEL
PYRD_ALIF1      GVIGINIGKNKDTPIEKGTEDYLICMEKVYQYAGYIAVNISSPNTPGLRTLQYGEALDDL
PYRD_PHOPR      GVIGINIGKNKDTPIEKGAEDYLICMDKVYEHAGYIAVNISSPNTPGLRSLQYGEALDDL
PYRD_SHEON      IMVGVNIGKNKDTPVEQGKDDYLICMDKVYLHAAYIAVNISSPNTPGLRSLQYGDLLDEL
PYRD_IDILO      GVLGINIGKNKNTPEEQAIDDYLACLNKVYPYADYVTINISSPNTPGLRNLQHGSSLDGL
PYRD_LEGPA      GILGINIGKNKETNLNQAAEDYLYCFRKVYDHASYVTINISSPNTPDLRQLQQGDYFAEL
PYRD_LEGPH      GILGINIGKNKETNLNQAAEDYLYCFRKVYDHASYVTINISSPNTPDLRQLQQGDYFAEL
PYRD_LEGPL      GILGINIGKNKETNLNQAADDYLYCFRKVYDHASYVTINISSPNTPDLRQLQQGDYFAEL
PYRD_COXBU      GIVGVNIGKNLTTPLEKAHEDYQNCFEKLYSYVDYVTINISSPNTPELRQLQSERYLADL
PYRD_DEIRA      APVWVNIGKNKVTPNEDAAEDYRKCVRALGDLADAFVVNVSSPNTPGLRALQAADDLAAL
PYRD_HELPY      TPIGINLGKNKHIEQAHALEDYKAVLSKCLNIGDYYTFNLSSPNTPNLRDLQNKAFVHEL
PYRD_HELPJ      TPIGINLGKNKHIEQAHALEDYQAVLNQCLNIGDYYTFNLSSPNTPNLRDLQNKVFVNEL
PYRD_NOSS1      IPIGINLGKSKVTPLEAAAEDYLNSFRLLKELGDYFVVNVSSPNTPGLRSLQDASMLSSI
PYRD_THEEB      IPIGINLGKSKITPLAAAKEDYLASFRRLHPLGDYFVINVSSPNTPGLRDLQAKEQLAPI
PYRD_SYNY3      IPIGINLCKSKITPLDQAVEDYVFSFQTLAPVADYFVVNVSSPNTPGLRSLQESDELPRI
PYRD_SYNP6      IPIGINLGKSKLTPLSGAVSDYVSSFRSLRSLGDYFVVNVSSPNTPGLRSLQAVTELEPI
PYRD_GLOVI      IPIGINLGKSKVTPLEQASDDYLYSFERLYHLGDYFVVNVSSPNTPGLRELQQADRLGEI
PYRD_PROMM      AVLGLNLGKSRITPLEQAPDDYALSLELLAPLADYAVINVSSPNTPGLRDLQDASQLRRL
PYRD_SYNPX      AVLGINVGKSKVTALEQAPEDYASSLELLAPLADYAVINVSSPNTPGLRDLQDSSQLRRL
PYRD_COREF      DVIGINIGKTKVVPAEQAVDDYRRSASLLGDLADYLVVNVSSPNTPGLRDLQAVESLRPI
PYRD_CORGL      DVIGINIGKTKVVPAEHAVDDYRRSASLLGDLADYLVVNVSSPNTPGLRDLQAVESLRPI
PYRD_CORDI      AVIGINIGKTKVVASKDAVNDYRRSALLLGNLADYLVINVSSPNTPGLRDLQAVESLRPI
PYRD_CORST      DVVGINIGKNK--TSEDAVADYRATSTLLGQLADYLVVNVSSPNTPGLRDLQAVEELRPI
PYRD_MYCBO      IPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSPNTPGLRDLQAVESLRPI
PYRD_MYCTU      IPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSPNTPGLRDLQAVESLRPI
PYRD_MYCLE      VPIGVNISKTKATPASHTVDDYRASARLVGPLASYLVVNVSSPNTPGLRDLQAVESLRAI
PYRD_MYCPA      IPIGVNIGKTKATPPDQAVDDYRASARLLGPLASYLVVNVSSPNTPGLRDLQAVGSLRPI
PYRD_NOCFA      VPIGANIGKTKVVEPAGAAADYATSAALLGPLADFVVVNVSSPNTPGLRDLQAVESLRPL
PYRD_STRAW      TVVGVNIGKTKVVPEEEAADDYVKSTERLARHADYLVVNVSSPNTPGLRNLQATEALRPL
PYRD_STRCO      TVVGVNIGKTKVVPEEEAVGDYVKSAERLAPHADYLVVNVSSPNTPGLRNLQATEALRPL
PYRD_LEIXX      PVLGVNISKSRAVAVEDATADYLISARALAPVADYLVVNVSSPNTPGLRGLQEREALAPL
PYRD_THET2      LPLGVNLGKNRDTPLERAAEDYLKALRFLEPFGDYFVLNVSSPNTPGLRALQEGPFLDEL
PYRD_THET8      LPIGVNLGKNRDTPLGRAAEDYLKALRLLEPFGDYFVLNVSSPNTPGLRALQEGPFLDEL
PYRD_HALMA      FPVGVNIAKTEHVGTNEAPDDYRTTYEHVAEGGDFFVVNVSCPNSEGFEELQNRDAMEAI
                  :  *: *.          **              ..*:*.**:  :. **    .  :

PYRD_PSEAE      LEALRQRQEALALRHGRRVPLAIKIAPDMTDEETALVAAALVEAGMDAVIATNTTLGREG
PYRD_PSEPK      LDALAERREQLAGAHGKRVPLAIKIAPDMSDEETALVAAALMESGMDAVIATNTTLGREG
PYRD_PSESM      LEALSLRQQELTQRHGKRVPLAIKIAPDMTDEETVLVAAALIESGMDAVIATNTTLSRQG
PYRD_METCA      LDGLMGEREELTAQHGKRVPLALKVAPDMDSREIKALAGAVVRHGVDAVIATNTTASRDG
PYRD_AROAE      LGRLKARQQQLADRHGRYVPLTLKIAPDLEPAQVTNIADALRRHRIDGVIATNTTIARDK
PYRD_NITEU      LGALKAEQTRLSDLHGRYTPLAIKIAPDLESEQITVIASLLMKHRMDAVIATNTTTAREG
PYRD_ACIAD      LETLKKRQLELAEQYHHYVPLVLKVAPDLTHEDIQFISEQLLTFKIDGLIVTNTTLSREG
PYRD_BORBR      LGQLQERRLALADQHQRHVPLAVKIAPDLSDDQIDAIAEILPRHGIDGVIATNTTLARDA
PYRD_BORPE      LGQLQERRLALADQHQRHVPLAVKIAPDLSDDQIDAIAEILPRHGIDGVIATNTTLARDA
PYRD_BORPA      LGQLQERRLALADQHQRHVPLAVKIAPDLSDDQIDAIAEILPRHGIDGVIATNTTLARDA
PYRD_RALSO      LGTLRGAQQRLADQHKRYVPVVLKIAPDLDDDQIANIGDALLRHRMDGVIATNTTIRREA
PYRD_BURMA      LAALKDKQRRLADLHGKLVPLALKIAPDLDDEQVKEIAATLLRHDIEGVIATNTTLSREA
PYRD_BURPS      LAALKDKQRRLADLHGKLVPLALKIAPDLDDEQVKEIAATLLRHDIEGVIATNTTLSREA
PYRD_CHRVO      LAALKQRQLALADQHGRYVPLAVKIAPDLDDEQIAEIARLLTGNGIDGVIATNTTLSRRE
PYRD_NEIMA      LEALKNKQAQLASVYGKYVPLAVKIAPDLDEAQIEDIAHVVKSVEMDGIIATNTTIDKSS
PYRD_NEIMB      LEALKNKQAQLASVHGKYVPLAVKIAPDLDEAQIEDIAHVVKSVEMDGIIATNTTIDKSS
PYRD_NEIG1      LEALKNKQAQLAAAHGKYIPLAVKIAPDLDEAQIEDIARVVKSVEMDGIIATNTTIDKSS
PYRD_FLALU      VSRLREGQETLAARHGKRVPMLVKVAPDLSDADVDAAARVLAELQVDGVIATNTTIARVG
PYRD_XANAC      ISDLRETQEALSAQHGKRVPMLVKVAPDLNDRDIDAAARVLADLAVDGVIATNTTVTRTL
PYRD_BUCAI      LYKIKKKQKELHKKYLKYVPIAIKISPDLSIKELVDISKQLIRYKIDAVIATNTTLDHSS
PYRD_BUCAP      LRDIKKKQSEMHSKYSKYVPIVIKISPDLSKKELIHISNKLIHYKIDGVIATNTTLDHSS
PYRD_HAEIN      LRSIKDRQAILANQYNKYVPIAVKIAPDLTESELVQIADTLVRHKMDGVIATNTTISRDT
PYRD_MANSM      LKSIKERQAYLAQVYNKYVPIAVKIAPDQTEEELVQIADTLRRHKMDGVIATNTTISRDT
PYRD_PASMU      LQGVKARQKDLAEQYQKYVPIAVKIAPDLTEGEVVQIADTLQRHKMDAVIATNTTISRDT
PYRD_HAEDU      LAELKTEQAKLAKKFNQYKPLVLKIAPDLTNEEIVSIADSLIRHQMDGVIAGNTTLSREN
PYRD_ECOLI      LTAIKNKQNDLQAMHHKYVPIAVKIAPDLSEEELIQVADSLVRHNIDGVIATNTTLDRSL
PYRD_ECO57      LTAIKNKQNDLQAMHHKYVPIAVKIAPDLSEEELIQVADSLVRHNIDGVIATNTTLDRSL
PYRD_ECOL6      LTAIKNKQNDLQVMHHKYVPIAVKIAPDLSEEELIQVADSLVRHNIDGVIATNTTLDRSL
PYRD_SALPA      LTAIKNKQNDLQAIHHKYVPVAVKIAPDLCEEELIQVADSLLRHNIDGVIATNTTLDRSL
PYRD_SALTY      LTAIKNKQNDLQAIHHKYVPVAVKIAPDLCEEELIQVADSLLRHNIDGVIATNTTLDRSL
PYRD_SALCH      LTAIKNKQNDLQAIHHKYVPVAVKIAPDLCEEELIQVADSLLRHNIDGVIATNTTLDRSL
PYRD_SALTI      LTAIKNKQNDLQVIHHKYVPVAVKIAPDLCEEELIQVADSLLRHNIDGVIATNTTLDRSL
PYRD_PECAS      LLAIKNKQTELKEKHQKYVPVAVKIAPDLSEEELIQIADSLVRYNIDGVIATNTTLDRKL
PYRD_PHOLL      LSAIKNKQGELQQKYQKYVPVAVKIAPDLSEEELIQIADSLIRHNIDGAIATNTTLDKRL
PYRD_VIBVU      LVELKRKQAELEEKHGKYVPLALKIAPDLTDDEISQICQSLINNKIDGVIATNTTLDRTM
PYRD_VIBVY      LVELKRKQAELEEKHGKYVPLALKIAPDLTDDEISQICQSLINNKIDGVIATNTTLDRTM
PYRD_VIBPA      LSELKAKQSELAEKHGKYVPLALKIAPDLSDDEITQICESLLKNNIDGVIATNTTLDRTV
PYRD_VIBCH      LAALKTRQAELAAKHDKYVPLALKIAPDLSDDEIQQICQSLLKNKIDSVIATNTTLDRSL
PYRD_ALIF1      LSQLKEKQKELAEKYGKYVPVALKIAPDLEDDELTQIAESLIKYKIDGVIATNTTLDRSM
PYRD_PHOPR      LSQLKAKQEELAAKHGKYVPLALKIAPDLEDHEIVQIAESLIKNKIDGVIGTNTTLDRTL
PYRD_SHEON      LSAIKAKQLELADKHKKYVPIALKIAPDLTIEEIENIAQALIKNQFDGAIATNTTLTRDG
PYRD_IDILO      LSSLKTAQLTLAKEYERYVPLVVKIAPDLEDHEVEVMAQSLLKNEMDGVIATNTTLSRDG
PYRD_LEGPA      LTQLQKEQIKLADQYGRHVPLVVKVSPDETDETLKQMTDIILQYGIEGIIATNTTCSREM
PYRD_LEGPH      LTQLQKEQIKLADQYGRHVPLVVKVSPDETDETLKQMTDIILQYGIEGIIATNTTCSREM
PYRD_LEGPL      LAQLQKEQIKLADQYGRHVPLVVKVSPDETDETLKQMTDIILQYGIEGIIATNTTCSREM
PYRD_COXBU      LTRLKEDQRRLEDQYHKRVPLFLKIAPDLTPEEIQTIATLALQHRIEGIVATNTSCSRQG
PYRD_DEIRA      VRAVLDEVEAGRVRTLRRPPVLVKLAPDLHPADFEASVGAVLDAGASGLIISNTTLSRGG
PYRD_HELPY      FCMAKEMT---------HKPLFLKIAPDLETDDMLEIVNSAIGAGAHGIIATNTTIDKSL
PYRD_HELPJ      FCMAKEMT---------HKPLFLKIAPDLEIDSMLEVVNSAIEAGANGIIATNTTIDKSL
PYRD_NOSS1      LDVLQKENNSH-------KPIFVKIAPDLEWEAIADIIGLAKTYQLAGIIATNTTIRRDG
PYRD_THEEB      LETLQSANHPR-------KPLLLKIAPDLSWEQIAAILDLVQAYELAGIVATNTTVAREG
PYRD_SYNY3      FAGLQSANHWQ-------KPLLVKISPDLSWEAIAVIIDLVKEHNLSGIVATNTSTRRSG
PYRD_SYNP6      LAALQAENTEQ-------RPLLLKIAPDLVDEEVVAIAHLAQRQQLAGIIATNTTIDKSL
PYRD_GLOVI      LARLQCANRES-------KPLLVKIAPDLGWDAVDAVVDLCGEHRLAGVIATNTTIARSG
PYRD_PROMM      VERLRRL-PGC-------PPLLVKIAPDLEDDAIDGLARLAYEEGLAGVIAVNTSLDRFG
PYRD_SYNPX      VERLRRL-PAC-------PPLLVKIAPDLEDEAIDGIARLAFEEGLAGVIAVNTSLDRLG
PYRD_COREF      LAAVQESTS---------VPVLVKIAPDLSDEDVDAVADLAVELGLAGIVATNTTISREG
PYRD_CORGL      LAAVQESTT---------VPVLVKIAPDLSDEDIDAVADLAVELKLAGIVATNTTISREG
PYRD_CORDI      IAAVQESTS---------VPVLVKIAPDLSDDDIDAVADLAVEMGIAGIVATNTTISRNG
PYRD_CORST      LEVVKKSTT---------TPVLVKIAPDLSDEDIDAVADLAVELELAGIVATNTTISRSG
PYRD_MYCBO      LSAVRAETS---------TPVLVKIAPDLSDSDLDDIADLAVELDLAGIVATNTTVSRDG
PYRD_MYCTU      LSAVRAETS---------TPVLVKIAPDLSDSDLDDIADLAVELDLAGIVATNTTVSRDG
PYRD_MYCLE      LLGVLAETS---------VPVLVKIAPDISDSEIDDITDLAVELRLAGIVATNTTVSRDC
PYRD_MYCPA      LSAVLAETS---------TPVLVKIAPDLSDSDVDDIADLAVELGLAGIVATNTTVSRDG
PYRD_NOCFA      LRTVLETVADG----GRRVPVLVKIAPDLSDEDIDAVADLAVELGLAGIVATNTTIRRDG
PYRD_STRAW      LSAVREAADRTVT--ERRVPLLVKIAPDLADDDIDAVADLAVELGLDGIIATNTTIAREG
PYRD_STRCO      LSAVREAADRAVT--ARRVPLLVKIAPDLADEDVDAVADLAVELGLDGIIATNTTIAREG
PYRD_LEIXX      LSAVKAASGKK--------PLLVKIAPDLTDEQIVAVARLAVELGLAGIIATNTTIARDG
PYRD_THET2      LARLRPATP---------KPLLLKVAPDLSPKALDEVLALTKKHRLQGLVAVNTTLAREG
PYRD_THET8      LARLRPATK---------KPLLLKVAPDLSPKALDEVLALAKKHRLQGLVAVNTTLAREG
PYRD_HALMA      LSELQDAGA---------APLLVKLSPDLPEPAVEDALDLVTELDLDGVVATNTTTERPA
                .                  *: :*::**                   . :  **:  :  

PYRD_PSEAE      VEGLPHG-------DEAGGLSGAPVREKSTHTVKVLAGELGGRLPIIAAGGITEGAHAAE
PYRD_PSEPK      VEALPYG-------GEAGGLSGAPVLEKSTHIVKVLAGELGGKLPIIAAGGITEGRHAAE
PYRD_PSESM      VEGLPHG-------DEAGGLSGAPVREKSTHIVKVLAGELAGRMPIIAAGGITEGRHAAE
PYRD_METCA      VEGLEHA-------DEAGGLSGKPLFLRSTEVVARLADALQGRAPIIACGGVFSGADAVA
PYRD_AROAE      VQGVRYA-------EQQGGLSGAPVFEASTAVVAQLSRALAGELPIIAAGGILDGRGARA
PYRD_NITEU      VEHLPRG-------NEKGGLSGAPLTERSTTVIRQLANHLQHAIPIIGAGGIMSARDAQL
PYRD_ACIAD      VENLPFG-------NEAGGLSGAPVFEKSTECLRSFAKVLNDQIPLIGVGGITQGEHAVA
PYRD_BORBR      VQGLPHA-------EEAGGVSGAPVHELSLRVIERLRSRLGDAVAIIGVGGILSGRQASE
PYRD_BORPE      VQGLPHA-------EEAGGVSGAPVHELSLRVIERLRSRLGDAVAIIGVGGILSGRQASE
PYRD_BORPA      VQGLPHA-------EEAGGVSGAPVHELSLRVIERLRSRLGDAVAIIGVGGILSGRQASE
PYRD_RALSO      VAGLPHA-------EEAGGLSGQPVREGSTRVIRALCGLLGDAVPIIGVGGILAGEHARE
PYRD_BURMA      VKGLPHA-------DEAGGLSGRPVFDASNAVIRKLRAELGDAVPIIGVGGIFSGEDARA
PYRD_BURPS      VKGLPHA-------DEAGGLSGRPVFDASNAVIRKLRAELGDAVPIIGVGGIFSGEDARA
PYRD_CHRVO      VAGHPLE-------SEAGGLSGAPVRARSTEVIRKLHKELGGAMPIIGVGGILSGNDAVE
PYRD_NEIMA      LGSHPLA-------GEQGGLSGLPVHEKSNRVLKLLADHIDGKLPIIGVGGIMEGGDAAD
PYRD_NEIMB      LGSHPLA-------GEQGGLSGLPVHEKSNRVLKLLADHIDGKLPIIGVGGIMEGEDSAD
PYRD_NEIG1      LGSHPLA-------GEQGGLSGFPVREKSNRVLKKLAEHIDGALPIIGVGGIMEGGDAAE
PYRD_FLALU      MENHPLA-------SEAGGLSGAPVMARSTAVLRRLRTRLPESIPLIGVGGICSGADAAA
PYRD_XANAC      VANHPLA-------AEAGGLSGAPLLGQSTLVLRRLRARLPESIPLIGVGGINSGADAVA
PYRD_BUCAI      LFGLKNS-------SEQGGLSGLPLQKKSTNTISILSKSLQKKIPIIGVGGINSINSAKE
PYRD_BUCAP      IPKIKNN-------KEEGGLSGLPLQKKSNDVISILYKNLKRKIPIIGVGGINSINSARE
PYRD_HAEIN      VTGMKNA-------EQQGGLSGKPLQHKSTEIIKRLHQELKGQIPIIGSGGIDGLQNAQE
PYRD_MANSM      VAGMKNA-------DQTGGLSGKPLQHKSTEIIRRLQQELKGEIPIIGSGGIDGVQNAQE
PYRD_PASMU      VSGLQNA-------EQQGGLSGKPLQQKSTEIIARLHQELKGQIPIIGSGGIDSVANAQE
PYRD_HAEDU      IAGFNHA-------HQQGGLSGKPLHTLSTKLISTLAKELKGKIPIIGSGGVHSIDSGQQ
PYRD_ECOLI      VQGMKNC-------DQTGGLSGRPLQLKSTEIIRRLSLELNGRLPIIGVGGIDSVIAARE
PYRD_ECO57      VQGMKNC-------DQTGGLSGRPLQLKSTEIIRRLSLELNGRLPIIGVGGIDSVIAARE
PYRD_ECOL6      VQGMKNC-------DQTGGLSGRPLQLKSTEIIRRLSQELNGRLPIIGVGGIDSVIAARE
PYRD_SALPA      VQGMKNC-------QQTGGLSGRPLQLKSTEIIRRLSQELKGQLPIIGVGGIDSVIAARE
PYRD_SALTY      VQGMKNC-------QQTGGLSGRPLQLKSTEIIRRLSQELKGQLPIIGVGGIDSVIAARE
PYRD_SALCH      VQGMKNC-------QQTGGLSGRPLQLKSTEIIRRLSQELKGQLPIIGVGGIDSVIAARE
PYRD_SALTI      VQGMKNC-------QQTGGLSGRPLQLKSTEIIRRLSLELKGQLPIIGVGGIDSVIAARE
PYRD_PECAS      IQGLNHC-------GQTGGLSGRPLQTSSTEIIRRLSQELAGRLPIIGVGGIDSLVAARE
PYRD_PHOLL      VEGLNYC-------QQAGGLSGRPVQLRSTEVIRQLSQELRDKIPIIGVGGIDSLTAARE
PYRD_VIBVU      VEGMKHA-------QEAGGLSGRPLQSRSTEVVRLLRKELQGNIPIIGVGGVDSYVAAKE
PYRD_VIBVY      VEGMKYA-------QEAGGLSGRPLQSRSTEVVRLLRKELQGNIPIIGVGGVDSYVAAKE
PYRD_VIBPA      VEGMKHA-------NEAGGLSGRPVQSRSTEVVRKLHEALGDKLPIIGVGGIDSYVAAKE
PYRD_VIBCH      VEGMKFA-------NEAGGLSGRPLQNRSTEVIKCLYKELGEEIPIIGVGGIDSYISAKE
PYRD_ALIF1      VEGMKHA-------EEMGGLSGRPVQTRSTEVVRRLKELLGDNLPIIGVGGIDSYVAAKE
PYRD_PHOPR      VKGMPHC-------DEMGGLSGRPLQNRSTEVIRRLAEELNGALPIIGVGGIDSAISARE
PYRD_SHEON      VSGLANA-------NESGGLSGKPLTELSTKVIKQLATCLQGQIPIIGVGGINSAEDALA
PYRD_IDILO      LQSSQ-A-------GEAGGLSGKPLQDKSTRVIELLCKTLQRKIPVIGVGGIDSVESAEA
PYRD_LEGPA      VKNLPCS-------EEQGGLSGRPLMELSTRCLRLLKQYVGNDVTLIGVGGIDSLESAKD
PYRD_LEGPH      VKNLPCS-------EEQGGLSGRPLMELSTRCLRLLKQYVGNDVTLIGVGGIDSLESAKD
PYRD_LEGPL      VKNLPCS-------EEQGGLSGRPLMELSTRCLRLLKQYVGNDVTLIGVGGIDSLESAKD
PYRD_COXBU      TEKLPNA-------NEAGGLSGKPLFPMTLQVVKQLHSFLGDEIPIVAVGGIFSGENAQT
PYRD_DEIRA      L-SHPNR-------EQAGGLSGRPLTDRSTELVRDAYRLTRGQVPIVGVGGVFSAEDAYA
PYRD_HELPY      VFAPK----------EMGGLSGKCLTKKSREIFKELAKAFFNKSVLVSVGGISDAKEAYE
PYRD_HELPJ      VFAPK----------EMGGLSGKCLTKKSREIFKELAKAFFNKSVLVSVGGISDAKEAYE
PYRD_NOSS1      LKTQVIEQTGKAPQEEAGGISGAPVRDRSTEIIRFIWQQTQGEIPIIGVGGIFTPEDAWA
PYRD_THEEB      LKSQTIPQTGRSPAEEAGGLSGAPLRQRATAVIRFIHEQTQGTLPIIGVGGIFTPEDVIE
PYRD_SYNY3      LKTKILPQTGQPIEQEAGGLSGQPIRDRATEVIRYIYQQTGGTIPIIGVGGIFTAEDAWE
PYRD_SYNP6      LSVEHLPGRREPLATEAGGISGAPLRSRSTEVIRLLHRTTQGQLPIIGVGGIFSAEDAWQ
PYRD_GLOVI      LRSDLQ---------ETGGLSGAPLRNRSTEVIGHIWGRTRGQLPIVGVGGIFSGEDAWE
PYRD_PROMM      LDGRVLPKTGRTLAEEAGGLSGAPLRQRALEVLRRLRATAGPALPLIGVGGIDSPEAAWE
PYRD_SYNPX      LEQRRLLQTGRTLAEEAGGLSGAPLRQRALEVIRRLRASAGPALTLIGVGGIDSAEIAWE
PYRD_COREF      LVTPAHE----VAEMGAGGISGPPVAERALEVLRRLHARVGDQLVLIGVGGISTPEQAWE
PYRD_CORGL      LNTPSGE----VEAMGAGGISGAPVAARSLEVLKRLYARVGKEMVLISVGGISTPEQAWE
PYRD_CORDI      LRTPHQD----VADMGAGGISGAPVAQRSLEVLERLYAHVGTEMVLIGVGGISTPQQAWE
PYRD_CORST      LKTPASK----VEKMGAGGISGAPLENRSLEVLKRLHERVGDKLVLVSVGGISTPEQAWE
PYRD_MYCBO      LTT--PG----VDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDAWE
PYRD_MYCTU      LTT--PG----VDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDAWE
PYRD_MYCLE      LVT--PG----IDALGAGGISGPPVARRAVEVLRRLYGRVGDRLVLISVGGIETADDAWD
PYRD_MYCPA      LRT--AG----VDQLGAGGISGPPVARRAVEVLRRLYGRVGDRLVLISVGGIETADHAWE
PYRD_NOCFA      LHTDPED----VAAMGAGGLSGAPVADRSLEVLRRLYRRVGDRLALISVGGIETPEQAYQ
PYRD_STRAW      LGLKSEP----TLVKETGGLSGAPLKARSLEVLSRLYARVGDRITLVGVGGIENAEDAWQ
PYRD_STRCO      LGLTSSP----ALVGETGGLSGAPLKARSLEVLRRLYARVGDRITLVGVGGVETAEDAWE
PYRD_LEIXX      LSSDPAV----VEAAGAGGLSGAPLAARSLEVLTLIRANVPPSLCVISVGGVETAQDVQR
PYRD_THET2      LKSP--------LAREAGGLSGRPLKRRALEVLRHL-AEGAEGLALVSVGGVETPLDLWE
PYRD_THET8      LKSP--------WAKEAGGLSGRPLKGRALEVLRHL-AEGAEGLALVSVGGVETPLDLWE
PYRD_HALMA      SLRSPNA-------VETGGLSGKPIENQATEMVRFVAERVD--VPVVGVGGVSTAEGAYR
                                 **:**  :   :   .            ::. **:        

PYRD_PSEAE      KIAAGASLVQIYSGFIYKGPALIREAVDAIAALPRRN-----------------------
PYRD_PSEPK      KIAAGASLVQIYSGFIYKGPALIREAVDAIAAMPR-------------------------
PYRD_PSESM      KIAAGASLVQIYSGFIYKGPALIRQSVDAIAAMPRTAS----------------------
PYRD_METCA      KFEAGASLVQVYTGFIYRGPALLAEIGRVVAAL---------------------------
PYRD_AROAE      KLAAGASLVQVYSGLIYRGPSLIAECVRATTDFADSGHAATSASFGA-------------
PYRD_NITEU      KIEAGASLVQIYSGLIYRGPDLVTKTVSLLCSRTTHAG----------------------
PYRD_ACIAD      KKDAGASLVQIYSGLIYTGPDLIKECVSAIT-----------------------------
PYRD_BORBR      KMAAGAQAVQLYTGLIYRGPALVGECVRALAQGSR-------------------------
PYRD_BORPE      KMAAGAQAVQLYTGLIYRGPALVGECVRALAQGSR-------------------------
PYRD_BORPA      KMAAGAQAVQLYTGLIYRGPALVGECVRALAQGSR-------------------------
PYRD_RALSO      KIDAGAQLVQLYTGLIYRGPGLVAECARALAR----------------------------
PYRD_BURMA      KLAAGAALVQLYTGFIYRGPALVAECVKAIARGEAR------------------------
PYRD_BURPS      KLAAGAALVQLYTGFIYRGPALVAECVKAIARG---------------------------
PYRD_CHRVO      KLDAGASLVQLYSGLIYRGPELVGECARATAQYLQARN----------------------
PYRD_NEIMA      KIRLGATAVQVYSGLIYKGPALVKECLKALAR----------------------------
PYRD_NEIMB      KIRLGATAVQVYSGLIYKGPALVKECLKALAR----------------------------
PYRD_NEIG1      KIRLGTTAVQVYSGLIYKGPALVKECLKALAR----------------------------
PYRD_FLALU      KMSAGATMVQLYSGLVYRGPALVGECVESIRRRREAPSSGVAHL----------------
PYRD_XANAC      KMAAGASLVQCYSGLVYRGPQLIGECVNAIRRRREAPSGGAVSPL---------------
PYRD_BUCAI      KIESGATLIQIYSGLVYHGPKLIKKIINHI------------------------------
PYRD_BUCAP      KIMCGANLIQVYSGLIYHGPNFIREIIRNL------------------------------
PYRD_HAEIN      KIEAGAELLQVYSGLIYHGPKLVKELVKNIK-----------------------------
PYRD_MANSM      KIVAGAELLQVYSGLIYHGPGLVKALVEAIR-----------------------------
PYRD_PASMU      KIKAGAELLQLYSGLIYHGPHLIKQLVQQIK-----------------------------
PYRD_HAEDU      KIDAGAHLLQLYSAMIYQGPTLIQELAKKIILR---------------------------
PYRD_ECOLI      KIAAGASLVQIYSGFIFKGPPLIKEIVTHI------------------------------
PYRD_ECO57      KIAAGASLVQIYSGFIFKGPPLIKEIVTHI------------------------------
PYRD_ECOL6      KIAAGASLVQIYSGFIFKGPPLIKEIVTHI------------------------------
PYRD_SALPA      KIAAGATLVQIYSGFIFKGPPLIKEIVTHI------------------------------
PYRD_SALTY      KIAAGATLVQIYSGFIFKGPPLIKEIVTHI------------------------------
PYRD_SALCH      KIAAGATLVQIYSGFIFKGPPLIKEIVTHI------------------------------
PYRD_SALTI      KIAAGATLVQIYSGFIFKGPPLIKEIVTHI------------------------------
PYRD_PECAS      KMDAGASLVQIYSGFIFHGPRLIKDIVTHI------------------------------
PYRD_PHOLL      KIAAGASLIQIFSGFIYHGPKLIKDIVNHI------------------------------
PYRD_VIBVU      KMLAGADLVQVYSGFIYHGPGLVRDIVKNL------------------------------
PYRD_VIBVY      KMLAGADLVQVYSGFIYHGPGLVRDIVKNL------------------------------
PYRD_VIBPA      KMMAGAQLVQVYTGFIYHGPGLVRDIVKNL------------------------------
PYRD_VIBCH      KLLAGAKLVQVYSGFIYQGPGLVADIVKNL------------------------------
PYRD_ALIF1      KMVAGAELVQVYSGFIYKGPGLVRDIVNNI------------------------------
PYRD_PHOPR      KMNAGAQLVQIYSGFIYHGPKLVKDIVMNS------------------------------
PYRD_SHEON      KFDAGATMVQIYSGFIYQGPKLIKEIVEAYRLK---------------------------
PYRD_IDILO      KLKAGASLVQVYTGFIYQGPGLIRSIVSHL------------------------------
PYRD_LEGPA      KINAGASLLQVYSGLVYKGPELIHDIVSGLNAI---------------------------
PYRD_LEGPH      KINAGASLLQVYSGLVYKGPELIHDIVSGLNAI---------------------------
PYRD_LEGPL      KINAGASLLQVYSGLVYKGPELIHDIVSGLNAV---------------------------
PYRD_COXBU      LINAGARLVQLYTGLIYEGPELVKNIVEFLTLSRQTREGIN-------------------
PYRD_DEIRA      KLLAGADLVEVYSALIYRGPGLVREINAGLVKLLERDGVRNIADVVGQG-----------
PYRD_HELPY      RIKMGASLLQIYSAFIYNGPNLCQNILKDLVKLLQKDGFLSVKEAIGADLR---------
PYRD_HELPJ      RIKMGASLLQIYSAFIYKGPNLCQNILKDLVKLLQKDGFLSVKEAIGADLR---------
PYRD_NOSS1      KITAGASLIQVYTGWIYQGPMMVSQILTGLLSKLEEHELNSISEAIGLEFKS--------
PYRD_THEEB      KLAAGATLVQLYTGWIYQGPSLLRELLKGLLAAADQETPEK-------------------
PYRD_SYNY3      KIQAGASFLQIYTGWIYGGPWVVSDILQGLGEKLAAGGFSHISEAVGIDTIGKAPE----
PYRD_SYNP6      KIVAGASLVQVYTGWVYEGPLLVKTIQQGLLERLDSAGLPNLAAAVGSAAIDS-------
PYRD_GLOVI      KIAHGASLLQVYTGWIYEGPWMVRRILASLATRLERSGFEHLQQATGCAFS---------
PYRD_PROMM      RISAGASLVQLYTGWIFKGPDLVPNILDGLIGQLDRHGFRHVSEAVGSGVPWQ-------
PYRD_SYNPX      RITAGASLIQLYTGWIFQGPELVPRILEGLQLQLDRHGLRSIAEAVGSGLPWLPGSEDAE
PYRD_COREF      RIAAGATLLQGYTGFIYGGPDWIRDIHLGLAEQVKAHGLSNISEAVGSGLPWKDSAV---
PYRD_CORGL      RITSGATLLQGYTPFIYGGPDWIRDIHLGIAKQLKAHGLRNIADAVGSELEWKN------
PYRD_CORDI      RIAAGATLLQGYTGMIYGGPDWIRDIHLGIAAQLRAHDLSSIDQAVGSKLPWTLQ-----
PYRD_CORST      RITAGASLLQGYTPFIYGGLGWIRGIHRGIAAQIKAHGLDSIEQAVGSGLEWKAL-----
PYRD_MYCBO      RITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARRRQPS-----
PYRD_MYCTU      RITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARRRQPS-----
PYRD_MYCLE      RITAGASLLQGYTGFIYGGGFWPKHIHDGIARRLHDGGFASLRDAVGSATAKSE------
PYRD_MYCPA      RITAGASLLQGYTGFVYGGGLWAKQIHDGIAQRLRDGGFASLRDAVGSSARESG------
PYRD_NOCFA      RVLAGASLLQGYTGFIYGGPFWTRKIHRGLAELLRRDGYTSLTEAVGAEHRGPRPQADTA
PYRD_STRAW      RILAGATLVQGYSAFIYEGPFWGRAIHKGLAARLRTSPYATLADAVGADVRKSA------
PYRD_STRCO      RILAGATLVQGYSAFIYEGPFWGRAMHKGLAARLRQSPYATLADAVGADVRKHS------
PYRD_LEIXX      RLDAGATLVQGYTAFLYRGPLWARQITRGLSALRSR------------------------
PYRD_THET2      RLKAGASLVQVYTGFVYGGPLFPRRLLLGLLRLMEAEGVSSLGELRRA------------
PYRD_THET8      RLKAGASLVQVYTGFVYGGPLFPRRLLLGLLRLMEAEGVSSLGELRRA------------
PYRD_HALMA      KIRAGASLVQLYTGLVYRGPSIAREINSGLRDLLAEDGFDSVEDAVGADL----------
                    *:  :: ::  :: *                                         

PYRD_PSEAE      -
PYRD_PSEPK      -
PYRD_PSESM      -
PYRD_METCA      -
PYRD_AROAE      -
PYRD_NITEU      -
PYRD_ACIAD      -
PYRD_BORBR      -
PYRD_BORPE      -
PYRD_BORPA      -
PYRD_RALSO      -
PYRD_BURMA      -
PYRD_BURPS      -
PYRD_CHRVO      -
PYRD_NEIMA      -
PYRD_NEIMB      -
PYRD_NEIG1      -
PYRD_FLALU      -
PYRD_XANAC      -
PYRD_BUCAI      -
PYRD_BUCAP      -
PYRD_HAEIN      -
PYRD_MANSM      -
PYRD_PASMU      -
PYRD_HAEDU      -
PYRD_ECOLI      -
PYRD_ECO57      -
PYRD_ECOL6      -
PYRD_SALPA      -
PYRD_SALTY      -
PYRD_SALCH      -
PYRD_SALTI      -
PYRD_PECAS      -
PYRD_PHOLL      -
PYRD_VIBVU      -
PYRD_VIBVY      -
PYRD_VIBPA      -
PYRD_VIBCH      -
PYRD_ALIF1      -
PYRD_PHOPR      -
PYRD_SHEON      -
PYRD_IDILO      -
PYRD_LEGPA      -
PYRD_LEGPH      -
PYRD_LEGPL      -
PYRD_COXBU      -
PYRD_DEIRA      -
PYRD_HELPY      -
PYRD_HELPJ      -
PYRD_NOSS1      -
PYRD_THEEB      -
PYRD_SYNY3      -
PYRD_SYNP6      -
PYRD_GLOVI      -
PYRD_PROMM      -
PYRD_SYNPX      G
PYRD_COREF      -
PYRD_CORGL      -
PYRD_CORDI      -
PYRD_CORST      -
PYRD_MYCBO      -
PYRD_MYCTU      -
PYRD_MYCLE      -
PYRD_MYCPA      -
PYRD_NOCFA      -
PYRD_STRAW      -
PYRD_STRCO      -
PYRD_LEIXX      -
PYRD_THET2      -
PYRD_THET8      -
PYRD_HALMA      -