CLUSTAL format seed alignment for MF_00228

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

THIM_GEOTN       ----------------------------------------MGNWHEWAELLERVRGTKPL
THIM_GEOKA       ----------------------------------------MANWHEWAELLERVREENPL
THIM_GEOSW       -----------------------------------------MNNQEAINALQMVRQANPL
THIM_BACC4       -----------------------------------------MNLKEFSKVVDLVRESNPL
THIM_BACCR       -----------------------------------------MNMKEISKVVDLVRESNPL
THIM_BACC2       -----------------------------------------MNMKEISKVVDLVRESNPL
THIM_BACCQ       -----------------------------------------MNRKEISKVVDLVRESNPL
THIM_BACC7       -----------------------------------------MNRKEISKVVDLVRESNPL
THIM_BACC1       -----------------------------------------MNMKEISKVVDLVRESNPL
THIM_BACAH       -----------------------------------------MNMKEISKVVDLVRESNPL
THIM_BACC3       -----------------------------------------MNMKEISKVVDLVRESNPL
THIM_BACAA       -----------------------------------------MNTKEISKVVDLVRESNPL
THIM_BACC0       -----------------------------------------MNTKEISKVVDLVRESNPL
THIM_BACAN       -----------------------------------------MNTKEISKVVDLVRESNPL
THIM_BACAC       -----------------------------------------MNTKEISKVVDLVRESNPL
THIM_BACHK       -----------------------------------------MNTKEISKVVDLVRESNPL
THIM_BACCZ       -----------------------------------------MNTKEISKVVDLVRESNPL
THIM_BACMK       -----------------------------------------MNMKEISKVVDLVRESNPL
THIM_BACCN       -----------------------------------------MHITEIAKVVEQVRKTNPL
THIM_BREBN       -----------------------------------------MILETIGQLLIKVREENPL
THIM_BACSU       -----------------------------------------MDAQSAAKCLTAVRRHSPL
THIM_BACVZ       -----------------------------------------MDAQTAAQHLSKVRDQNPL
THIM_BACLD       -----------------------------------------MNMEDAARGIELVRKQKPL
THIM_BACP2       -----------------------------------------MKTSIASHLLEKVRAENPL
THIM_ANOFW       -------------------------------------------MMNVGQWLTRVRKESPL
THIM_BACHD       ------------------------------------------------MSIEMLRKSNPL
THIM_BACSK       --------------------------------------------------MELVRQNNPL
THIM_LISMC       --------------------------------------------MFDFMTLEKVWEKGPL
THIM_LISMF       --------------------------------------------MFDFMTLEKVWEKGPL
THIM_LISIN       --------------------------------------------MFDFMMLEKVREKGPL
THIM_LISMO       --------------------------------------------MFDFMTLEKVREKGPL
THIM_LISMH       --------------------------------------------MFDFMTLEKVREKGPL
THIM_LISW6       --------------------------------------------MFDFMTLEKVQERGPL
THIM_HAEIN       -------------------------------------------MLMQSIYLSKIREQNPL
THIM_HAEI8       -------------------------------------------MLMQSIYLSKIREQNPL
THIM_HAEIG       ---------------------------------------------MQSIYLSKIREQNPL
THIM_HAEIE       ---------------------------------------------MQSIYLAKIREQNPL
THIM_HAES1       ---------------------------------------------MNSQFLTKLRQRNPL
THIM_PASMU       --------------------------------------------MLNPTYLQQIRSQNPL
THIM_HAEPS       -------------------------------------------MNPKIIFLDAVREHNPL
THIM_ACTSZ       ---------------------------------------------MQFRYLSLVRQQAPL
THIM_EXISA       ---------------------------------------------MRHEIWNEIRQQAPL
THIM_LYSSC       ------------------------------------------------MIFQTIRQQQPL
THIM_STAEQ       -----------------------------------------------MNNLERLRSENPL
THIM_STAES       -----------------------------------------------MNNLERLRSENPL
THIM_STAHJ       -----------------------------------------------MNNLERLRQENPL
THIM_STAA3       -----------------------------------------------MNYLNKIRIENPL
THIM_STAAE       -----------------------------------------------MNYLNKIRIENPL
THIM_STAA8       -----------------------------------------------MNYLNKIRIENPL
THIM_STAAC       -----------------------------------------------MNYLNKIRIENPL
THIM_STAAW       -----------------------------------------------MNYLNKIRIENPL
THIM_STAAS       -----------------------------------------------MNYLNKIRIENPL
THIM_STAAM       -----------------------------------------------MNYLNKIRIENPL
THIM_STAA9       -----------------------------------------------MNYLNKIRIENPL
THIM_STAAN       -----------------------------------------------MNYLNKIRIENPL
THIM_STAA2       -----------------------------------------------MNYLNKIRIENPL
THIM_STAA1       -----------------------------------------------MNYLNKIRIENPL
THIM_STAAR       -----------------------------------------------MNYLNNIRIENPL
THIM_STAAB       -----------------------------------------------MNYLNKIRIENPL
THIM_STAS1       -----------------------------------------------MNSLNNLRTNNPL
THIM_STACT       ----------------------------------------------MNKILDQIRTEHPL
THIM_MACCJ       -----------------------------------------------MVKLNQLRKDNPL
THIM1_STRPS      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRPJ      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRP2      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRR6      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRP4      -----------------------------------------------MTSLKLLKKKAPL
THIM1_STRP7      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRZP      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRZT      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRPI      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRZJ      -----------------------------------------------MTSLKLLKEKAPL
THIM1_STRPN      -----------------------------------------------MTSLKLLKEKAPL
THIM_STRSY       ------------------------------------------------MYLEKLRSQNPL
THIM_STRS2       ------------------------------------------------MYLEKLRSQNPL
THIM_STRA1       ------------------------------------------------MYLEQLKEVNPL
THIM_STRA5       ------------------------------------------------MYLEQLKEVNPL
THIM_STRA3       ------------------------------------------------MYLEQLKEVNPL
THIM_HELPG       ------------------------------------------------MVLKELRQKRPL
THIM_HELPY       -------------------------------------------------MLKELRQKRPL
THIM_HELPH       ------------------------------------------------MVLKELRQKRPL
THIM_HELPS       -------------------------------------------------MLKELRQKRPL
THIM_HELPJ       -------------------------------------------------MLKELRQKRPL
THIM1_OCEIH      ---------------------------------------------MQVDIIKQVRDTKPL
THIM_CARHZ       ------------------------------------------MLNTLWEIREKVRDLSPL
THIM_DESRM       ----------------------------------------MQEVQRLWDIRQEVRIKKPL
THIM2_OCEIH      ------------------------------------------MVDAIAKIKQD----KPF
THIM_DESVV       ---------------------MFSTGTVWKNV-------------------AAVRQRAPI
THIM_DESVH       ---------------------MFSTGTVWKNV-------------------AAVRQRAPI
THIM_DESVM       ---------------------MPHTEHIWRNV-------------------DAVRRQAPL
THIM_DESAG       ---------------------MSEHSFVWDAV-------------------QRVRTGAPL
THIM_DESMR       ---------------------MPFAAAVFADL-------------------ARIRQNAPL
THIM_LEPBA       -------------------MSQHILKNTIEDL-------------------ELVRSKSPL
THIM_LEPBP       -------------------MSQHILKNTIEDL-------------------ELVRSKSPL
THIM_SYNAS       --------------------MQITPENTWAAV-------------------KAIRSRAPL
THIM_CHLT3       --------------------MEINATTLWRDI-------------------LAVRTKAPL
THIM_RHOFT       ------------------MAAKLSFSDLWSDV-------------------CAVRDRSPL
THIM_LEPCP       ----------------MSLAAPLTAADLWADV-------------------LAVRAQSPL
THIM_VIBPA       ----------------------MLIEQITQAL-------------------TAVRQQKPL
THIM_VIBCB       ----------------------MLIEQITQAL-------------------TAVRQQKPL
THIM_VIBA3       ----------------------MLTEQIIQSL-------------------RAVREQKPL
THIM_ALIF1       -------------------MTIMNIQYIVECL-------------------ALLREKKPL
THIM_ALIFM       ----------------------MNIQYIVECL-------------------ALLREKKPL
THIM_ALISL       ----------------------MNTQEIIEAL-------------------AMLREKKPL
THIM_PSYIN       ----------------MKKNIDSNIKTIVSAL-------------------KTLREQKPL
THIM_PHOPR       ----------------MKKCDLDYTQSICDAL-------------------NTLRQQKPL
THIM_BRAHW       --------------------MSTLQEEIFNSI-------------------KEMKSKSPL
THIM_DESAH       MDNEGNNPTLSFVNGNSMIEHQTLVHGIFELC-------------------ARIRDQKPL
THIM_CHLFF       -----------------------MLEQMHEAL-------------------QRLRQEQPV
THIM_CHLCV       -----------------------MLEQMYEAL-------------------QRLRKEKPV
THIM_CHLAB       -----------------------MLERMQEAL-------------------QRLRKERPV
THIM_HERA2       ---------------------MLTPSSIADCW-------------------HSLRQQRPL
THIM_SHIB3       -----------------MQVDLLSSAQSAHTL-------------------HLFHQHSPL
THIM_ECOSM       -----------------MQVDLLSSAQSAHAL-------------------HLFHKHSPL
THIM_ECOLU       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECO45       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECOK1       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECOUT       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECOL6       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECO7I       -----------------MQVDLLSSAQSAHAL-------------------HLFHKHSPL
THIM_ECO81       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECO27       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECOL5       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_SHIBS       -----------------MQVDLQSSAQSAHAL-------------------HLFHQHSPL
THIM_ECO24       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECO55       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECOSE       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECO8A       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_SHISS       -----------------MQVDLLGSAQSAHAL-------------------HLFHQHSPL
THIM_ECODH       -----------------MQVDLLGSAQSAHAL-------------------HLFHQHSPL
THIM_ECOLI       -----------------MQVDLLGSAQSAHAL-------------------HLFHQHSPL
THIM_ECOHS       -----------------MQVDLLGSAQSAHAL-------------------HLFHQHSPL
THIM_ECOLC       -----------------MQVDLLGSAQSAHAL-------------------HLFHQHSPL
THIM_ECOBW       -----------------MQVDLLGSAQSAHAL-------------------HLFHQHSPL
THIM_SHIFL       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_SHIF8       -----------------MQVDLLSSAQSAHAL-------------------HLFHQHSPL
THIM_ECO57       -----------------MQVDLLSSAQSAHTL-------------------HLFHQHSPL
THIM_ECO5E       -----------------MQVDLLSSAQSAHTL-------------------HLFHQHSPL
THIM_SHIDS       -----------------MQVDLLSSAQSAHTL-------------------HLFHQHSPL
THIM_ESCF3       -----------------MQPDLLSRKTAALTL-------------------QKFHTLSPL
THIM_SALPA       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALPK       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALAR       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALEP       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALTY       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALG2       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALDC       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALNS       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALHS       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALA4       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALPB       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALTI       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALCH       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALPC       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_SALSV       -----------------MQPDLHCRTLAAHTL-------------------KHFRALSPL
THIM_CITK8       -----------------MQPDLHSRALAAHTL-------------------QQFRILSPL
THIM_ENT38       -----------------MQPD----RLDLHAL-------------------HHFRTRSPL
THIM_KLEP3       ------------------MPELLNPAPVAHLR-------------------HLLRAHSPL
THIM_KLEP7       ------------------MPELLNPAPVAHLR-------------------HLLRAHSPL
THIM_CROS8       -----------------MSSDLLCGSHAAPVV-------------------TQLRRHAPL
THIM_SERP5       ---------------MLARPDVFPGARAAACL-------------------TQFKRQSPL
THIM_YERE8       ------------------MMDLFPDALASACL-------------------QQFRATPPL
THIM_PECAS       ---------------MNTQPADFSAAQAATSL-------------------TQFRSAAPL
THIM_PECCP       ---------------MNTRPADFSAVQAATSL-------------------TQFRSASPL
THIM_TOLAT       ------------------MPQALPATIVATHL-------------------ERIRRSVPL
THIM_LARHH       ------------------MSDLLPLPPAAIRLP------------------DLVRQHPPL
THIM_LEPIN       ----------------MSKTTIIERIWPAKEIIEDL---------------SELRKQSPL
THIM_LEPIC       ----------------MSKTTIIERIWPAKEIIEDL---------------SELRKQSPL
THIM_LEPBJ       ----------------MPKHSALERAWPAKEIVEDL---------------LELRKRSPL
THIM_LEPBL       ----------------MPKHSALERAWPAKEIVEDL---------------LELRKRSPL
THIM_CLAM3       --------------MSAARPSAHETTGTGTASADLL---------------LLLRERQPL
THIM_CLAMS       --------------MSALRPSTGTITRGTPTSADLL---------------LQLRERQPL
THIM_CORGB       ---------------------------MANSFLDSL---------------TLVRQNTPL
THIM_CORGL       ---------------------------MANSFLDSL---------------TLVRQNTPL
THIM_COREF       ---------------------------MADSYLHAP---------------TLVRATTPL
THIM_CUTAK       ----------------MPAKGVVDMTELSNLVAESL---------------ERLRRDKPL
THIM_KINRD       ------------------MSAVAPHPVPAPALAAAR---------------AALTERAPL
THIM_RHOE4       ----------------------MSDTVSVETVASAI---------------DALRDQVPL
THIM_BURP0       -----------------MESISWNTPSVRDAL-------------------AAVKRDAPF
THIM_BURTA       -----------------MESINWNTRSVREEL-------------------AAVKRAAPF
THIM_BURP6       -----------------MESISWNTPSVRDAL-------------------AAVKRDAPF
THIM_BURPS       -----------------MESISWNTPSVRDAL-------------------AAVKRDAPF
THIM_BURP1       -----------------MESISWNTPSVRDAL-------------------AAVKRDAPF
THIM_GRABC       -----------------MTEEPLSAAWLTERTIYLL---------------TLLREKRPL
THIM_AKKM8       ---------------------MLSSTDLVQAVTADL---------------GKIRETAPL
THIM_RHOSK       ------------------------MDGCGTYL-------------------DTMRREAPL
THIM_RHOS4       ------------------------MDGCGTYL-------------------DTMRREAPL
THIM_RHOS1       ------------------------MDGCGTYL-------------------DTMRREAPL
THIM_RHOS5       ------------------------MDRCGAYL-------------------DTMRSTAPL
THIM_RHIL3       ---------------------MQTRTTPGAML-------------------KAMREKPPL
THIM_RHILW       ---------------------MQSRTTPGAML-------------------TAMREKPPL
THIM_RHIE6       ------------------------------ML-------------------EAMREKPPL
THIM_RHIEC       ------------------------------ML-------------------DAMREKPPL
THIM_AGRRK       --------------------MQNPTTTPGSLL-------------------TAMRANPPL
THIM_ROSDO       -------------------------MAPHDLL-------------------TALRDQNPL
THIM_GEMAT       -----------MDAPSSASGPTQPRLSPADAL-------------------AALRASAPL
THIM_PSYWF       ----------------------MQLSFIESCF-------------------HAFKDQSAL
THIM_BIFLO       ----------------MSNSASSFTGVSSGYTAGTPVPADSPIRDNIADAVRRVRETTPL
THIM_BIFLD       ----------------MSNSASSFTGVSSGYTAGTPVPADSPIRDNIADAVRRVRETTPL
THIM_BIFLS       ----------------MSNSASSFADVSSGCTAGTPVPADSPIRDNIADAVRRVRETTPL
THIM_BIFAA       ----------------MSDDPSTNDALGT-------------LRAAIKQAVTDVRGQTPL
THIM_BIFA0       ----------------MTTASTTPNSDTSNLHEVAP---DDPIRERIRQAAQNVREQTPL
THIM_DICNV       ----------------MTESLEMGKSIDFNVQTFDF--------KSAQFYLDRAYANAPF
THIM_ACIBY       -----------------MNSTSNLIEQVIEAW-------------------QNMQAKTPL
THIM_ACIB3       -----------------MNSTSNLIEQVIEAW-------------------QNMQAKTPL
THIM_ACIB5       -----------------MNSTSNLIEQVIEAW-------------------QNMQAKTPL
THIM_ACIBT       -----------------MTSTSNLIEQVIEAW-------------------QNMQAKTPL
THIM_ACIBS       -----------------MTSTSNLIEQVIEAW-------------------QNMQAKTPL
THIM_ACIBC       -----------------MTSTSNLIEQVIEAW-------------------QNMQAKTPL
THIM_ACIAD       -----------------MYNSSNIIDYVIDAW-------------------EKLQEQAPL
THIM_LACCB       ---------------MSKVITDVFYTAFKTAL---------------------PLTSSPL
THIM_LACP3       ---------------MSKAITDVFYTAFKTAL---------------------PLTSSPL
THIM_ENTFA       ---------------MKTSVK------FETIF---------------------PLTTAPL
THIM2_LEUMM      ---------------MKNELIK-----IKSIL---------------------PLQKAPL
THIM2_STRP2      ------------------------MQEFTNPF---------------------PIGSSSL
THIM2_STRPN      ------------------------MQEFTNPF---------------------PIGSSSL
THIM2_STRR6      ------------------------MQEFTNPF---------------------PIGSSSL
THIM2_STRPI      ------------------------MQEFTNPF---------------------PIGSSSL
THIM2_STRP7      ------------------------MQEFTNPF---------------------PIGSSSL
THIM2_STRZP      ------------------------MQALTNPF---------------------PIGSSSL
THIM2_STRPJ      ------------------------MQALTNPF---------------------PIGSSSL
THIM2_STRPS      -----------------------MMQALTNPF---------------------PIGSSSL
THIM2_STRZT      ------------------------MQEFTNPF---------------------PIDSSSL
THIM2_STRZJ      ------------------------MQEFTNPF---------------------PIGSSSL
THIM2_STRP4      ------------------------MQEFTNPF---------------------PIGSSSL
THIM_THEP3       --------------------------MKKELLK-------------------ILREKKPL
THIM_THEPX       --------------------------MKKELLK-------------------ILREKKPL
THIM_CALS4       --------------------------MGSEVLK-------------------LLRDKKPL
THIM_METBF       ---------------------------MNDPLK-------------------TIRETKPL
THIM_METMA       ---------------------------MKNPLK-------------------TIRETKPL
THIM_METAC       ---------------------------MNEPLK-------------------TIRETKPL
THIM_METAR       ----------------------MDARSLSGILT-------------------EVREKRPL
THIM_METPE       -----------------------MTLDLASALN-------------------DLQTKKPL
THIM_METMJ       ---------MPDNTREGSSARFVDGAIPAGLLA-------------------AVRSQRPL
THIM_METB6       ----------------------MDNQVFSGIFA-------------------RAREQHPL
THIM_METHJ       -------------MQTYPEILDFFMTLFGSILT-------------------DIREKTPL
THIM_METLZ       ------------------------MQKYAQILD-------------------LVRERNPL
THIM_RUBXD       -------------------------MRAGEALR-------------------RLGERRPL
THIM_MOOTA       ---------------------MNWGEQVASRRQ-------------------RVHEQRPL
THIM_DESOH       ------------------MNEHEFAQKTIAIRR-------------------KVREQRPL
THIM_DESPS       --------------------MSNISLTAAENLQ-------------------QIRENKPL
THIM_CHLAA       ---------------------MTLNERIAELRE-------------------RVRQQRPL
THIM_CHLSY       ---------------------MTLNERIAELRE-------------------RVRQQRPL
THIM_CHLAD       ---------------------MTFNDRIAELRD-------------------RVRQQRPL
THIM_ROSS1       --------------------MDPINQRIGDMLA-------------------RIRATRPL
THIM_ROSCS       --------------------MDTINQRIGEMLA-------------------RVRATRPL
THIM_DESAP       ------------------MNVSELRLRFANALA-------------------RIRATKPL
THIM_DESAL       ---------------------MNWNAHGAKILD-------------------MIRNSKPL
THIM_SYNFM       -----------------------MLAETARCLE-------------------KIRAQRPL
THIM_NATPD       ------------MSD------VDAAVDLAAALG-------------------DIDTATPL
THIM_HALWD       ------------MNEDTTTLVEETNTTTQAALR-------------------QLSQTTPL
THIM_PYRAB       ------------------------MNFIVEALN-------------------EVRKRKPL
THIM_PYRHO       ------------------------MKFIIEALK-------------------RVRERRPL
THIM_PYRFU       ------------------------MISVGEALA-------------------KVRERKPL
THIM_METM5       ------------------------MDFVAKNLT-------------------KLRETNPL
THIM_METM7       ------------------------MDFVAKNLT-------------------KLRETNPL
THIM_METM6       ------------------------MDFVAKNLT-------------------KLRETNPL
THIM_METMP       ------------------------MDFVAKNLT-------------------KLRETNPL
THIM_METVS       ------------------------MKFIAENLT-------------------KLRTISPL
THIM_COPPD       -------------------MVSQPSVNIKEILE-------------------QVVSTKPL
THIM_CALMQ       ---------------------MWLSDEFPRDLK-------------------TLRDRKPL
THIM_ARCFU       ------------------MHLQRLKEELERDIA-------------------RIAEFKPV
THIM_CLOTE       ---------------------MEIYKKIYNSLL-------------------KLKEKNPL
THIM_ALKOO       ---------------------MELKNELCTVLE-------------------QIKEKTPL
THIM_CLOB8       -------------------MSNEISIKIGSLLN-------------------EVRNKKPL
THIM_RUMCH       --------------------MSEYTKQITRLIS-------------------EVRSKKPL
THIM_CLOBA       -------------------MINEILDKVGRLLE-------------------EVRTKKPL
THIM_CLOBB       -------------------MINEILDKVVRLLE-------------------EVRAKKPL
THIM_ALKMQ       ---------------------MLELEESSKIIE-------------------KIKYNKPL
THIM_EXIS2       ------------------------------MLR-------------------RIHDKKPL
THIM_CLOD6       ---------------------------MYNLIK-------------------DVKKLNPL
THIM_CLOAB       --------------------------MLKERLE-------------------NVRGTNPL
THIM_DESDA       ------------------------MTVFADILD-------------------TVRRHEPV
THIM1_METST      -------------------MSEYTLENIAQVVE-------------------ILREKSPL
THIM2_METST      -----------------------MLEQCSKNIE-------------------KLRNKCPL
THIM_METS3       -----------------MTNKEKLLQKIPELLN-------------------EVKSKNPL
THIM_CLOPE       -------------------------------ME-------------------VLKRENPL
THIM_CLOPS       -------------------------------ME-------------------VLKRENPL
THIM_CLOP1       -------------------------------ME-------------------VLKRENPL
THIM2_CLOB6      ----------------------------MQIRQ-------------------SVKLKKPL
THIM2_CLOBK      ----------------------------MQIRQ-------------------SVKLKKPL
THIM2_CLOBL      ----------------------------MEIRQ-------------------NVKFKKPL
THIM2_CLOBJ      ----------------------------MQIRQ-------------------SVKFKKPL
THIM1_CLOBM      ----------------------------MQIRQ-------------------SVKFKKPL
THIM2_CLOB1      ----------------------------MQIRQ-------------------SIKLKKPL
THIM2_CLOBH      ----------------------------MQIRQ-------------------SIKLKKPL
THIM_FINM2       --------------------MDNLIQKMSEIYS-------------------DLHNSNNL
THIM_CAMLR       -----------------------------MYIE-------------------KIRKVKPL
THIM_DESHY       -------------------MKE----KLTEALQ-------------------ALKQKTPL
THIM_DESHD       -------------------MKE----KLTKALQ-------------------ALKHKTPL
THIM1_CLOB1      -------------------MKN------KNVIQ-------------------KMREKTPL
THIM1_CLOBH      -------------------MKN------KNVIQ-------------------KMREKTPL
THIM1_CLOBK      -------------------MEN------KNVIQ-------------------KMREKTPL
THIM1_CLOBJ      -------------------MEN------KNVIQ-------------------KMREKTPL
THIM1_CLOB6      -------------------MEN------KNVIQ-------------------KMREKTPL
THIM1_CLOBL      -------------------MKN------KNVIQ-------------------KMREKIPL
THIM2_CLOBM      -------------------MGN------KNVIQ-------------------KMREKTPL
THIM_CLOK1       -------------------MNDLKLDKVSKVLK-------------------EVRKSVPL
THIM_CLOK5       -------------------MNDLKLDKVSKVLK-------------------EVRKSVPL
THIM_CLONN       ------------------MLEN-----ICINFK-------------------KVKEKTPL
THIM_SYNWW       ------------------MLKY-----CAEIWD-------------------EVRNRRPL
THIM_NATTJ       ------------------MSTFNSNFKLGTYLT-------------------QVRQENPL
THIM_LACPL       ---------------------------------------------MELQLLNTLRNHNPI
THIM_LACBA       ---------------------------------------------MKLALLDDLRTQNPI
THIM_LACSS       ---------------------------------------------MSKTLLDQIKQANPI
THIM_LACF3       ----------------------------------------------MQNAIATIKETNPI
THIM_PEDPA       ---------------------------------------------MNLQDIAKIREVNPV
THIM_LACRJ       ----------------------------------------MVQRQINWSLIDRVRAKNPI
THIM_LACRD       ----------------------------------------MVQRQINWSLIDRVRAKNPI
THIM_LACLM       -----------------------------------------------MSILSKIQRTQPL
THIM_LACLS       -----------------------------------------------MSILGKIQRTQPL
THIM_LACLA       -----------------------------------------------MSILEKIQEKQPL
THIM1_LEUMM      ------------------------------------------------MNITDIRTKSPL
THIM_LEUCK       ------------------------------------------------MKLSTLNETTPL
                                                                            .

THIM_GEOTN       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMAKLAGALVLNIGTLNATEVEAML
THIM_GEOKA       VHNITNVVVTNWTANGLLALGASPVMAYAKEE-VGEMAKLAGALVLNIGTLNDKEVEAML
THIM_GEOSW       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VADMAKIAGALVLNIGTLNPTEVEAMI
THIM_BACC4       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPEEVEAML
THIM_BACCR       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPEEVEAML
THIM_BACC2       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMANIAGALVLNMGTLRPEEVEAML
THIM_BACCQ       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPEEVEAML
THIM_BACC7       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPEEVEAML
THIM_BACC1       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPEEVEAML
THIM_BACAH       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BACC3       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BACAA       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BACC0       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BACAN       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BACAC       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BACHK       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BACCZ       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMTSIAGALVLNMGTLRPDEVEAML
THIM_BACMK       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPEEVEAML
THIM_BACCN       VHNITNVVVTNFTANGLLALGASPVMAYAKEE-VAEMASIAGALVLNMGTLRPDEVEAML
THIM_BREBN       VHNITNVVVTNFTANGLLALGASPVMAYAKQE-VADMAKIAGALVLNIGTLNEHEIEAML
THIM_BACSU       VHSITNNVVTNFTANGLLALGASPVMAYAKEE-VADMAKIAGALVLNIGTLSKESVEAMI
THIM_BACVZ       VHSITNNVVTNFTANGLLALGASPVMAYAIEE-AADMAKIAGALVLNIGTLSSASVEAMI
THIM_BACLD       VHNMTNNVVTNFTANGLLALGASPVMAYAREE-AADMAKIAGALVLNIGTLSRESVEAMI
THIM_BACP2       VHNITNQVVTNFTANGLLALGASPVMANAKEE-VAEMAQLADALVLNIGTLTKETVESMI
THIM_ANOFW       VHNMTNVVVTNFVANGLLAVGASPVMAYAKEE-VADMVRLARALVLNIGTLNETDVEAML
THIM_BACHD       IHCMTNVVVTNFTANGLLAVGASPVMAYAKEE-VADMAKVANALLLNIGTLSAESIDNMI
THIM_BACSK       IHCMTNDVVMNFTANGLLAIGASPVMAFSAAE-TEDMASVADALLLNIGTPSNEGVDSMV
THIM_LISMC       VHNITNIVVANDSANGLLAIGASPIMASAKEE-MDELAKMADVLVINIGTLDGELVTAMK
THIM_LISMF       VHNITNIVVANDSANGLLAIGASPIMGSAKEE-MDELAKMADVLVINIGTLDGELVTAMK
THIM_LISIN       VHNITNIVVANDSANGLLAIGASPIMASAKEE-MDELAKMADVLVINIGTLDGELVTAMK
THIM_LISMO       VHNITNIVVANDSANGLLAIGASPIMASAKEE-MDELAKMADVLVINIGTLDGELVTAMK
THIM_LISMH       VHNITNIVVANDSANGLLAIGASPIMASAKEE-MDELAKMADVLVINIGTLDGELVEAMK
THIM_LISW6       VHNITNIVVANDSANGLLAIGASPIMASAKQE-MDELAKMADVLVINIGMLDGELVEAMK
THIM_HAEIN       IHNITNIVAANFSANGLLALGASPLMSANVEE-MQEVPKISQALVINIGTLIGKDREAML
THIM_HAEI8       IHNITNIVAANFSANGLLALGASPLMSANIEE-MQEVPKISQVLVINIGTLIGKDREAML
THIM_HAEIG       IHNITNIVAANFSANGLLALGASPLMSANIEE-MQEVPKISQALVINIGTLIGKDREAML
THIM_HAEIE       IHNITNIVAANFSANGLLALGASPLMSANVEE-MQEVPKISQALVINIGTLIGKDREAML
THIM_HAES1       IHNITNIVAANFSANGLLAIGASPIMSACIEE-MEEMAKLSQSLVINIGTLTGKDVEAML
THIM_PASMU       IHNITNVVAANFSANGLLAIGASPLMSAAMEE-MHEVPRLSQALVINIGTLMGKEVDAMV
THIM_HAEPS       IHNITNLVSAHFTANGLLALGASPMMAESPDE-MAELATISSAVVLNLGTPSDEKVSAML
THIM_ACTSZ       EHCITNIVVTNFSANGLLALGASPFMSAMPQE-VTEIQNFAQALLINIGTLNQSDVEAML
THIM_EXISA       IHNITNTVVANFSANGLLAIGASPVMADAIEE-VAEMTFVSDALVLNIGTLGTMTEATMI
THIM_LYSSC       IHCITNYVVANFQANGLLALGASPVMADDSHE-VEEMVAIAEALLINIGTLNDRTKEAML
THIM_STAEQ       VICYTNDVVKNFTANGLLSLGASPAMSEAPEE-AEDFTRMASALLINIGTLTRENEEDII
THIM_STAES       VICYTNDVVKNFTANGLLSLGASPAMSEAPEE-AEDFTRMASALLINIGTLTRENEEDII
THIM_STAHJ       VVCYTNDVVKNFTANGLLSIGASPAMSEAPEE-AKEFYKVAGALLINIGTMTKANEQDIL
THIM_STAA3       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAENEQDII
THIM_STAAE       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAENEQDII
THIM_STAA8       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAENEQDII
THIM_STAAC       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAENEQDII
THIM_STAAW       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQGLLINIGTLTAENEQDII
THIM_STAAS       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQGLLINIGTLTAENEQDII
THIM_STAAM       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAQNEQDII
THIM_STAA9       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAQNEQDII
THIM_STAAN       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAQNEQDII
THIM_STAA2       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAQNEQDII
THIM_STAA1       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAQNEQDII
THIM_STAAR       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAQNEQDII
THIM_STAAB       TICYTNDVVKNFTANGLLSIGASPAMSEAPEE-AEEFYKVAQALLINIGTLTAQNEQDII
THIM_STAS1       VICYTNDVVKNFTANGLLSLGASPAMSQAPEE-AIDMLTPANALLINIGTLTKDREQDIL
THIM_STACT       VICYTNDVVKNFTANGLLSLGASPTMSEAPQE-AEDFYPVAGSVLINIGTLTKHHEHAML
THIM_MACCJ       IICITNDVVKNFTANGLLALGASPAMATERQE-MDEFLAHAGALLINIGSIEEGDKENML
THIM1_STRPS      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRPJ      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRP2      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRR6      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRP4      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRP7      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRZP      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRZT      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRPI      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRZJ      VICITNDVVKNFTANGLVALGASPAMSEFPED-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM1_STRPN      VICITNDVVKNFTANGLVALGASPAMSEFPAD-LEDLLKYAGGLLINIGTLTDENWKLYQ
THIM_STRSY       TICITNDVVKNFTANGLLALGASPAMSEYPED-LEDLLPYTKGLLINTGTLTNETWELYK
THIM_STRS2       TICITNDVVKNFTANGLLALGASPAMSEYPED-LEDLLPYTKGLLINTGTLTNETWELYK
THIM_STRA1       TICITNNVVKNFTANGLLALGASPAMSECIED-LEDLLKVADALLINIGTLTKESWQLYQ
THIM_STRA5       TICITNNVVKNFTANGLLALGASPAMSECIED-LEDLLKVADALLINIGTLTKESWQLYQ
THIM_STRA3       TICITNNVVKNFTANGLLALGASPAMSECIED-LEDLLKVANALLINIGTLTKESWQLYQ
THIM_HELPG       VHNITNYVVAQFVANGLLALGASPLMSDAIDE-MQDLAKISDALAINIGTLNERTILCAK
THIM_HELPY       VHNITNYVAAQFVANGLLALGASPLMSDAIDE-MRDLAKISDALAINIGTLNDRAILCAK
THIM_HELPH       VHNITNYVAAQFVANGLLALGASPLMSDAIDE-MQDLAKISDALAINIGTINERAILCAK
THIM_HELPS       VHNITNYVVAQFVANGLLALGASPLMSDAIAE-MQDLAKISDALAINIGTLNERTILCAK
THIM_HELPJ       VHNITNYVVAQFVANGLLALGVSPLMSDAIAE-MPDLAKISDALAINIGTLNERTILCAK
THIM1_OCEIH      VHHLTNQVVMNFSANGLLSFGGSPIMAKAIEE-VEQIAAISNAVLINIGTLTSTELESMI
THIM_CARHZ       VVNLTNNVVTNFTANVLLAAGASPIMSEGVEE-ADDLVKIANAVVINIGTLHSRQVEYFK
THIM_DESRM       VCNITNTVVTNFTANVLLAVGASPLMSEGWQE-ADDLAKIVDVLVLNMGTLHPRQVEYFI
THIM2_OCEIH      IFNITNEVASNFSANGLIAIGASPAMSHTPRE-AKKYGEIADAVVLNLGTLTEDRGEAML
THIM_DESVV       IHSITNFVVMNTTANALLAAGASPIMAHAPEE-MAEMAGIASALVLNIGTLTKPWVESMM
THIM_DESVH       IHSITNFVVMNTTANALLAAGASPIMAHAPEE-MAEMAGIASALVLNIGTLTKPWVESMM
THIM_DESVM       VHSITNFVVMNVTANALLAAGASPIMAHAREE-MAELVNIVSSLVLNIGTLSAPWIDSMF
THIM_DESAG       VHNITNYVVMNTTANALLAAGASPVMAHAREE-VEELAGLCSSLVLNIGTLSKPWIESMF
THIM_DESMR       VVNITNNVVTNATANALLALGASPAMTHHPAD-AAELAALAGALVCNMGTPGGENIEAML
THIM_LEPBA       VHNITNYVVMNNTANALLAIGASPIMAHAIEE-VEEMVTICSATVINIGTLSEPWIQSME
THIM_LEPBP       VHNITNYVVMNNTANALLAIGASPIMAHAIEE-VEEMVTICSATVINIGTLSEPWIQSME
THIM_SYNAS       IHNITNYVVMNSTANALLALGASPVMAHAQEE-VEEMVGIAQALVVNIGTLSPSWVRAMA
THIM_CHLT3       VHNITNYVVMNSTANALLSIGASPVMAHAEEE-VIDMVTIAGSLVINIGTLSKAWVAAMH
THIM_RHOFT       VHSITNLVVINFNANVLLAAGASPVMAHAHEE-VADMVGIAQALVLNIGTLDPYWIESMQ
THIM_LEPCP       VHSITNFVVMNFNANVLLALGAAPVMAHAHDE-VADMAGIAQALVLNIGTLEPAWVESMH
THIM_VIBPA       VVNITNYVVMNNTANALLAIGASPIMAHSKQE-MAEMMSFAGALVINIGTLDSVWTPRMS
THIM_VIBCB       VVNITNYVVMNNTANALLAIGASPIMAHSKQE-MVEMMSFAGALVINIGTLDSVWTPRMS
THIM_VIBA3       VVNITNYVVMNNTANALLAIGASPIMAHSKQE-LAEMMSFSGALVINIGTLDSVWTPRMC
THIM_ALIF1       VVNITNYVVMNNTANALLALGASPIMAHSQQE-MAEMMSFSGALVINIGTLDSVWTPRMH
THIM_ALIFM       VVNITNYVVMNNTANALLALGASPIMAHSQQE-MAEMMSFSGALVINIGTLDSVWTPRMH
THIM_ALISL       VVNITNYVVMNNTANALLALGASPIMAHSQQE-MAEMMSFSGALVINIGTLDSVWTPRMH
THIM_PSYIN       VVNISNYVAMNNTANALLALGASPIMAHSRDE-MAEMLSFSGALVVNIGTLDSLWIPRML
THIM_PHOPR       VVNITNYVVMNNTANALLAIGASPIMAHSQEE-MAEMMSFAGSLVINIGTLDSVWIPRMI
THIM_BRAHW       VHNITNFVVMQITANALLAVGASPVMTFEKEE-FEDMLSIASSLVVNIGTLTKTSIEAMH
THIM_DESAH       VHVVTNFVVMNQTANALLALGASPTMSWAQED-AAYMSKISDALCINMGTPVKGRIEVMK
THIM_CHLFF       VLNITNYVSMDFLANCFLALGASPVMSVSDLE-LEELIGLSSAVYINIGTLDHLFIQRAY
THIM_CHLCV       ILNITNYVSMDFLANCFLAIGASPIMSVSDLE-LEELIGLSSAVYLNIGTLDHLFIQRSY
THIM_CHLAB       ILNTTNYVSMDFLANCFLAIGASPIMSVSDLE-LEELIELSSAVYINIGTLDHLFIQRAY
THIM_HERA2       VHVVPNLVTANDLANALLAVGAAPIMAIEPAE-FSQLPN--RALVLSMGTPTIDRMQLLA
THIM_SHIB3       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECOSM       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECOLU       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECO45       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMS
THIM_ECOK1       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMS
THIM_ECOUT       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMS
THIM_ECOL6       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMS
THIM_ECO7I       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMS
THIM_ECO81       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRVQAMS
THIM_ECO27       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMS
THIM_ECOL5       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASHFAAIASALLINVGTLTQPRAQAMS
THIM_SHIBS       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQLRAQSMC
THIM_ECO24       VHCMTNDVVQTFTANTLLVLGASPAMVIETEE-ASQFAAIASALLINVGTLTQLCAQSMC
THIM_ECO55       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECOSE       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECO8A       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_SHISS       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECODH       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECOLI       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECOHS       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECOLC       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECOBW       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_SHIFL       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_SHIF8       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECO57       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_ECO5E       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVGTLTQPRAQAMR
THIM_SHIDS       VHCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAIASALLINVDTLTQPRAQAMR
THIM_ESCF3       THCMTNDVVQTFTANTLLALGASPAMVIETEE-ASQFAAVASALLINVGTLTQARAHAMR
THIM_SALPA       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALPK       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALAR       THCMTNDVVQTFTANTLLALGASPAMVIDPAE-ARPFAAIANALLVNVGTLTASRADAMR
THIM_SALEP       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALTY       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALG2       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALDC       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALNS       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALHS       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLVNVGTLTASRADAMR
THIM_SALA4       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLVNVGTLTASRADAMR
THIM_SALPB       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLVNVGTLTASRADAMR
THIM_SALTI       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLINVGTLTASRADAMR
THIM_SALCH       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLVNVGTLTASRADAMR
THIM_SALPC       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLVNVGTLTASRADAMR
THIM_SALSV       THCMTNDVVQTFTANTLLALGASPAMVIDPVE-ARPFAAIANALLVNVGTLTASRAEAMR
THIM_CITK8       THCMTNDVVQNFTANTLLASGASPAMVIEPEE-ARQFAAIASALLINVGTLTRSRAEAMR
THIM_ENT38       THCMTNDVVQTFTANVLLALGASPAMVIEAEE-AEQFAAMADALLINVGTLTAPRAQAMR
THIM_KLEP3       VHCMTNDVVQTFTANVLLAVGASPAMVIDPRE-AAQFAAIADALLINVGTLTEDRAVAMR
THIM_KLEP7       VHCMTNDVVQTFTANVLLAVGASPAMVIDPRE-AAQFAAIADALLINVGTLTEDRAVAMR
THIM_CROS8       VHCITNDVVQNFTANVLLALGASPAMVVDTDE-AAQFAAIADALLINLGTLTRPQQQAMR
THIM_SERP5       IHCLTNEVVQELTANVLLALGASPAMVVEPTE-AAQFSRLADALLINIGTLNASRAESML
THIM_YERE8       VHCLTNEVVQSFTANVLLALGAFPAMVVEPQE-AAQFSTMANSLLINIGTLHRARAESML
THIM_PECAS       VHCLTNDVVQSFTANVLLALNASPAMVVDPEE-AAQFSAVADALLINVGTLERTRAEAMR
THIM_PECCP       VHCLTNDVVQSFTANVLLALNASPAMVVDPEE-AAQFSAVADALLINVGTLERSRAEAMR
THIM_TOLAT       THVITNDVVTGFTANVLLALGAAPAMITAPEE-AGSFAAIASVLSVNVGTLTSAQAATIR
THIM_LARHH       VHCLTNQVVSQFTANVLLAAGAAPAMVIAREE-AGDFARMASAVLVNVGTLTPVQADAMR
THIM_LEPIN       THVITNIVVTNWTANVLLAIGSSPAMVIAKEE-AGEFAKIASGLLINIGTVTSNDAITMK
THIM_LEPIC       THVITNIVVTNWTANVLLAIGSSPAMVIAKEE-AGEFAKIASGLLINIGTVTSNDAITMK
THIM_LEPBJ       THIMTNIVVTNWTANVLLAVGASPAMVIAEEE-AGEFVKIANGLLINVGTITSNDAKAMK
THIM_LEPBL       THIMTNIVVTNWTANVLLAVGASPAMVIAEEE-AGEFVKIANGLLINVGTITSNDAKAMK
THIM_CLAM3       VQCITNAVVTGFTANVLLALGAAPAMTDVPTE-AGPFARIASGLLVNLGTPHAEQREAAV
THIM_CLAMS       VQCITNAVVTGFTANVLLALGAAPAMTDVPTE-SGPFARIASGVLINLGTPHAEQREAAV
THIM_CORGB       VQCLTNSVVMQFTANVLLAAGATPAMVDTPAE-SAEFAAVANGVLINAGTPSAEQYQGMT
THIM_CORGL       VQCLTNSVVMQFTANVLLAAGATPAMVDTPAE-SAEFAAVANGVLINAGTPSAEQYQGMT
THIM_COREF       VQCLTNAVVMQFTANALLAIGASPAMVDTPAE-SFDFAGVADGVLINAGTPSAEQYAGME
THIM_CUTAK       VQCLTNIVVANFTANVLLSAGAVPAMVDNPEE-SEGFASIADGVLVNTGTPYRETTEAMI
THIM_KINRD       VQCLTNSVVQTITANALLAAGAAPAMVDNVHE-SAAFAQIASAVLVNVGTLDDDRARAMG
THIM_RHOE4       VQSLTNIVSANFLTNVLLAAGASNAHIDNVHE-AGGFAAVAGGVLVNLGTPDDGTAEAFL
THIM_BURP0       VYGLTNYVAANLSANVLLAVGAAPAIGAAADW-PARFGAGANALWINTAALMSSGADTLL
THIM_BURTA       VYGLTNYVAANLSANVLLAVGAAPAIGAAADW-PARFGAGAGALWINTAALMSSGADTLR
THIM_BURP6       VYGLTNYVAANLSANVLLAVGAAPAIGAAADW-PARFGAGANALWINTAALMSSGADTLL
THIM_BURPS       VYGLTNYVAANLSANVLLAVGAAPAIGAAADW-PARFGAGANALWINTAALMSSGADTLL
THIM_BURP1       IYGLTNYVAANLSANVLLAVGAAPAIGAAADW-PARFGAGANALWINTAALMSSGADTLL
THIM_GRABC       VHNITNLVVTNTTANALLALGASPAMVEGVEE-VDSFARMADSLVINLGTMSSPRAAAMR
THIM_AKKM8       VLSLTNSVVQPLTANLLLAIGAVPAMLNDAEEAVDMLRSGTGALLVNLGTVTREQGAAMQ
THIM_RHOSK       VQCITNFVAMNVVANVLLAAGASPAMVHDAEE-SGEFAAIAQALTINMGTPSPRWVEGME
THIM_RHOS4       VQCITNFVAMNVVANVLLAAGASPAMVHDAEE-SGEFAAIAQALTINMGTPSPRWVEGME
THIM_RHOS1       VQCITNFVAMNVVANVLLAAGASPAMVHDAEE-SGEFAAIAQALTINMGTPSPRWVEGME
THIM_RHOS5       VQCITNFVAMNVMANVLLAAGASPAMVHDAEE-SGEFAAIAQVLTINLGTPSPRWVEGME
THIM_RHIL3       VQCITNYVAMNIAANVLLAAGASPAMVHAAEE-AGEFAAIASALTINIGTLSTQWIDGMQ
THIM_RHILW       VQCITNYVAMNIAANVLLAAGASPAMVHAAEE-ADEFAGIASALTVNIGTLSTQWIDGMQ
THIM_RHIE6       VHCITNYVAMNIAANVLLASGASPAMVHAPEE-AGEFAGIASALTVNIGTLSTQWLDGMR
THIM_RHIEC       VHCITNYVAMNIAANVLLASGASPAMVHAPEE-AGEFAGIASALTVNIGTLSTQWIDGMQ
THIM_AGRRK       VQCITNFVAMNIAANVMLAAGASPAMVHAEEE-AGEFAAISGALTINIGTLSTGWLAGMT
THIM_ROSDO       VHCITNYVAMNIAANVVLAAGASPAMVHAPEE-IAEFTPICGALTINIGTISTPWQASMM
THIM_GEMAT       TQCITNYVAMQIAANTLLAAGAAPAMIHTVEE-SGAFAGLARAVTINIGTLSPAWVDGMK
THIM_PSYWF       VHNLTNDVAHNTVANVLLACRASPAMVHDIQE-APDFVCLSDALAINIGTLTQTRLNSML
THIM_BIFLO       AQSFTNFVTINLVANAQLAAGGTAAMSFLPDD-VIETAKIAGANYINVGTLLPFYKDALP
THIM_BIFLD       AQSFTTFVTINLVANAQLAAGGTAAMSFLPDD-VIETAKIAGANYINVGTLLPFYKDALP
THIM_BIFLS       AQSFTNFVTINLVANAQLAAGGTAAMSFLPDD-VIETAKIAGANYINVGTLLPFYKDALP
THIM_BIFAA       AQSFTNFVTINLVANAQLAAGGTAAMSYLPDD-VIATAEIAGSNYINVGTLLPFFKNALP
THIM_BIFA0       AQSFTNFVTINLVANAQLAAGGTAAMSFLPND-VTSLASSCGATYINVGTLLPFYRDALQ
THIM_DICNV       IHCLTNNTTKFFVANALLAIGAKPAMVESWQE-VVEFSQRAANVVMNLDSLTDERLRSLS
THIM_ACIBY       VQCITNSVAANYTANVLLASGASPAMIDNPYE-AESFTKISSALSINLGTPTSEQMQAMQ
THIM_ACIB3       VQCITNSVAANYTANVLLASGASPAMIDNPYE-AESFTKISSALSINLGTPTSEQMQAMQ
THIM_ACIB5       VQCITNSVAANYTANVLLASGASPAMIDNPYE-AESFTKISSALSINLGTPTSEQMQAMQ
THIM_ACIBT       VQCITNSVAANYTANVLLASGASPAMIDNPYE-AESFTKISSALSINLGTPTSEQMQAMQ
THIM_ACIBS       VQCITNSVAANYTANVLLASGASPAMIDNPYE-AESFTKISSALSINLGTPTSEQMQAMQ
THIM_ACIBC       VQCITNSVAANYTANVLLASGASPAMIDNPYE-AESFTKISSALSINLGTPTSEQMQAMQ
THIM_ACIAD       VQCITNSVAANYAANVLLAAGASPAMIDNPFE-ARSFTEISGALSINVGTPTTEQIQAMQ
THIM_LACCB       VQCITNEITVESMANALLYIDAKPVMADDQRE-FPEFFAQSDALLLNLGHISEVRQQNLL
THIM_LACP3       VQCITNEITVESMANALLYIDAKPVMADDQRE-FPEFFAQSDALLLNLGHISEVRQQNLL
THIM_ENTFA       IQCITNEITCESMANALLYIDAKPIMADDPRE-FPQMFQQTSALVLNLGHLSQEREQSLL
THIM2_LEUMM      VHCITNDITLETVANTILYLGGKPIMSSDTRE-FSSLFQSTDALLLNMGRLNESHEQSLS
THIM2_STRP2      IHCITNEISCEMLANGILALGCKPVMADDSRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRPN      IHCITNEISCEMLANGILALGCKPVMADDSRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRR6      IHCITNEISCEMLANGILALGCKPVMADDSRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRPI      IHCMTNEISCEMLANGILALGCKPVMADDSRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRP7      IHCMTNEISCEMLANGILALGCKPVMADDPRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRZP      IHCMTNEISCEMLANGILALGCKPVMADDPRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRPJ      IHCMTNEISCEMLANGILALGCKPVMADDPRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRPS      IHCMTNEISCEMLANGILALGCKPVMADDPRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRZT      IHCMTNEISCEMLANGILALGCKPVMADDPRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRZJ      IHCMTNEISCEMLANGILALGCKPVMADDPRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM2_STRP4      IHCMTNEISCEMLANGILALGCKPVMADDPRE-VLDFTKQSQALFINLGHLSAEKEKAIR
THIM_THEP3       VHHITNIVTVNDCANITLAIGALPVMAHALEE-VEEMVSAADALVLNIGTLTNEQVEAMI
THIM_THEPX       VHHITNVVTVNDCANITLAIGALPVMAHALEE-VEEMVSAADALVLNIGTLTNEQVEAMI
THIM_CALS4       IHHITNVVTVNDCANVTLAIGALPVMAYAPEE-VEEMVKNANALVLNIGTLSVEEVNTMI
THIM_METBF       IHHITNWVTIYDCANMTRAFGALPVMAHASEE-CAEMTGISSALVLNIGTPTSEIIDSML
THIM_METMA       VHHITNWVTIYDCANITRAFGALPVMAHAPEE-CADMTGISSALVLNIGTLTSEIIDSML
THIM_METAC       IHHITNWVTIYECANMTRAFGALPVMAHAPEE-CADMTKISSALVLNIGTLTSEIIDSML
THIM_METAR       VHHITNYVTVNDCANVTLCIGAAPVMAHAHDE-VAEMVAMAGALVLNIGTLDHRQVESML
THIM_METPE       VHHITNAVTINDCANITLCIGAAPVMAEAPEE-VAEMVAMAGALVLNIGTLSKSQISAML
THIM_METMJ       VHHITNGVTINDCANITICAGAAPVMAEAPEE-VAGMVAAAGALVLNIGTLSAAQVEAML
THIM_METB6       VHHITNYVTVNDCANITIGAGGAPVMADAREE-AGEMTGFAGALVLNIGTLNSGIIESMI
THIM_METHJ       VHHMTNYVTVNDCANITLCIGASPVMAHAEEE-VGEMVALAGALVLNIGTLDTLQIDRMF
THIM_METLZ       VHQITNYVTVNDCANMTICFGASPVMSHAPED-VVDMIKIASALVLNIGTLDEKQIEGMI
THIM_RUBXD       VHHITNYVSVGLVANATLCTGALPVMAHAREE-VAEMSGAAGALVLNIGTLDERQVESML
THIM_MOOTA       VHHITNLVVTNLTANVTLAIGASPVMAYAREE-VADMARLAQAVVLNMGTLTGDVVEAML
THIM_DESOH       VHHITNFVVMNITANVTLAVGASPVMAHAHEE-VKEMAAFAGALNLNIGTLTPYWIDAMV
THIM_DESPS       IHNITNFVVMNYTANVLLATGASPVMAHAQNE-VEEMVAFAGSLVLNIGTLSESWVSSML
THIM_CHLAA       IHHITNFVVMNDTANVTLHIGGLPVMAHDRAE-VAEMVTAAGALVLNVGTLSPDWIEAML
THIM_CHLSY       IHHITNFVVMNDTANVTLHIGGLPVMAHDRAE-VAEMVTAAGALVLNVGTLSPDWIEAML
THIM_CHLAD       IHHITNFVVMNDTANVTLHIGGLPVMAHDREE-VAEMVAAAGALVLNVGTLSPDWIEAMI
THIM_ROSS1       IHHITNLVVMNDTANVTLHVGGLPVMAHDAEE-VAEMVAHAGALVLNVGTLSPDWIESML
THIM_ROSCS       IHHITNLVVMNDTANVTLHVGGLPVMAHDVEE-VAEMVTHAGALVLNVGTLSPDWVESML
THIM_DESAP       VHHITNYVVMNDTANVTLHVGALPVMAHTTEE-AAEMTGLAGALVLNIGTLSPAWVDAML
THIM_DESAL       VHHITNLVVMNDTANVTLHLGALPVMAHAVEE-MEEMTSIASALVINIGTLSKHWIEAMF
THIM_SYNFM       VHNITNYVVMNYTANALLCLGASPVMAHAVEE-VEAMVELADALVINIGTLSAPWVDAMF
THIM_NATPD       VNSVTNNVTVNDVANITLHWGGLPVMSDDARE-VDDMVATADGCLINMGTVDEDGEESMV
THIM_HALWD       VNAITNDVTVNQVANIILHWGGLPVMSDDVRE-LDEMVNAAEACLLNMGTVSETGEEAMM
THIM_PYRAB       VHNITNFVVMNTTANALLALGASPVMAHAEEE-LEEMIGLADAVVINIGTLDSWWRKSMI
THIM_PYRHO       VHNITNFVVMNTTANALLALGASPVMAHAEEE-LEEMIRLADAVVINIGTLDSGWRRSMV
THIM_PYRFU       VHNITNFVVMNTTANALLALGASPVMAHAEEE-LEEMVRIADSVVVNIGTLDKFWINSMI
THIM_METM5       VQNITNYVVMNSTANSLLALGASPVMAHAMDE-LEEMVSIASALVVNIGTLDEYWIPSME
THIM_METM7       VQNITNYVVMNSTANSLLALGASPVMAHAMDE-LEEMVSIASSLVVNIGTLDEYWIPSME
THIM_METM6       VQNITNYVVMNSTANSLLALGASPVMAHAMDE-LEEMVSIASSLVINIGTLDEYWIPPME
THIM_METMP       VQNITNYVVMNSTANSLLALGASPVMAHAMDE-LEEMVSIASALVVNIGTLDEYWIPSME
THIM_METVS       VQNITNYVVMNSTANTLLALGASPVMAHAKEE-LEEMIAISSALVVNIGTLDEYWIPSME
THIM_COPPD       VYHMTNMVAMAEQAHLTLAIGASPVMSLSSEE-AAEMVNIANAVLINIGTPSKEANEAML
THIM_CALMQ       VHHFMNFVVMNDAANVTLAIGASPIMAHAKEE-VEELASKANALYINIGTLDEYWVESMI
THIM_ARCFU       VHHITNYVAMNDSANITIAIGASPIMSFAHGE-IDELVSIASSLLINIGTLDEYIIQAVM
THIM_CLOTE       IHHITNYVTVNDCANIVLAIGASPVMADDIRE-VEDMVSIASALVINIGTLNKKTVKSMF
THIM_ALKOO       VHHITNYVTVNDCANITLAIGGSPVMADDHKE-VEDMVSIASAVVLNIGTLNERTIESFV
THIM_CLOB8       VHNITNYVTVNDCANILLAIGASPIMADDIKE-AADITKISSALVINIGTLNERTIESMI
THIM_RUMCH       IHNITNYVTVNDCANVTLAIGASPIMADDIDE-AADITSISSALVINIGTLNKRTIESMI
THIM_CLOBA       VHSITNYITATDCANVILAVGGSPTMADYVKE-VEEIASISSAVVLNMGVISEKMVEAMI
THIM_CLOBB       VHSITNYITATDCANVILAVGGSPTMADYVKE-VEEIASISSAVVLNMGVISDGMVESMI
THIM_ALKMQ       IHHITNYVSVNDCANIVLALGGSPIMADDPKE-VVEVVSKASALVINIGTLNDKRVQSML
THIM_EXIS2       IHHLTNTVTINDCANMTLALGGSPVMAEDLLE-VEEMVGLADAVVINTGTINPDMRKAQL
THIM_CLOD6       VIHYTNNVTINDCANVTLAVGASPLMSFSYEE-VEEMVSVANSVVINIGTMNSNMLDLFL
THIM_CLOAB       IHNITNYVTVNDCANILLACGASPIMADDIGE-VEEITSICRGLNINIGTLNENTIESML
THIM_DESDA       VHCITNYVTVNDCANMVLAAGGSPIMADDAAE-VEDIVALSQALVINIGTLNSRTVESML
THIM1_METST      THCITNVVTVKDCANAVLAVGASPIMANAPEE-AEEIVGISNSLVINIGTLTKEQIETMK
THIM2_METST      THCITNYVTINDCANVVLAIGGSPAMANEAPE-IEEFVEAAGVTIINMGTLLEDQIEPMQ
THIM_METS3       THCITNFVTVNDCANAVLAIGASPIMSEDIEE-VAEVVSIADALVINIGKLSHEQVEAMK
THIM_CLOPE       IHMITNYVTVNDLAQVTINYGGLPLMATHHDE-LKEITKMANGLLVNIGTLEPYQMESSM
THIM_CLOPS       IHMITNYVTVNDLAQVTINYGGLPLMATHHDE-LKVITKMANGLLVNIGTLEPYQMESSM
THIM_CLOP1       IHMITNYVTVNDLAQVTINYGGLPLMATHHDE-LKEITKMANGLLVNIGTLEPYQMESSM
THIM2_CLOB6      IHYITNPISINDCANMILAAGAKPIMAEHPLE-VSEITSVSKSLGVNLGNITDNKMKSML
THIM2_CLOBK      IHYITNPISINDCANIILAAGAKPIMAEHPLE-VSEITSVSKSLGVNLGNITDNKMKSML
THIM2_CLOBL      IHYITNPISINDCANMILAAGAKPIMAEHPLE-VSEITSASKSLGVNIGNITDNKMKSML
THIM2_CLOBJ      IHYITNPISINDCANMILAVGAKPIMAEHPLE-VSEITSISESLGINLGNITDNKMKSML
THIM1_CLOBM      IHYITNPISINDCANMILAVGAKPIMAEHPLE-VSEITSISESLGINLGNITDNKMKSML
THIM2_CLOB1      IHYITNPISINDCANIILAAGAKPIMAEHPLE-VSEITSVSKSLGVNLGNITDNKMKSML
THIM2_CLOBH      IHYITNPISINDCANIILAAGAKPIMAEHPLE-VSEITSVSKSLGVNLGNITDNKMKSML
THIM_FINM2       IHCLTNAISINDMANAVLSIGQSPFMADNPRE-VEDVTRKSDSLLVNLGNITDYRIESIK
THIM_CAMLR       IHHITNYVTVNDCANASIAIGASPIMADFIQE-QEEFSKICNCLVLNTGTINERVANSMY
THIM_DESHY       VHAITNVVTVNDCANSLLAVGASPAMCEAADE-VFEFSQLAGSLYLNLGTLTKEQEMAAY
THIM_DESHD       VHAITNVVTVNDCANSLLAVGASPAMCEAADE-VFEFSQLAGSLYLNLGTLTKEQEMAAY
THIM1_CLOB1      IHCITNYVTINDCANILLSFGASPAMCEAYDE-VYDFVSISSALYINLGTLTKEQETAAV
THIM1_CLOBH      IHCITNYVTINDCANILLSFGASPAMCEAYDE-VYDFVSISSALYINLGTLTKEQETAAV
THIM1_CLOBK      IHCITNYVTINDCANILLSFGASPAMCEAYDE-VYDFVSISSALYINLGTLTKEQETAAV
THIM1_CLOBJ      IHCITNYVTINDCANILLSFGASPAMCEAYDE-VYDFVSISSALYINLGTLTKEQETAAV
THIM1_CLOB6      IHCITNYVTINDCANILLSFGASPAMCEAYDE-VYDFVSISSALYINLGTLTKEQETAAV
THIM1_CLOBL      IHCITNYVTINDCANILLSFGASPAMCEAYDE-VYDFVSISSALYINLGTLTKEQETAAV
THIM2_CLOBM      IHCITNYVTINDCANILLAFGASPAMCEAYDE-AYDFVSISSALYINLGTLTKEQETAAI
THIM_CLOK1       VHCITNYVTINDCANILLSYGASPAMCEAYDE-VFDFVKISSALYINIGTFTREQESSAI
THIM_CLOK5       VHCITNYVTINDCANILLSYGASPAMCEAYDE-VFDFVKISSALYINIGTFTREQESSAI
THIM_CLONN       VHSITNYVTINDCANMLLAYGASPAMVESFDE-SYDFAKLASCIYINLGTLTREQEQSIL
THIM_SYNWW       VHCITNYVTVNDVANIILAAGASPAMVEYPAE-ASGFAPLASVLYFNLGTLTGEQEAAML
THIM_NATTJ       VHAITNYVTMNDCANITLAAGASPAMCESRDE-VSDFVPLAKALYINIGTINQEHKDSIY
THIM_LACPL       VFNIANFVTVQDVANGLNALGASPIMSAEVQE-AETMVQIAGAVCINLGTLTTTQIDQMR
THIM_LACBA       VFNISNFVTVQDVANGLNALGASPIMSEEPAE-AGEMVGLAGGVCLNLGAFTQAQIQQIR
THIM_LACSS       ITNVANSVTVDQVANVQNIIGASPIMSSDPEE-APEMVAIAQALSINIGTLSTEPIHQMK
THIM_LACF3       VLTVANNVTPADVANGLNALGASPMMSQTPEE-ADDMVNIAQAAAINLGTLNPHQRGEME
THIM_PEDPA       VVNYANFVTPFLVANGLNAVGASPIMSDEVSE-AEELVQLASAVVINAGASRKESWPLMN
THIM_LACRJ       VLNLANLVTIDKVADAVSAVGASPIMSVEPAE-ADEMVMLANALSINLGTINEHQATQIR
THIM_LACRD       VLNLANLVTIDKVADAVSAVGASPIMSVEPAE-ADEMVMLANALSINLGTINEHQATQIR
THIM_LACLM       ILNLANFVTPQRVADVISFIGASPLMTSEIAE-LESLVEISDAVVVNIGTISESTYPLFL
THIM_LACLS       ILNLANFLTPQRVADVISFIGASPLMTSEIAE-LESLVEISDAVVVNIGTISESTYPLFL
THIM_LACLA       ILNLANFVTPQRVADAISFAGGSPLMTAEISE-SETLVEIADAVVVNIGTISEKDYPLFL
THIM1_LEUMM      VLTYANFVTPQFVANVVNVVGASPLMSRELAE-FKELAGIANAVIINTGTLQKVEINDII
THIM_LEUCK       VFNYANYVTPQFVANAVNVIGGSPIMAREVAE-FSDLVAVSDAVVVNTGTWRRAELLETV
                      .       :.                               .             

THIM_GEOTN       IAGRAANEAGVPVIFDPVGAGATSYRTETAHRIAEQIQLAVVRGNAAEIANMIG------
THIM_GEOKA       VAGQAANEAGVPVIFDPVGAGATRYRTETARRIAEQVKLAVIRGNAAEIANMIG------
THIM_GEOSW       IAGKAANEAGVPVIFDPVGAGATPYRTETARNIASAVQLSVIRGNAAEIANTIG------
THIM_BACC4       LAGKSANANNVPVLFDPVGAGATSYRTEVARHIPAEIDLAIIRGNAAEIANVIN------
THIM_BACCR       LAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELASIRGNAAEIANVIN------
THIM_BACC2       LAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIDLAIIRGNAAEIANVIN------
THIM_BACCQ       LAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACC7       LAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACC1       LAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACAH       LAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACC3       LAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACAA       LAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACC0       LAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACAN       LAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACAC       LAGKSANRNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACHK       LAGKSANTNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACCZ       LAGKSANMNDVPVLFDPVGAGATSYRTEVARHIPAEIELAIIRGNAAEIANVIN------
THIM_BACMK       LAGKSANKNDVPVLFDPVGAGATSYRTEVARYIPAEIDLAVIRGNAAEIANVIN------
THIM_BACCN       IAGKAANQQHVPVLFDPVGAGATLYRTEVARHIPNEIKLAMIRGNAAEIANVIH------
THIM_BREBN       IAGKSANQHGVPVLFDPVGAGATSYRTETSQRLAQELDLAFIRGNAAEVANVIG------
THIM_BACSU       IAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGV-----
THIM_BACVZ       AAGKSANENGVPVIFDPVGAGATPFRTASASKIIQEVRLSAIRGNAAEIANIAGA-----
THIM_BACLD       IAGKSANEHGVPVIFDPVGAGATPFRTESAQAIMRKVKVSAVRGNAAEIANTLG------
THIM_BACP2       LAGQSANKKGIPVLLDPVGVGATTFRLKAAKQLLEQVNITVVRGNAAEIAHLLEV-----
THIM_ANOFW       IAGKAANEANIPVIFDPVGAGATAYRTETARRILREVNISILRGNASEIASIAG------
THIM_BACHD       IAGKAANKAGAPVVLDPVGAGATVFRTESCKRILKEVDVTIVRGNGGEIAALSD------
THIM_BACSK       LAGKAANRAGKPVIFDPVGVGATPFRNEISKRILNEVDVAVVRGNAGEIAALLG------
THIM_LISMC       IAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAG------
THIM_LISMF       IAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAG------
THIM_LISIN       IAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAG------
THIM_LISMO       IAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFAAIRGNAGELAAIAG------
THIM_LISMH       IAGRAANVAGTPVVLDPVGVGATSYRRKVVQELLAEIQFTAIRGNAGELAAIAG------
THIM_LISW6       IAGRAANFAETQVVLDPVGVGATSYRRKVVQELLAEIQFAAIRGNAGELAAIAG------
THIM_HAEIN       QAGKTANEVGIPVVLDPVGVGATSYRRETIRELLAEVKFALIRGNAGELAAIAG------
THIM_HAEI8       QAGKTANEVGIPVVLDPVGVGATSYRRETIRQLLAEVKFALIRGNAGELAAIAG------
THIM_HAEIG       QAGKTANEVGIPVVLDPVGVGATSYRRETISQLLAEVKFALIRGNAGELAAIAG------
THIM_HAEIE       QAGKTANEVGIPVVLDPVGVGATSYRRETVRQLLAEVKFTLIRGNAGELAAIAG------
THIM_HAES1       LAGKTANQVGIPVVLDPVGVGATTFRQKTTALLLEQVQFSAIRGNAGELAYIAG------
THIM_PASMU       LAGKTANEVGIPVVLDPVGVGATTFRKQTVARLLKEVKFAAIRGNAGELATIAE------
THIM_HAEPS       AAGMAANQAGVPVVLDPVAVGASHLRQKTVATLTQNIQFAAIRGNAGELAYLAD------
THIM_ACTSZ       IAGKAANRTGVPVVLDPVGAGATLFRRKIVEQFLAEINFAVIRGNAAEIGFLAG------
THIM_EXISA       RAGQAANEAGCPIVLDPVGVGATSFRRDVVERIMRHVRVSVIRGNAGEIATLIG------
THIM_LYSSC       LAGKKANTLGIPVILDPVGAGATVYRKETVHLLLTDIQFAVIRCNKGELAALVN------
THIM_STAEQ       KIGKIANQQGTPIVFDPVAVGASTYRKNFCQRFLGEVNVTVIKGNASEILTLID------
THIM_STAES       KIGKIANQQGTPIVFDPVAVGASTYRKNFCQRFLGEVNVTVIKGNASEILTLID------
THIM_STAHJ       EIGKIANQQGTPIVFDPVAVGASSYRKAFCQKFLSEVKVSVIKGNASEILTLVD------
THIM_STAA3       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAE       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAA8       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAC       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAW       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAS       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAM       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAA9       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAN       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAA2       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAA1       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAR       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAAB       AIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALID------
THIM_STAS1       EIAKTANEVGTPIVFDPVAVGASQYRKDFCKTFLNTVDVVVIKGNASEILALIN------
THIM_STACT       ENAKIANETETPLVFDPVAVGASKYRKDFCKYFLKKIKPTVIKGNASEILALID------
THIM_MACCJ       QAAAFANKHHVPIVLDPVACGASKFRKDFCLRLLNEHHISIIRGNASELAALTD------
THIM1_STRPS      AALKIAEKYNVPVVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRPJ      AALKIAEKYNVPVVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRP2      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRR6      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRP4      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRP7      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRZP      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRZT      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRPI      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRZJ      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM1_STRPN      AALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRGNAGEIASLVG------
THIM_STRSY       SALDIAEKYGVPTVLDPVAAGAGAYRKKVTLDLLHHHTISLVRGNAGEIAALIG------
THIM_STRS2       SALDIAEKYGVPTVLDPVAAGAGAYRKKVTLDLLHHHTISLVRGNAGEIAALIG------
THIM_STRA1       EAIKIANKNQVPVVLDPVAAGASRFRLEVSLDLLKNYSISLLRGNGSEIAALIG------
THIM_STRA5       EAIKIANKNQVPVVLDPVAAGASRFRLEVSLDLLKNYSISLLTGNGSEIAALIG------
THIM_STRA3       EAIKIANKNQVPVVLDPVAAGASRFRLEVSLDLLKNYSISLLRGNGSEIAALVG------
THIM_HELPG       EAIKHYKALNKPIVLDPVGCSASALRHDTSLELLESEGISALRGNAAELGSLVG------
THIM_HELPY       EAIKHYKALNKPIVLDPVGCSASALRHDTSLELLKSGGISALRGNAAELGSLVG------
THIM_HELPH       EAIKHYKALNKPIVLDPVGCSASALRHDTSLELLKSGGISALRGNAAELGSLVG------
THIM_HELPS       EAIKHYKALNKPIVLDPVGCSASALRHGTSLELLESEGISVLRGNAAELGSLVG------
THIM_HELPJ       EAIKRYKALNKPIVLDPVGCSASALRYDTSLELLESKGISTLRGNAAELGSLVG------
THIM1_OCEIH      AAGKTANKHNIPVLLDPVGVAATSFRRNAIDKILEEVRPTVIKGNAGELASLVN------
THIM_CARHZ       KAVYLANKYQKPLLLDPVGLGATTYRNETTFELLNSGNFTLIRGNYGEISFLAG------
THIM_DESRM       KAGKSANQEQKPVVFDPVGIGATSYRNAVAAEILDKIKLDLIRGNHGEINFLAG------
THIM2_OCEIH      KAGMAANKNGVPVILDPIAVGGTDFRTEIIDDILKTVKLAAIRANAGEIAVLAG------
THIM_DESVV       LAGMAARERRLPVVLDPVGAGASSLRTTTALEILEKVRPAVVRGNGSEILALAGAA-GD-
THIM_DESVH       LAGMAARERRLPVVLDPVGAGASSLRTTTALEILEKVRPAVVRGNGSEILALAGAA-GD-
THIM_DESVM       LAGAAAHERGIPVVLDPVGAGASTLRTTTAAQLMERVRPAIVRGNGSEIMALAGAA-GA-
THIM_DESAG       AAGRIAQSRGVPVVLDPVGAGASSLRTWTSLDLLRELNISVLRGNASEILALSGAG-SR-
THIM_DESMR       AAGGAANAGGVPVVFDPVAAGVTSRRREVAGRMLETVRLAAVRGNASEILALAGEA-AL-
THIM_LEPBA       KAAKKAVSLGKPLVLDPVGAGASNIRNAAIRRILDAGNPTIVRGNASEILSTLSSS-GK-
THIM_LEPBP       KAAKKAVSLGKPLVLDPVGAGASNIRNAAIRRILDAGNPTIVRGNASEILSTLSSS-GK-
THIM_SYNAS       SAALKAADRGIPIILDPVGAGATAYRTRTAFQLLETVSPTIIRGNASEILAFESVETME-
THIM_CHLT3       KAMKKAHELQKPIVFDPVGAGATPYRTQTILELIHETPPSIIRGNSSEIKALVEAG-IK-
THIM_RHOFT       LALRAAAKRGIPVVLDPVGAGATKYRNEAIEQLLMTSLPTVVRGNGSEIMSVAGSA-AQ-
THIM_LEPCP       KARRAARARGIPVVLDPVGAGATAYRNRALSGLLAAGAPTVIRGNGSEVLSVAGLG-AP-
THIM_VIBPA       YAVEQANSNGKIVVLDPVGCGASSLRTETSREIARLANKLIIRGNASEIIALAGEQ-AQ-
THIM_VIBCB       YAVEQANANGKIVVLDPVGCGASSLRTETSREIARLADKLIIRGNASEIIALAGEQ-AQ-
THIM_VIBA3       FAVEQANANNKVVVLDPVGCGASTLRTETSREIARLADKLIIRGNASEIIALAGEQ-AQ-
THIM_ALIF1       FAVEQANLNNKAVVLDPVGCGASQLRTQVARQIAEAANKLIIRANASEVIALAGEN-AQ-
THIM_ALIFM       FAVEQANLNNKVVVLDPVGCGASQLRTQVARQIAEAANKLIIRANASEVIALAGEN-AQ-
THIM_ALISL       FAVEQANLNNKVVVLDPVGCGASQLRTQTARQIAEAANTLIIRGNASEIIALAGEN-AQ-
THIM_PSYIN       FAVEQANIHKKTVVLDPVGCGASSLRTATSWQIAEAANKLIIRGNASEIIALAGEK-GQ-
THIM_PHOPR       YAVEQANANNKPVILDPVGCGASALRTNTARQIVALAEQLTIRGNASEIIALAGEQ-AQ-
THIM_BRAHW       KACETANKKNVPFVLDPVGAGATKLRTKTAIDLIKNYNPKVVRGNASEIMVLAGES-IK-
THIM_DESAH       TLMTLAARMDKPVVLDPVGSGAGAYRTGIAKALFALAPRKIIRGNASEVCSLTGTN-YT-
THIM_CHLFF       RAVDLAVRQSKPVIFDPAGSGATKIRTEVSHHIL--SHATIIRGNASEILSFGDVP-AK-
THIM_CHLCV       RAVDIAIRQNKPIIFDPVGSGTTKIRTEVSHHLL--AHSTIVRGNASKILSFGDLS-IK-
THIM_CHLAB       RTVDLAVRQNKPVIFDPVAAGATKIRTEVSHHLL--AHATIVRGNASEILSFGDVT-MK-
THIM_HERA2       QAGRAAQAKNLPIVLDPVGVGATVWRKQAALALIATVQPTILRLNLGEALALLDQT-GV-
THIM_SHIB3       AAVEQAKSSQTPWTLDPVAVGA-LDYRRRFCLELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECOSM       AAVEQAKRSQTPWTLDPVAVGA-LDYRRRFCLELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECOLU       AAVEQAKRSQTPWTLDPVAVGA-LDYRRCFCLELLSHKPTAIRGNASEIMALAGIANG--
THIM_ECO45       AAVEQATRSQTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECOK1       AAVEQATRSQTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECOUT       AAVEQATRSQTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECOL6       AAVEQATRSQTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECO7I       AAVEQATRSQTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECO81       AAVEQATRSQTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECO27       AAVEQA---QTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_ECOL5       AAVEQATRSQTPWTLDPVAVGA-LDYRRRFCVELLSHKPTAIRGNASEIMALAGVANG--
THIM_SHIBS       AAVEQAKSSQTPWTLDPVAVGA-LDYRRRFCLELLPHKPTAIRGNASEIMALAGIANG--
THIM_ECO24       AAVEQAKSSQTPWTLDPVAVGA-LDYRRRFCLELLSHKPTAIRGNASEIMALAGIANG--
THIM_ECO55       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECOSE       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECO8A       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_SHISS       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECODH       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECOLI       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECOHS       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECOLC       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECOBW       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_SHIFL       AAVEQAKSSQTRWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_SHIF8       AAVEQAKSSQTRWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ECO57       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGVANG--
THIM_ECO5E       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGVANG--
THIM_SHIDS       AAVEQAKSSQTPWTLDPVAVGA-LDYRRHFCHELLSFKPAAIRGNASEIMALAGIANG--
THIM_ESCF3       AAVVHAKRVKTPWTLDPVAVGS-LDYRRHFCTELLSLNPDAIRGNASEIMALAGVSNS--
THIM_SALPA       AAVESAYDAKTPWTLDPVAVGV-LEFRRRFCLDLLSLRPAAIRGNASEILALAGMALG--
THIM_SALPK       AAVESAYDAKTPWTLDPVAVGV-LEFRRRFCLDLLSLRPAAIRGNASEILALAGMALG--
THIM_SALAR       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALAGMALG--
THIM_SALEP       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALTY       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALG2       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALDC       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALNS       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALHS       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLPLRPAAIRGNASEILALSGMALG--
THIM_SALA4       GAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALPB       ATVESAYDAKIPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALTI       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALCH       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALPC       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_SALSV       AAVESAYDAKTPWTLDPVAVGA-LEFRRRFCLDLLSLRPAAIRGNASEILALSGMALG--
THIM_CITK8       AATEQAHIAKTPWTLDPVAVGA-LDYRRRFCLELLSLKPRAIRGNASEILALAGLAAG--
THIM_ENT38       RAIEGAMAAGKPWTLDPVAVGA-LSYRTRFCQQILSLKPAAIRGNASEILALAGMSAG--
THIM_KLEP3       AAVEHARQAGKPWTLDPVAVGA-LTVRTAFCHELLALQPAAIRGNASEILALAGMSAG--
THIM_KLEP7       AAVEHARQAGKPWTLDPVAVGA-LTVRTAFCHELLALQPAAIRGNASEILALAGMSAG--
THIM_CROS8       AAIDSACAAGKPWTLDPVAVGA-LTLRTEFAQEILARRPAAIRANASEIRALTGESGG--
THIM_SERP5       AAIEAANAAGTPWTLDPVAVGG-LAYRTAFAQSLLGEKPAAIRGNASEIMALSGLQAS--
THIM_YERE8       SAITAANQAGTPWVLDPVAVGG-LAYRTDFARHLLTLKPAAIRGNASEIMALSGMATM--
THIM_PECAS       AAVNSAHQAGTPWVLDPVAVGG-LTFRTEFCRELLTWKPAAIRGNASEIMALAGLAAQ--
THIM_PECCP       TAVNSAHQAGTPWVLDPVAVGG-LIFRSEFCRELLAWKPAAIRGNASEIMALAGLAAQ--
THIM_TOLAT       IAVQSANQAGTPWVLDPVAAGV-LPYRTELCRELLQQHPAAIRGNASEIMALAGQAAA--
THIM_LARHH       VAVAAALEAGTPWTLDPVAVGA-LAFRTQFCRELLSQRPTAIRGNPAEILALAGEASR--
THIM_LEPIN       IAAEAAHQAKIPWVLDPVAVGA-LGFRTELAKELLNFKPTVIRGNASEILALAGTDGG--
THIM_LEPIC       IAAEAAHQAKIPWVLDPVAVGA-LGFRTELAKELLNFKPTVIRGNASEILALAGTDGG--
THIM_LEPBJ       IAATVAHQTNTPWVLDPVAVGA-LGFRTETTKKLLDLKPTVIRGNASEILTLAGIAGK--
THIM_LEPBL       IAATVAHQTNTPWVLDPVAVGA-LGFRTETTKKLLDLKPTVIRGNASEILTLAGIAGK--
THIM_CLAM3       EAAHAAREAGTPWVLDPVAVGA-LPVRTRLAHELVALSPTVVRGNASEVIALATGGAG--
THIM_CLAMS       EAAHAARDAGTPWVLDPVAVGA-LPVRTRLAHELVALSPTIVRGNASEIIALATGGAG--
THIM_CORGB       KAIEGARKAGTPWVLDPVAVGG-LSERTKYAEGIVDKQPAAIRGNASEVVALAGLGAG--
THIM_CORGL       KAIEGARKAGTPWVLDPVAVGG-LSERTKYAEGIVDKQPAAIRGNASEVVALAGLGAG--
THIM_COREF       RAIEGATAAGTPWVLDPVGVGG-LAERSAFLRRAVDKHPAAIRGNASEIVALAGLGAG--
THIM_CUTAK       AAARGAASSNTPWVLDPVGVGM-SWRTRVVLDTLDVAAPAVIRANASEVLALAGTGAS--
THIM_KINRD       LAAQSADRSRTPWVLDPVAVGG-LEFRTRVARDLLASSPTVVRGNASEVLGLAGAGSG--
THIM_RHOE4       ISAEAARTAGTPWVLDPVGVGG-LPWRSGIAVDLLRFHPSAIRGNASEIIALAGLGGD--
THIM_BURP0       TAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAA--
THIM_BURTA       TAARAASETGTRWVLDPVATGAGAPEYDAIVQELLAFRPSVIRGNASELIALAGGTAA--
THIM_BURP6       TAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAA--
THIM_BURPS       TAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAA--
THIM_BURP1       TAARAASKAGTRWVLDPVALGAGAPEYDAIVRDLLALRPTVIRGNASELIALAGGTAA--
THIM_GRABC       LAMAAARQAGKPVVLDPVAVGA-LRYRTELARDLLEAKPHIVRGNASEIIALAGDGGG--
THIM_AKKM8       TAVREANRLNIPWVLDPVAVGA-LSLRTRLAGQLKEQSPRIIRGNASEIMALAGYSSV--
THIM_RHOSK       AAARGATAAGRPWVLDPVAVGA-TAFRRGLGARLLALKPTVIRGNASEILALAGAETR--
THIM_RHOS4       AAARGAAAAGRPWVLDPVAVGA-TAFRRGLGARLLALKPTVIRGNASEILALAGAETR--
THIM_RHOS1       AAARGAAAAGRPWVLDPVAVGA-TAFRRGLGARLLALKPTVIRGNASEILALAGAETR--
THIM_RHOS5       AAARGAVAAGRPWVLDPVAVGA-TAFRRGLGARLLALKPTVIRGNASEILALAGAEAR--
THIM_RHIL3       AAAKAATSAGKPWVLDPVAHYA-TAFRRNAVAELLALKPTIIRGNASEIIALAGGESR--
THIM_RHILW       AAAKATTAAGKPWVLDPVAHYA-TAFRRDAVAGLLALKPTIIRGNASEIIALAGGESR--
THIM_RHIE6       AAAKAAASSGKPWVLDPVAHYA-TAFRRQAVADLLALKPTIIRGNASEIIALAGGESR--
THIM_RHIEC       AAAKAAASAGKPWVLDPVAHYA-TTFRRQAVADLLALKPTIIRGNASEIIALAGGESR--
THIM_AGRRK       SAAQAANKAGKPWVLDPVAHYA-TSFRRRSVAQLLELQPTIIRGNASEIIALAGGTSR--
THIM_ROSDO       AAAATASAQNIPWVLDPVAHFI-SVYRREAAQQLLAQRPTILRGNASEILALTGETGA--
THIM_GEMAT       AAIDGATAVGTPWVLDPVAHYA-SAYRSAVARDLLSRRPTILRGNASEILALAGGNTA--
THIM_PSYWF       ATAKMAHSKGIPWVLDPVAVGA-TAFRQQACRQLLSLQPDVIRGNASEILALAGMSSQ--
THIM_BIFLO       EIAQRLNYLDKPWVLDPVA-AGIGRTRTAILQAFKAAPPTMIRANASEVIALANMWGLNT
THIM_BIFLD       EIAQRLNYLDKPWVLDPVA-AGIGRTRTAILQAFKAAPPTMIRANASEVIALANMWGLNT
THIM_BIFLS       EIAQRLNYLDKPWVLDPVA-AGIGHTRTAILQTFKAAPPTMIRANASEVIALANMWGLNT
THIM_BIFAA       EIARKLHENGKTWVLDPVA-AGIGETRTAILESFRDVPPTIVRGNASEIIALDAMWGL-A
THIM_BIFA0       EISEHLSRHGCKWVLDPVA-AGVGVARTEILKGFKDYPPTVIRANASEALVLHDMWQL-G
THIM_DICNV       MSAQVAHDHGKWWVFDPAAVSDILSYRSGFARELLRYYPRVIRGNASEISYLNDTYGR--
THIM_ACIBY       ISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQ--
THIM_ACIB3       ISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQ--
THIM_ACIB5       ISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQ--
THIM_ACIBT       ISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQ--
THIM_ACIBS       ISAKTAQLNNVPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQ--
THIM_ACIBC       ISAKTAQLNNIPWVLDPVGYGPILAWRSQMTDELLQFKPSVIRGNASEISTLAGNQVQ--
THIM_ACIAD       ISAKTAHEHDIPWVLDPVGYGPILKWRSDMVDELLQYHPSVIRGNASEIGALAGSLVQ--
THIM_LACCB       AAGKFAQATNQPTVIDLVGVSA-TQLRYDLGHQLLANHPNVVKGNISEMRRFADLKST--
THIM_LACP3       AAGKFAQATNQPTVIDLVGVSA-TQLRYDLGHQLLVNHPNVVKGNISEMRRFADLKST--
THIM_ENTFA       AASDYARQVNKLTVVDLVGYGA-SDIRNEVGEKLVHNQPTVVKGNLSEMRTFCQLVSH--
THIM2_LEUMM      QASSLADMTKKPTVVDLVGYGI-TNERTKLGMAMARNHPTVIKGNTSEIRRFVGLPSL--
THIM2_STRP2      MAASYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRPN      MAASYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRR6      MAASYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRPI      MAASYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRP7      MAASYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVIKGNMSEIRSLVGLKHH--
THIM2_STRZP      MAASYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRPJ      MAALYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRPS      MAALYANQSSLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRZT      IAASYAAQVCLPMVVDAVGVTT-SSIRKSLVKDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRZJ      IAASYAAQVCLPMVVDAVGVTA-SSIRKSLVRDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM2_STRP4      IAASYAAQVCLPMVVDAVGVTA-SSIRKSLVRDLLDYRPTVLKGNMSEIRSLVGLKHH--
THIM_THEP3       KAGKAANRLKVPVILDPVGAGATKLRTQSSKKILEEVKISVIKGNSAEISIL--------
THIM_THEPX       KAGKAANRFKVPVILDPVGAGATKLRTQSSKKILEEVKISVIKGNSAEISIL--------
THIM_CALS4       KAGKTANQHGVPVILDPVGAGATSLRTKSAKRIIEEVRVSVIKGNSAEISTL--------
THIM_METBF       LSAAAANEKKIPVVLDAVGVGATKFRDEMAAKILGSVRVDIIKGNYSEIAKL--------
THIM_METMA       LSAAAANKKKIPVVLDAVGVGATRFRDEMAAKILGSVRVDIIKGNYSEIAKL--------
THIM_METAC       LSAAAANERDIPVVLDAVGVGATKFRDEMAAKILASVHIDIIKGNYSEIAKL--------
THIM_METAR       AAGHRANELNIPIILDPVGAGATRLRTETAKTLLHKLHVSVLKGNAGEIATL--------
THIM_METPE       IAGRAANDLEVPVILDPVGAGATMLRTESARRLLTELQVAVVKGNAGEIGLL--------
THIM_METMJ       IAGRRANELGIPVVLDPVGVGATEFRTATARKLLDTLDIAVLKGNAGEIGVL--------
THIM_METB6       LAGKVANERKIPIILDPVGAGATRLRTDSTRRLLDELTISIIKGNAGEIGVL--------
THIM_METHJ       IAAKAAEKYGIPIILDPVGAGATSLRTKTAQRMIQELSISVLKGNAGEIGTL--------
THIM_METLZ       AAANEAKKCGIPIVLDPVGAGATLYRTQTAERFMNEFPLAVIKGNAGEIGTL--------
THIM_RUBXD       AAGRAANERGIPVILDPVGAGATALRTRTAGRLLSELEVSAVCGNAGEIATL--------
THIM_MOOTA       LAGKAANNAGIPVVFDPVGAGATPFRTRTAQKIIKELHIDILRGNASEIASI--------
THIM_DESOH       MAGKVAEQRGIPIVLDPVGSGATPLRTGAAKKILAEVGVNVIRGNASEVMSLF----A--
THIM_DESPS       MASQRANTLKTPIILDPVGSGATAFRTASAKRIIAEAKVSVIRGNASEILSL--------
THIM_CHLAA       IAGRRANELGIPIVLDPVGAGATSLRTASNRRLLEELQIAVVRGNSGEIGAL--------
THIM_CHLSY       IAGRRANELGIPIVLDPVGAGATSLRTASNRRLLEELQIAVVRGNSGEIGAL--------
THIM_CHLAD       IAGKRANELGIPIVLDPVGAGATSLRTSSNRRLLETLQVAVIRGNSGEIGAL--------
THIM_ROSS1       IAGRRANELQTPVVLDPVGAGATQLRTRTNLELLRSLRIAVVRGNGGEIGAL--------
THIM_ROSCS       VAGRQANELDIPIVLDPVGAGATQLRTMTNLKLLRSLHIGVVRGNGGEIGAL--------
THIM_DESAP       LAGRRANESGIPVVLDPVGAGATAYRTETCLRLLGGLRVAVIRGNSGEIGTL--------
THIM_DESAL       KAGKTANDKGIPIILDPVGAGATSYRTETCHRLLEELSVSVIRGNLGEVSIL--------
THIM_SYNFM       LASRAAIERSIPVVLDPVGAGATAFRTDTARRLLDEFGITVLRGNASEIMAL--------
THIM_NATPD       VAGTAANEGDKPLVVDPVGVGATPTRTRVANRLLDELDVTILNGNHGEITAL--------
THIM_HALWD       TAGQAASEHDAGLVLDPVGAGATATRSRVAERLSTTLDVDVINGNRGEVAAL--------
THIM_PYRAB       KAVEIANEMKKPIVLDPVGAGATKLRTKVALEILDRG-VTVLKGNFGEISSL--------
THIM_PYRHO       KATEIANELGKPIVLDPVGAGATKFRTRVSLEILSRG-VDVLKGNFGEISAL--------
THIM_PYRFU       KAAKLAKEYGKPLVLDPVGAGATRLRTKTALEVLKIG-ATIVKGNFGEISAL--------
THIM_METM5       KAAKIASDLKKPIILDPVGAGATKLRTKTALKILDFADISVLRGNFGEIAAV--------
THIM_METM7       KAAKIATDLKKPIILDPVGAGATKLRTKTALKILDFADISVLRGNFGEIAAV--------
THIM_METM6       KAAKIASDLKKPIILDPVGAGATKLRTNTALKILDFADISVLRGNFGEIAAV--------
THIM_METMP       KAAKIASDLKKPIVLDPVGAGATKLRTKTALKILDFADISVLRGNFGEIAAV--------
THIM_METVS       KAVKIASDLKKPIILDPVGAGATKLRTNTALKLLDIGNVSVLRGNFGEISAL--------
THIM_COPPD       SAAHTAKRLGKPAILDPVGYGATKLRINLVERLLETGAFSLVKGNGGEISLL--------
THIM_CALMQ       IAGKAASRNNVPILLDPVGAGATRYRTEVVKRILSETEVSVVKGNGGEMLAL--------
THIM_ARCFU       LAVKSAKSKGVPVLLDPVGSGATKLRTSTALSV-AEEGVDVIKGNQGEILSL--------
THIM_CLOTE       LAGKKANELNIPVILDPVGVGATKYRTSIALELLEEIKFSVVRGNISEVKVL--------
THIM_ALKOO       LAGKKANELNIPVILDPVGAGATAFRSQTIEKILKEVKLSVLRGNMSEIKNI--------
THIM_CLOB8       ASGKKANELNIPVVFDPVGAGASEFRNSTTKRLLEEVKISVLRGNMSEIKFI--------
THIM_RUMCH       LSGKKANEKGIPVIFDPVGAGASALRNETTSTILDKIKISVLRGNLSEISYI--------
THIM_CLOBA       LAGKSANKNNVPVIFDPVGAGVANFRNKSAEKILSEVKVDIIRGNISEIKFI--------
THIM_CLOBB       LAGKSANKNNVPVIFDPVGAGVANFRNESAEKILSEVKIDIIRGNISEIKFI--------
THIM_ALKMQ       LAGRKANELGIPVILDPVGVGASTFRKDTVNQLLKNIDFTVIRGNASEMQVL--------
THIM_EXIS2       LAGKTANRLGKPVILDPVGAGATTLRTDFMKQLMEEITFTVIKGNASEIKTL--------
THIM_CLOD6       LAGKAANKYNKPVVLDPVGVFASKARAELTSRLLNEVKFSVVKGNVSEIKFI--------
THIM_CLOAB       KAGKMANKLKHPVILDPVGVGASKLRRQTALKLLEEVKFTVIRGNISEIKVL--------
THIM_DESDA       VAGRRANSMGKPVVLDPVGAGASALRNSTLQRLLGEVRFAAIKGNASEIGFL--------
THIM1_METST      KSAKFAIENNKPFILDPVGVGISNIRNQTPIDIITNSKPSIIRGNLSEIKAIAMMYDI--
THIM2_METST      IAACHTKKTNTPLVLDPVAVGVSKLRNDITIDLINKSSVDVIRGNMSEIKAIANLFNI--
THIM_METS3       ISSAQANKINTPVILDPVGVGISQLRNKVTLEIIENYKLAAIRGNITEIKTIAKLTGI--
THIM_CLOPE       ISMKIAKEKGIPSVLDPVGVQASKLRRDFAKKIILEGEPSLIKGNLAEIKTL--------
THIM_CLOPS       ISMKIAKEKGIPSVLDSVCVQVSKLRRDFAKKIILEGEPSLIKGNLAEIKTL--------
THIM_CLOP1       ISMKIAKEKGIPSVLDPVGVQASKLRKDFAKKLILEGEPSLIKGNLAEIKTL--------
THIM2_CLOB6      ISGKTAYENKIPQVIDLVGVGCSKLRLDYARKFISECHPNVIKGNMSEIKAI--------
THIM2_CLOBK      ISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFILECHPNVIKGNMSEIKAI--------
THIM2_CLOBL      ISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAI--------
THIM2_CLOBJ      ISGKISYEKKIPQVIDLVGVGCSKLRLDYAKKFILECHPNVIKGNMSEMKAI--------
THIM1_CLOBM      ISGKTSYEKKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAI--------
THIM2_CLOB1      ISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAI--------
THIM2_CLOBH      ISGKTAYENKIPQVIDLVGVGCSKLRLDYAKKFISECHPNVIKGNMSEIKAI--------
THIM_FINM2       KSVRIANENNIPITLDLVGVSASKLRLDLTLDILKNHTITCIKGNYSEIKSL--------
THIM_CAMLR       ESAKFYGNLNKAIVLDPVALGVSMARDAINLKLLNSYKISIIKANASEIASV--------
THIM_DESHY       LAIRGATLKGIPVILDPVACGAIPRKKATIERLGHFGRFTVIKGNLGEVKAL--------
THIM_DESHD       LAIRGATLKGIPVILDPVACGAIPRKKATIERLGHFGRFTVIKGNLGEVKAL--------
THIM1_CLOB1      LASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFL--------
THIM1_CLOBH      LASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFL--------
THIM1_CLOBK      LASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFL--------
THIM1_CLOBJ      LASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFL--------
THIM1_CLOB6      LASISAKNHNVPVVIDPVGCPAIKRKVEVINRMAEVGRIDIIKGNIGEIKFL--------
THIM1_CLOBL      LASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFL--------
THIM2_CLOBM      LASISAKNHNVPVVIDPVGCPAIKRKVEVINRIAEVGRIDIIKGNIGEIKFL--------
THIM_CLOK1       LAAVSAKTHNIPVVLDPVACAAIPKKIQFIDKLFKVGRVDVIKGNIGEIKFL--------
THIM_CLOK5       LAAVSAKTHNIPVVLDPVACAAIPKKIQFIDKLFKVGRVDVIKGNIGEIKFL--------
THIM_CLONN       MVCISAKNNNIPVVLDPVACGAVPHKIALIEKLFEIGRIDIIKGNIGEIKSL--------
THIM_SYNWW       EGRWAAASRDVPLILDPVACGVIGRKVDLIERIKSLGKIQVLKGNIAEIKSL--------
THIM_NATTJ       LAAEKASELEIPIVLDPVGAVAIKSRLDLVKDLLTNYNVSCIKGNNAEIKCL--------
THIM_LACPL       VVGKLANQYHKPVVLDPVAVGAVPYRKEVALALLSDFQVDVIRGNAGEIAALAG------
THIM_LACBA       TVGQQANAQHKPLVIDPVAVGAVQYRKQVATGLLADFHPDVIRGNAGEIAALAD------
THIM_LACSS       TLMAEAYRQAKPVVIDPVAVSSIHYRQKIIDELLALGTPQIIRGNAGEIAYLAG------
THIM_LACF3       AVMEAAKKYHKPTVLDPVACGATMYRLRVVTELLHQYHFTVIRGNAGEIATLAG------
THIM_PEDPA       KLCEAANQYQKPLVLDPVAVGATQYRKALNLMLLEKYHFDVIRGNIGEIAVLAG------
THIM_LACRJ       TVLRAATPL-KPLVLDPVAVSAVPSRLKFAHSLLNDFHFDVIRGNASEIAALVE------
THIM_LACRD       TVLRAATPL-KPLVLDPVAVSAVPSRLKFAHSLLNDFHFDVIRGNASEIAALVE------
THIM_LACLM       EACRLANQKAKPLILDPVAVNIP-FRASIVKRLSQEVKFNIIRGNSAEIAWFAD------
THIM_LACLS       EACRLANQKAKPLILDPVAVNVP-FRASIVKRLSQEVKFNIIRGNSAEIAWFAD------
THIM_LACLA       TICQLANQKHKPLILDPVAVNVP-FRANFVKRLMQEVKFDIIRGNSAEIAWFAD------
THIM1_LEUMM      KLSQEAYQLGKPVVLDPVAVSVP-FRSKAITQFLASGHVDVIRGNAAEIAWFAD------
THIM_LEUCK       KLIQIANQTQTVVVLDPVAVGIP-SRSVPVQELLTNSKVDIIRGNAAEIAWFAG------
                               .*                         :  *  :            

THIM_GEOTN       ------ESWMIKGVDAGEGSG-------DVVALAKRAAAKL-------------------
THIM_GEOKA       ------EAWTIKGVDAGGGSG-------DRVALAKRAAEQL-------------------
THIM_GEOSW       ------ESWTIKGVDAGEGSG-------DVVSLAKKAAKQL-------------------
THIM_BACC4       ------EKWEIKGVDAGTGNG-------DVVSIARQAADEL-------------------
THIM_BACCR       ------ERWEIKGVDAGTGNG-------NVVSIARQAADEL-------------------
THIM_BACC2       ------EKWEIKGVDAGTGNG-------NVVSIARQAADEL-------------------
THIM_BACCQ       ------ERWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACC7       ------ERWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACC1       ------ERWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACAH       ------EKWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACC3       ------EKWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACAA       ------EKWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACC0       ------EKWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACAN       ------EKWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACAC       ------EKWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACHK       ------EKWEIKGVDAGVGNG-------NVVSIAKQAADEL-------------------
THIM_BACCZ       ------EKWEIKGVDAGAGNG-------NVVSIAKQAADEL-------------------
THIM_BACMK       ------EKWEIKGVDAGTGNG-------NVVNIAKQAADEL-------------------
THIM_BACCN       ------EKWEIKGVDAGTGNG-------DSVAIATKAANKL-------------------
THIM_BREBN       ------ERWEIKGVDAKEAGG-------DVEDLARAAAKKL-------------------
THIM_BACSU       ------TDWLIKGVDAGEGGG-------DIIRLAQQAAQKL-------------------
THIM_BACVZ       ------PDWKIKGVDAGEAGG-------DVVQLAKTAASGL-------------------
THIM_BACLD       ------EDWLIKGVDAGEESG-------DRTELAKKAAKLW-------------------
THIM_BACP2       ------DGWESKGVDAKAANG-------DVSALVKQAAKTL-------------------
THIM_ANOFW       ------EQVRTKGVDAGDVQS-------DLVDVAKKAAHMF-------------------
THIM_BACHD       ------QAGTVKGVDGSIDS--------DPVELAKHAANVL-------------------
THIM_BACSK       ------QAGTVKGVDGKINA--------DVKELCLQAAKAL-------------------
THIM_LISMC       ------EAWEAKGVDAGVGS-------ADVLSIAEKVANEW-------------------
THIM_LISMF       ------EAWEAKGVDAGVGS-------ADVLSIAEKVANEW-------------------
THIM_LISIN       ------EAWEAKGVDAGVGS-------ADVLSIAEKVANEW-------------------
THIM_LISMO       ------EAWEAKGVDAGVGS-------ADVLSIAGKVANEW-------------------
THIM_LISMH       ------EAWEAKGVDAGVGS-------ADVLSIAEKVANEW-------------------
THIM_LISW6       ------EAWEAKGVDAGVGS-------ADVLAIAEKVAKEW-------------------
THIM_HAEIN       ------ETWQAKGVDAGQGE-------VDLKAVAEKVAQRY-------------------
THIM_HAEI8       ------ETWQAKGVDAGQGE-------VDLKAVAEKVAQRY-------------------
THIM_HAEIG       ------EAWQAKGVDAGQGE-------VDLKAVAEKVAQRY-------------------
THIM_HAEIE       ------EAWQAKGVDAGKGE-------VDLKAVAEKVAQRY-------------------
THIM_HAES1       ------VQWSTKGVDAGKGM-------ADIAEIAHLVARKY-------------------
THIM_PASMU       ------VNWQAKGVDAGSGE-------ADLAQIAHIVAKTY-------------------
THIM_HAEPS       ------VQWASKGVDAGQGS-------GNLAEIAQKVAQKF-------------------
THIM_ACTSZ       ------TDWQGKGVDAGTGADS-----ENLSRLAQSVAQKY-------------------
THIM_EXISA       ------VDWAARGVDAGDGA-------CEPRQLALEAAKRY-------------------
THIM_LYSSC       ------VEWQQKGVDSGDGF-------IDIETEATLLAQRY-------------------
THIM_STAEQ       ------FNTTMKGTDSDSEL--------DSVNIAKKAANTL-------------------
THIM_STAES       ------FNTTMKGTDSDSEL--------DSVNIAKKAANTL-------------------
THIM_STAHJ       ------ATTTMKGTDGKTDL--------DVVEIAKRAHEEL-------------------
THIM_STAA3       ------DTATMKGTDSDANL--------DAVAIAKKAYATY-------------------
THIM_STAAE       ------DTATMKGTDSDANL--------DAVAIAKKAYATY-------------------
THIM_STAA8       ------DTATMKGTDSDANL--------DAVAIAKKAYATY-------------------
THIM_STAAC       ------DTATMKGTDSDANL--------DAVAIAKKAYATY-------------------
THIM_STAAW       ------DTATMKGTDSDANL--------DAVTIAKKAYATY-------------------
THIM_STAAS       ------DTATMKGTDSDANL--------DAVTIAKKAYATY-------------------
THIM_STAAM       ------DTATMKGTDSDANL--------DAVAIAKKAYAIY-------------------
THIM_STAA9       ------DTATMKGTDSDANL--------DAVAIAKKAYAIY-------------------
THIM_STAAN       ------DTATMKGTDSDANL--------DAVAIAKKAYAIY-------------------
THIM_STAA2       ------DTATMKGTDSDANL--------DAVAIAKKAYAIY-------------------
THIM_STAA1       ------DTATMKGTDSDANL--------DAVAIAKKAYAIY-------------------
THIM_STAAR       ------DTATMKGTDSDANL--------DAVTIAKKAYAIY-------------------
THIM_STAAB       ------DTATMKGTDSDAYL--------DAVAIAKKAYAIY-------------------
THIM_STAS1       ------NDAKMKGTDSDDNL--------NAIEIAKEAHKRL-------------------
THIM_STACT       ------DTATMKGTDSADNL--------DVVDIAEKAYKEY-------------------
THIM_MACCJ       ------D-ATMKGTDADQSL--------STESVARRAYDKF-------------------
THIM1_STRPS      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRPJ      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRP2      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRR6      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRP4      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRP7      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRZP      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRZT      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRPI      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRZJ      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM1_STRPN      ------IDVASKGVDSAGVD--------NIDEIALAANEKF-------------------
THIM_STRSY       ------ESIETKGVDSAQID--------NVGELALRANQQL-------------------
THIM_STRS2       ------ESIETKGVDSAQID--------NVGELALRANQQL-------------------
THIM_STRA1       ------EKQASKGADGGKVA--------DLESIAVKANQVF-------------------
THIM_STRA5       ------EKQASKGADGGKVA--------DLESIAVKANQVF-------------------
THIM_STRA3       ------EKQASKGADGGKVA--------DLESIAVKANQVF-------------------
THIM_HELPG       ------ISCESKGLDSHDAT--------TPVEIIKRAAQKY-------------------
THIM_HELPY       ------ISCESKGLDSNDAA--------TPVEIIKLAAQKY-------------------
THIM_HELPH       ------ISCESKGLDSQDAN--------TPVEIIKRVAQKY-------------------
THIM_HELPS       ------ISCGSKGLDSHYAT--------TPIEIVKLVAQKY-------------------
THIM_HELPJ       ------ISCESKGLDSKHSA--------TPIEIVKRAAQKY-------------------
THIM1_OCEIH      ------INLEAKGVDSIGDG--------NLDVIAQKVSEKY-------------------
THIM_CARHZ       ------NSAQVKGVDSQTSD--------FAAENLTEVAKRY-------------------
THIM_DESRM       ------ITGQTKGVDSLSNQ--------ISVKHLAEFANTT-------------------
THIM2_OCEIH      ------KLEKAKGPDSIIQE--------NEPEIAKTVAKKY-------------------
THIM_DESVV       ----------TRGVDSARTAH-----------EAVDGARALARRYG--------------
THIM_DESVH       ----------TRGVDSARTAH-----------EAVDGGRALARRYG--------------
THIM_DESVM       ----------TRGVDSTRDAH-----------AAADSARALSRRHH--------------
THIM_DESAG       ----------TKGVDSIHQAA-----------DAADAARELAGKFG--------------
THIM_DESMR       ----------SKGADSQHASR-----------EAAPAAVALARSLG--------------
THIM_LEPBA       ----------TKGVDATDSSE-----------SAVETGKSLSKVTG--------------
THIM_LEPBP       ----------TKGVDATDSSE-----------SAVETGKSLSKVTG--------------
THIM_SYNAS       ----------TRGVDSTELSQ-----------NAVDAGRRLNDSYG--------------
THIM_CHLT3       ----------TKGVDSTESSE-----------SAIEAAKHLSQKYG--------------
THIM_RHOFT       ----------TRGVDSSAAAT-----------DALGAAQSLVQRTQ--------------
THIM_LEPCP       ----------TRGVDSTLSSN-----------DAVAAAQTLSRRIG--------------
THIM_VIBPA       ----------SKGVDALDSSD-----------AALGAAHFLVKEYG--------------
THIM_VIBCB       ----------SKGVDALDSSD-----------AALGAANFLVAEYG--------------
THIM_VIBA3       ----------SKGVDALDSSD-----------AALGAAQCLVAEYG--------------
THIM_ALIF1       ----------SKGVDALDSSD-----------SAVGAACYVAQKYQ--------------
THIM_ALIFM       ----------SKGVDALDSSD-----------SAVGAACYVAQKYQ--------------
THIM_ALISL       ----------SKGVDALDSSD-----------SALGAACYVAQQYQ--------------
THIM_PSYIN       ----------SKGVDSLDSSE-----------AALGAARYLRDTYQ--------------
THIM_PHOPR       ----------SKGVDALDSSD-----------KAIHAAHHLATQNN--------------
THIM_BRAHW       ----------TKGVDSTANVN-----------MALEAGKHLAKEYN--------------
THIM_DESAH       ----------TRGIDNTLDLE-----------HARQILAGHGRTHGDGEETGTDEPGWPS
THIM_CHLFF       ----------TRGMDSANATH-----------DAKDIAVALASECLCG------------
THIM_CHLCV       ----------TRGVDSANTTH-----------DAKETAIALANECLCG------------
THIM_CHLAB       ----------TRGVDSTHSTQ-----------DAKDVATALAKECLCG------------
THIM_HERA2       ----------AHGVDVGHAWH-----------DPRLVAGQLARRYG--------------
THIM_SHIB3       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOSM       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOLU       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO45       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOK1       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOUT       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOL6       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO7I       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO81       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO27       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOL5       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_SHIBS       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO24       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO55       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOSE       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO8A       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_SHISS       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECODH       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOLI       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOHS       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOLC       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECOBW       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_SHIFL       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_SHIF8       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ECO57       ----------GRGVDTTDAAV-----------NAIPAAQTLARE----------------
THIM_ECO5E       ----------GRGVDTTDAAV-----------NAIPAAQTLARE----------------
THIM_SHIDS       ----------GRGVDTTDAAA-----------NAIPAAQTLARE----------------
THIM_ESCF3       ----------GRGVDSTDVVA-----------NALPAAVMLAQE----------------
THIM_SALPA       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALPK       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALAR       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALEP       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALTY       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALG2       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALDC       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALNS       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALHS       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALA4       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALPB       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALTI       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_SALCH       ----------GRGVDTTEAAL-----------AALPAAQALAHQ----------------
THIM_SALPC       ----------GRGVDTTEAAL-----------AALPAAQALAHQ----------------
THIM_SALSV       ----------GRGVDTTEAAL-----------AALPAAQALARQ----------------
THIM_CITK8       ----------GRGVDTTDTAV-----------SALPAAQALARQ----------------
THIM_ENT38       ----------GRGVDTTDTAS-----------SALPAAIALARQ----------------
THIM_KLEP3       ----------GRGVDTTDTAA-----------AALPAAQALARR----------------
THIM_KLEP7       ----------GRGVDTTDTAA-----------AALPAAQALARR----------------
THIM_CROS8       ----------GRGVDATESAH-----------QAREAARLLARR----------------
THIM_SERP5       ----------GRGVDSADDSL-----------AALPAARELARN----------------
THIM_YERE8       ----------GRGVDSVDTSL-----------AALPAARQLAQR----------------
THIM_PECAS       ----------GRGVDSADDSL-----------AALPAARELARQ----------------
THIM_PECCP       ----------GRGVDSADDSL-----------AALPAARELARQ----------------
THIM_TOLAT       ----------GKGVDSANQSD-----------QAIEAAQVLAKS----------------
THIM_LARHH       ----------GRGVDSLDDST-----------VALAAARRLADA----------------
THIM_LEPIN       ----------GKGVDSTALSS-----------DALPLAQMLAEK----------------
THIM_LEPIC       ----------GKGVDSTALSS-----------DALPLAQMLAEK----------------
THIM_LEPBJ       ----------GKGVDSTVNSK-----------DALPYAQELSGK----------------
THIM_LEPBL       ----------GKGVDSTVNSK-----------DALPYAQELSGK----------------
THIM_CLAM3       ----------GRGVDATDEVE-----------AALDAATLLART----------------
THIM_CLAMS       ----------GRGVDATDEVE-----------AALDAASLLART----------------
THIM_CORGB       ----------GRGVDATDSVE-----------AALEAAQLLAKR----------------
THIM_CORGL       ----------GRGVDATDSVE-----------VALEAAQLLAKR----------------
THIM_COREF       ----------GRGVDATDDVA-----------DAVEAAQVLARR----------------
THIM_CUTAK       ----------SRGPEAGDAVE-----------DALASATQLVRH----------------
THIM_KINRD       ----------GRGVDSTAGAE-----------EAVEAARELSRR----------------
THIM_RHOE4       ----------TRGVDSASDSA-----------DAVPAALSLLTH----------------
THIM_BURP0       ----------GKGVDTTASPE-----------SALAFIGDLARR----------------
THIM_BURTA       ----------GKGVDTTASSD-----------SALAYIGDLARR----------------
THIM_BURP6       ----------GKGVDTTASPE-----------SALAFIGDLARR----------------
THIM_BURPS       ----------GKGVDTTASPE-----------SALAFIGDLARR----------------
THIM_BURP1       ----------GKGVDTTASPE-----------SALAFIGDLARR----------------
THIM_GRABC       ----------GRGVDSLVSST-----------AALEAASILARR----------------
THIM_AKKM8       ----------TKGPESTSSSA-----------DALHAARELALH----------------
THIM_RHOSK       ----------GKGADSADPVA-----------AAEAAAQRLAES----------------
THIM_RHOS4       ----------GKGADSADPVA-----------AAEAAAQRLAES----------------
THIM_RHOS1       ----------GKGADSADPVA-----------AAEAAAQRLAES----------------
THIM_RHOS5       ----------GKGADSADTVA-----------AAEAAAQRLAEG----------------
THIM_RHIL3       ----------GQGVDSRDPVE-----------QAEGSARWLAER----------------
THIM_RHILW       ----------GQGVDSRDPVE-----------QAEGSARWLAER----------------
THIM_RHIE6       ----------GQGVDSRDPVE-----------QAEDSARRLAER----------------
THIM_RHIEC       ----------GQGVDSRDPVE-----------QAEDSARRLAER----------------
THIM_AGRRK       ----------GQGVDSRDPVE-----------LAEEAAVQLAQK----------------
THIM_ROSDO       ----------GKGADSGDSVD-----------AAQGAAKKLAAQ----------------
THIM_GEMAT       ----------ARGVDAADPVT-----------AAGAAASALARE----------------
THIM_PSYWF       ----------SRGIDSGDSVA-----------AAHAAAEALT-Q----------------
THIM_BIFLO       ETVGDASEHRPAGVESVDDVE-----------SATGAAVALAQYLTEQHAKHSSH-----
THIM_BIFLD       ETVGDASEHRPAGVESVDDVE-----------SATGAAVALAQYLTEQHAKHSSH-----
THIM_BIFLS       ETVGDASEHRPAGVESVDDVE-----------SATGAAVALAQYLTEQHAKHSSH-----
THIM_BIFAA       DADSTTPATRPAGVEAVDEVD-----------AAVDAAKRLARHLAKR------------
THIM_BIFA0       DAAGTDEHNGPAGVEAADSVD-----------AAITAATDLAAYLALH------------
THIM_DICNV       -----------RSFENVMSSS-----------EAIEAAVKLAIH----------------
THIM_ACIBY       ----------SKGVDSTLSSD-----------QAYQQAFSLLTH----------------
THIM_ACIB3       ----------SKGVDSTLSSD-----------QAYQQAFSLLTH----------------
THIM_ACIB5       ----------SKGVDSTLSSD-----------QAYQQAFSLLTH----------------
THIM_ACIBT       ----------SKGVDSTLSSD-----------QAYQQAFSLLTH----------------
THIM_ACIBS       ----------SKGVDSTLSSD-----------QAYQQAYVLLAH----------------
THIM_ACIBC       ----------SKGVDSTLSSD-----------QAYQQAYALLAH----------------
THIM_ACIAD       ----------SKGVDSTLKSD-----------EMFQLAHNLLTK----------------
THIM_LACCB       ----------GRGVDGSQLDQSAT-ALG----ELAASLQQLTQAF---------------
THIM_LACP3       ----------GRGVDGSQLDQSVT-ALG----ELAASLQQLTQAF---------------
THIM_ENTFA       ----------GRGVDGSPLDQSEE-AIE----ELIQALRQQTQKF---------------
THIM2_LEUMM      ----------AKGIDGASSDQHDQ-ALK----DLILSLKQITTEY---------------
THIM2_STRP2      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRPN      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRR6      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRPI      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRP7      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRZP      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRPJ      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRPS      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRZT      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRZJ      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM2_STRP4      ----------GVGVDASAKDQ----ETE----DLLQVLKDWCQTY---------------
THIM_THEP3       ----AGKGGKIRGVESQSGADDI-------SEAAKDLANAY-------------------
THIM_THEPX       ----AGKGGKIRGVESQGGVDDI-------AEAAKDLANAY-------------------
THIM_CALS4       ----SGRTGKIRGVEAVEEEEDI-------SDIAYDLAVKC-------------------
THIM_METBF       ----AGESAETKGVEATSINADP-------VKIAKQFAKLS-------------------
THIM_METMA       ----AGENAETKGVESTSISADP-------QKVAKEFAKSS-------------------
THIM_METAC       ----AGENAETKGVEATSIDADP-------AKVAKAFAKAE-------------------
THIM_METAR       ----AGAEGKVRGVDSAGVSGDP-------AEFARGLAEKL-------------------
THIM_METPE       ----AGAAGRVRGVDSAGLDGDP-------VAVCKSLVNAY-------------------
THIM_METMJ       ----AGTGGSVRGVDSGGVAGDP-------VETARECARST-------------------
THIM_METB6       ----AGAEAKVRGVDSAGISGDP-------VTITRTFARET-------------------
THIM_METHJ       ----AGKQAQVRGVDSGGVNGDP-------TEITCGLAERL-------------------
THIM_METLZ       ----AGVSATVRGVDSGNISGDP-------KEIAHSLAKEY-------------------
THIM_RUBXD       ----AGLAAEVRGVES--IGGDA-------REAALKAASSL-------------------
THIM_MOOTA       ----GGFGGHTKGVDAAGAPARV-------AEMVKQVARDL-------------------
THIM_DESOH       ----DKETVNIRGVDSLETVDAV-------RHEAGLLAGEL-------------------
THIM_DESPS       ----GSEQSNTRGVDTSQSVSDA-------AQTASLLAREL-------------------
THIM_CHLAA       ----AGMGGVVKGVETVVEVDDP-------TAAAKALAQQY-------------------
THIM_CHLSY       ----AGMGGVVKGVETVVEVDDP-------TAAAKALAQQY-------------------
THIM_CHLAD       ----AGMGGVVKGVEAVVEADDP-------LAAAQVLARQY-------------------
THIM_ROSS1       ----SGEGGEVKGVESVSGPEDP-------LTAARRLAQTY-------------------
THIM_ROSCS       ----SGAGGEMRGVESIAAPENP-------LTAARTLAQTY-------------------
THIM_DESAP       ----SGAGGVVRGVESVEGVANP-------AAAAGVLAHRY-------------------
THIM_DESAL       ----AGLGGEVKGVESVSAGGDA-------VDVAKALAAKQ-------------------
THIM_SYNFM       ----AGLNSTTRGVDSVHATDEA-------RSAAVELANVY-------------------
THIM_NATPD       ----AGDDADVRGVESVGEYADI-------AETALSCARTH-------------------
THIM_HALWD       ----VGEDAEVRGVESVGEHPDA-------AETAIACAQHT-------------------
THIM_PYRAB       ----LGEFGKTRGVDSSEYDEEKA------KVLALSAAKEF-------------------
THIM_PYRHO       ----LGEEGKTRGVDSLEYGEEEA------KKLTMNAAREF-------------------
THIM_PYRFU       ----LGEEGKTRGVDSSTYDPERA------KELALAVAEEF-------------------
THIM_METM5       ----LGEHGKTRGVDSAAYDSNEA------IELSKNAAKEF-------------------
THIM_METM7       ----LGEHGKTRGVDSVAYDSNEA------IELSKNAAKEF-------------------
THIM_METM6       ----LGEHGKTKGVDSAAYDSNEA------IELSKNAAKEF-------------------
THIM_METMP       ----LGEHGKTRGVDSAAYDSNEA------IELSKNAAKEF-------------------
THIM_METVS       ----LGEHGKTKGVDSAVYDNNEA------LNISKNASKEF-------------------
THIM_COPPD       ----AGERAEVRGVDSVGSPP--A------AIAAKTVAQKY-------------------
THIM_CALMQ       ----AGVTGGVKGVDSIVNAT---------MDTAVKIAEEY-------------------
THIM_ARCFU       ----LRKEGVVRGVDSKVTAE---------AADVKEVARKF-------------------
THIM_CLOTE       ----SGMNASTKGVDAESWDE--TNPIEERIRLVKSLSEKY-------------------
THIM_ALKOO       ----YGTGTQTKGVDSVD------SSLDGGKEIAISLAKKL-------------------
THIM_CLOB8       ----SGLGSTTKGVDASENDA--RTGNDEGIDVAKNLAKKL-------------------
THIM_RUMCH       ----AGRNASTKGVDASEADI--QS--NDSIAVAKAAAVKL-------------------
THIM_CLOBA       ----CGLRSETKGVDASERDM--NMGNDKKVIVAQELAKKL-------------------
THIM_CLOBB       ----CGLSSETKGVDASESDM--NMGNDKKAIVAQELAKKL-------------------
THIM_ALKMQ       ----MNMNYSVAGVDSMDFG-------GNTPKMIRTLAQKY-------------------
THIM_EXIS2       ----LGQAARTKGVDVAEGE-------SLDLQSVHAFASQT-------------------
THIM_CLOD6       ----GGFNVRGKGVDSFDEE-------EDSTEIIRKIAEKL-------------------
THIM_CLOAB       ----ALGQGITKGVDADVNDKVKDDTLDNVINFAKGFSKKT-------------------
THIM_DESDA       ----AGKDAKARGVDAQDSCLVTEDRLESAAATARHLSEST-------------------
THIM1_METST      ----LDECTMAKGVDVAQCDIINKDTLISNCNLIKNISEKL-------------------
THIM2_METST      ----TDEKSVAKGVDVSSDDIITKDNIKSNASLVKAVADKL-------------------
THIM_METS3       ----ISESNTAKGVDVSESDIITQDNLNENADVISKLAAKL-------------------
THIM_CLOPE       ----IGETSNSIGIDS-----FEDSLSENTKNKIKEYARER-------------------
THIM_CLOPS       ----IGETSNSIGIDS-----FEDSLSENTKNKIKEYAKER-------------------
THIM_CLOP1       ----IGETSNSIGIDS-----FDDSLSENTKNKIKEYARER-------------------
THIM2_CLOB6      ----YGIKSSAKGIDVGACDIITEQNFDENIKMIKRLSMET-------------------
THIM2_CLOBK      ----YGIKSSAKGIDVGACDIITEQNFDENIEMIKRLSMET-------------------
THIM2_CLOBL      ----YGIKSSAKGIDVGACDIITEQNFDENIEMIKRLSMET-------------------
THIM2_CLOBJ      ----YGIKSSAKGIDVGACDIITEQNFDENIEMIKRLSMET-------------------
THIM1_CLOBM      ----YGIKSSAKGIDVGECDIITEQNFDENIEMIKRLSMET-------------------
THIM2_CLOB1      ----YGIKSSAKGIDVGACDIITKQNFDENIEMIKRLSMET-------------------
THIM2_CLOBH      ----YGIKSSAKGIDVGACDIITKQNFDENIEMIKRLSMET-------------------
THIM_FINM2       ----FIKDLSTKGVDS------QKLEVDDVINCCKNLHEKY-------------------
THIM_CAMLR       ----IGLDGKAKGTDNTFVV------NDHFLDKACEYAKGH-------------------
THIM_DESHY       ----AGLAARVRGVDSLDEG-------NDGLEACQSLARAY-------------------
THIM_DESHD       ----AGLAARVRGVDSLDEG-------NDGLEACQSLARAY-------------------
THIM1_CLOB1      ----AGMDSETRGVDSLDNG-------ENALDACTQLAKKY-------------------
THIM1_CLOBH      ----AGMDSETRGVDSLDNG-------ENALDACTQLAKKY-------------------
THIM1_CLOBK      ----AGMDSETRGVDSLDNG-------ENALDACTQLAKKY-------------------
THIM1_CLOBJ      ----AGMDSETRGVDSLDNG-------ENALDACTQLAKKY-------------------
THIM1_CLOB6      ----AGMDSETRGVDSLDNG-------ENALDACTQLAKKY-------------------
THIM1_CLOBL      ----AGMDSETRGVDSLDNG-------ENALNACTQLAKKY-------------------
THIM2_CLOBM      ----AGMDSETRGVDSLDNG-------ENALDACTQLAKKY-------------------
THIM_CLOK1       ----AGETSNVKGVDSLEDG-------EGALECSRILSEKY-------------------
THIM_CLOK5       ----AGETSNVKGVDSLEDG-------EGALECSRILSEKY-------------------
THIM_CLONN       ----AGYNAKTRGVDSIDNG-------NDSIDACISLAKKY-------------------
THIM_SYNWW       ----AGLAGKAQGVDSLDTG-------EGLEEACLQLAVKD-------------------
THIM_NATTJ       ----AGRKGHGKGMDSLDLG-------EDIQMVNSELSEKY-------------------
THIM_LACPL       ------MDWQAKGIDAGSGQGDLV-------EIAQACAQQF-------------------
THIM_LACBA       ------ISWQAKGIDAGEGAGDLV-------AIAQACAQKL-------------------
THIM_LACSS       ------LDWQANGIDAGSGEIDLV-------KVAQTAAKKQ-------------------
THIM_LACF3       ------VEWQSHGIDAGEGNADLE-------KVARLAAEKL-------------------
THIM_PEDPA       ------IDWQTRGIDAGNGTGDMS-------AVVQACAQKF-------------------
THIM_LACRJ       ------ADNTSHGIDAGK-VPNQV-------QIAETCARRY-------------------
THIM_LACRD       ------ADNTSHGIDAGK-VPNQV-------QIAETCARRY-------------------
THIM_LACLM       ------KKSLNKGIDALE-SNIDN-------EHARLAAKKT-------------------
THIM_LACLS       ------KKSLNKGIDALE-SNIDN-------EHARLAAKKT-------------------
THIM_LACLA       ------KESLNKGIDALE-SNLEV-------EHARVAAQKT-------------------
THIM1_LEUMM      ------IDFASQGIDATG-KGDVI-------EIAQRAAKKT-------------------
THIM_LEUCK       ------IDFASHGIDAVG-SGNIE-------QIAQLAANKT-------------------
                             . :                                             

THIM_GEOTN       ----GTVVAITGKEDVVTD-----GQAAYLIHNGHPLLTKVTGAGCLLTSVVGAFAAVE-
THIM_GEOKA       ----GAVVAITGKEDVVAD-----GQTTYLIQNGHPLLTKVTGAGCLLTSVIGAFAAVE-
THIM_GEOSW       ----KTVVAITGKEDVVTD-----GNTTYIIRNGHPLLTKVTGTGCLLTSVIGAFAAVE-
THIM_BACC4       ----NTVAVITGKEDVVTD-----GERTIVIRNGHPILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACCR       ----NTVAVITGKEDVVTD-----GERTIVIRNGHPILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACC2       ----NTVAVITGKEDVVTD-----GERTVLIRNGHPILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACCQ       ----NTVAVITGKEDVVTD-----GQRTIVIRNGHPILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACC7       ----NTVAVITGKEDVVTD-----GQRTIVIRNGHPILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACC1       ----NTVAVITGEEDVVTD-----GERTIVIQNGHSILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACAH       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVE-
THIM_BACC3       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVE-
THIM_BACAA       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVE-
THIM_BACC0       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVE-
THIM_BACAN       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVE-
THIM_BACAC       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVE-
THIM_BACHK       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACCZ       ----NTVAVITGKEDVVTD-----GERTIVIRNGHSILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACMK       ----NTVAVITGQEDVVTD-----GERTILIRNGHPILTKVTGTGCLLTSVIGAFVAVE-
THIM_BACCN       ----GTVAVITGKEDIVTD-----GKRTVIIRNGHPILTKVTGTGCLLTSVMGAFVAVE-
THIM_BREBN       ----RTIVAITGKVDVISD-----GEKTYSIHNGHPILTKVTGTGCLLTSVMGAFAAIA-
THIM_BACSU       ----NTVIAITGEVDVIAD-----TSHVYTLHNGHKLLTKVTGAGCLLTSVVGAFCAVE-
THIM_BACVZ       ----KTVIAITGKTDVISD-----GADTYAVHNGDKLLTKVTGAGCLLTSVIGAFCAAG-
THIM_BACLD       ----DTAVIITGAEDVITD-----GTKTYTVGNGHQLLTKVTGTGCLFTSVIGAFCAVE-
THIM_BACP2       ----QTVVVITGEVDVVSD-----GEDVLSIHNGHEWLTKVTGTGCLLTSVIGAFCAAG-
THIM_ANOFW       ----RCVVVITGKDDIVTD-----GERIVIVSNGDAMLTKVTGTGCLLSSVLGAFAGVG-
THIM_BACHD       ----NSAVVVTGEVDVVTD-----GTGTVCGYNGHPWLTKVVGTGCLSGAIVAAFASLKT
THIM_BACSK       ----RTVVVVTGEVDAVSN-----GEQLVAVANGHEWLTKVVGTGCLLGGVIAAYAAVQP
THIM_LISMC       ----STVVIISGEVDVISD-----GTRFAKVANGSALLPRITGSGCLLSAVCGSFMAVQD
THIM_LISMF       ----STVVIISGEVDVISD-----GTRFAKVANGSALLPRITGSGCLLSAVCGSFMAVQD
THIM_LISIN       ----STVVIISGEVDVISD-----GTRFAKVANGSALLPRITGSGCLLSAVCGSFIAVQD
THIM_LISMO       ----STVVIISGEVDVISD-----GTRFAKVANGSALLPRITGSGCLLSAVCGSFIAVQD
THIM_LISMH       ----STVVIISGEVDVISD-----GTRFAKVANGSALLPRITGSGCLLSAVCGSFIAVQD
THIM_LISW6       ----NTVVIISGEVDVISD-----GTRFAKVANGSALLPRITGSGCLLSAVCGSFIAVQD
THIM_HAEIN       ----GCTVLISGAVDIVSD-----GTQTATVHNGTSLFPKVTASGCLLSAVCAAFLAVSE
THIM_HAEI8       ----GCTVLISGAVDIVSD-----GTQTATVHNGTSLFPKVTASGCLLSAVCAAFLAVSE
THIM_HAEIG       ----GCTVLISGVVDIVSD-----GTQTATVHNGTSLFPKVTASGCLLSAVCAAFLAVSE
THIM_HAEIE       ----GCTALISGAVDIVSD-----GTQTATIHNGTPLFPKVTASGCLLSAVCAAFLAVSE
THIM_HAES1       ----QCIAVISGETDYISD-----GKRLAKLNNGTPLFPKITASGCLLSAVCSAFLAVAE
THIM_PASMU       ----QCIAMISGATDYLSD-----GEHHAQIHNGTPLFPKITASGCLLSAVCGAFLAVAK
THIM_HAEPS       ----NTIAVLSGEHDFVAN-----HDRVMKLSNGVALFPKVTATGCLLSAIVGAFLAVAP
THIM_ACTSZ       ----RCVVALSGETDFISD-----GLKTYQICNGTRMLPKVTGSGCLLGAVIAAFLGVSP
THIM_EXISA       ----GCVVAVTGKEDMVSD-----GHVVMEVRGGTKRMTETTGTGCLLSAVVGACLAVEK
THIM_LYSSC       ----NCIVIVTGEHDFMTD-----GVQSQWITGGNSQMTEVTGTGCLLSAICGAAYSSGE
THIM_STAEQ       ----NTAIVITGKDDIIAK-----NEKIIKLSNGSPLLTKITGAGCLLGGVLASFLFRN-
THIM_STAES       ----NTAIVITGKDDIIAK-----NEKIIKLSNGSPLLTKITGAGCLLGGVLASFLFRN-
THIM_STAHJ       ----NTAIVLTGKDDVVVQ-----GGKVVKLSNGSPLLAKITGAGCLLGGIVASFLFRE-
THIM_STAA3       ----KTAIVITGKEDVIVQ-----DNKAFVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAAE       ----KTAIVITGKEDVIVQ-----DNKAFVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAA8       ----KTAIVITGKEDVIVQ-----DNKAFVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAAC       ----KTAIVITGKEDVIVQ-----DNKAFVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAAW       ----KTAIVITGKEDVIVQ-----DNKAIVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAAS       ----KTAIVITGKEDVIVQ-----DNKAIVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAAM       ----KTAIVITGKEDVIVQ-----DNKAIVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAA9       ----KTAIVITGKEDVIVQ-----DNKAIVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAAN       ----KTAIVITGKEDVIVQ-----DNKAIVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAA2       ----KTAIVITGKEDVIVQ-----DNKAIVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAA1       ----KTAIVITGKEDVIVQ-----DNKAIVLANGSPLLARVTGAGCLLGGVIAGFLFRE-
THIM_STAAR       ----KTAIVITGKEDVIVQ-----GDKAIVLANGSPLLARVTGAGCLLGGIIAGFLFRE-
THIM_STAAB       ----KTAIVITGKEDVIVQ-----GDKAIVLANGSPLLARVTGAGCLLGGIIAGFLFRE-
THIM_STAS1       ----NSAIIITGKEDVVIQ-----DNQIYQLNNGSALLAKVTGAGCLLGAVIASFLPTD-
THIM_STACT       ----QTAIILTGETDVIVQ-----DNKVVKLSNGSHFLAKITGAGCLLGAVVGAFLFRN-
THIM_MACCJ       ----KTAIIATGAVDAICQ-----DEQIMLVENGTPMLTKVTGGGCLLGAVVASFIYNE-
THIM1_STRPS      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRPJ      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRP2      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRR6      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRP4      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRP7      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVIASFIGLE-
THIM1_STRZP      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRZT      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRPI      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRZJ      ----NIPIVVTGEVDAIAV-----NGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM1_STRPN      ----NIPIVVTGEVDAIAV-----NGEVVMIHNGSAMMPKVIGTGCLLGAVVASFIGLE-
THIM_STRSY       ----GIPVVITGKKDAVAV-----NHQVRILENGSELMPLVTGTGCLLGAVLAAFIHLAD
THIM_STRS2       ----GIPVVITGKKDAVAV-----NHQVRILENGSELMPLVTGTGCLLGAVLAAFIHLAD
THIM_STRA1       ----DVPVVVTGETDAIAV-----RGEVRLLQNGSPLMPLVTGTGCLLGAVLAAFIGSSD
THIM_STRA5       ----DVPVVVTGETDAIAV-----RGEVRLLQNGSPLMPLVTGTGCLLGAVLAAFIGSSD
THIM_STRA3       ----DVPVVVTGETDAIAV-----RGEVRLLQNGSPLMPLVTGTGCLLGAVLAAFIGSSD
THIM_HELPG       ----SVIAVMTGKTDYVSD-----GKKVLSITGGSEYLALITGAGCLHAAACASFLGLK-
THIM_HELPY       ----SVIAVMTGKTDYVSD-----GKKVLSITGGSEYLALITGAGCLHAAACASFLSLK-
THIM_HELPH       ----FVIAVMTGKTDYVSD-----GKKVLSITGGSEYLALITGAGCLHTAACASFLGLK-
THIM_HELPS       ----SVIAVMTGKTDYVSD-----GKKVFSITGGSEYLALITGAGCLHAAACASFLSLR-
THIM_HELPJ       ----SVIAVMTGKTDYVSD-----GKKVLSITGGSEYLAAITGAGCLHAAACASFLSLK-
THIM1_OCEIH      ----NTAVVVTGETDVIYV-----DNHLIHNGTGHHYLSSITGSGCLLGSIIAACLTTK-
THIM_CARHZ       ----KTVVVATGPVDYVIA-----EGELYLNRTGDIMLQKVTGTGCALTSLIGAFVGVI-
THIM_DESRM       ----RTLVVSTGEVDYLSD-----GAKTFTNKTGHAYLQLVTGTGCALSSLAGAFMSVT-
THIM2_OCEIH      ----DTVVISTGKVDVVTD-----GKRTALCTNGHEMLQNITASGCLLSSFVGPFVSVV-
THIM_DESVV       -----AVVVVSGAEDVVTDGDA-----LWLVRGGSPLMPRVTGMGCTATVLVAAH-----
THIM_DESVH       -----AVVVVSGAEDVVTDGDA-----LWLVRGGSPLMPRVTGMGCTATVLVAAH-----
THIM_DESVM       -----CVTVVSGPVDLVTDGDE-----EVLITGGHELMPRVTGMGCTATVLVAAH-----
THIM_DESAG       -----CVVVVSGAEDLITDGSS-----DVLVRGGHDMMPRITGMGCTATALVAAH-----
THIM_DESMR       -----CTVCVSGEVDVVTDGER-----VVELAGGHAMMTRVTGLGCTATAFVGAF-----
THIM_LEPBA       -----GVVVISGATDFILKGTD-----MAQISNGDALMTKVTGLGCTASALCGAF-----
THIM_LEPBP       -----GVVVISGATDFILKGTD-----MAQISNGDALMTKVTGLGCTASALCGAF-----
THIM_SYNAS       -----STVCISGETDFIIGDRA-----ILGIRNGHPLMTRVTGLGCTASALCGAF-----
THIM_CHLT3       -----AVICISGATDHILNQEE-----YVRVENGHPMMTKVTGLGCTATAVVAAF-----
THIM_RHOFT       -----GVVCVSGQIDHILDASHR----WAQLSNGHAWMTRITGVGCSATALIGAF-----
THIM_LEPCP       -----SVVCVSGADDHVVDALGR----WATLSNGHPWMTRITGVGCSATAMIGAF-----
THIM_VIBPA       -----ASVVISGETDYIVTKEQ-----TVQLNNGHEMMPYVTGMGCTLTALTGAF-----
THIM_VIBCB       -----ASVVISGETDYIVTKGQ-----TVQLNNGHEMMPYVTGMGCTLSALTGAF-----
THIM_VIBA3       -----ANVVISGETDYVVTKDS-----VVTLNNGHPMMPYVTGMGCTLTALTGAF-----
THIM_ALIF1       -----CSVVISGETDYIVTQDA-----QYKLNNGHAMMPFVTGMGCTHTALTGAF-----
THIM_ALIFM       -----CSVVISGETDYIVTQDA-----QYKLNNGHAMMPFVTGMGCTHTALTGAF-----
THIM_ALISL       -----CSVVISGETDYVVTKEA-----QYKLNNGHAMMPFVTGMGCTHTALTGAF-----
THIM_PSYIN       -----CAVVISGATDFIVTAGG-----QIQLNNGHAMMPYVTAMGCTLSALTGAF-----
THIM_PHOPR       -----CSVVISGATDYIVTTTA-----TIALNNGHEMMPYVTGMGCSHTALTGAF-----
THIM_BRAHW       -----TVVSISGETDIITDGNK-----VLYVSGGSPLMPVNTGMGCTSTAITGAM-----
THIM_DESAH       ILVSASSLIVSGQKDMILAPGR-----RMILDNGTPLMNSVTGTGCILSALTAAF-----
THIM_CHLFF       -----CAVAVTGSEDFITDGKR-----HATVELGDPLMSRITGMGCSLTGVLAAF-----
THIM_CHLCV       -----CAIAVTGAVDFITDGKR-----SATIELGDPLMSHVTGMGCSLTGVLAAF-----
THIM_CHLAB       -----CAIAVSGAIDFITDGQR-----HTTVELGDPFMSYVVGMGCSLTGVFAAF-----
THIM_HERA2       -----CVVGLTGVIDVVSDGMN-----WIQLEHGHQWLSQITGAGCIVTSLIGAL-----
THIM_SHIB3       ---TGAIVVVTGEVDYVTD-----GHRIVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOSM       ---TGAIVVVTGEVDYVTD-----GHRIVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOLU       ---TGAIVVVTGEVDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO45       ---TGAIVVVTGEVDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOK1       ---TGAIVVVTGEVDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOUT       ---TGAIVVVTGEVDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOL6       ---TGAIVVVTGEVDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO7I       ---TGAIVVVTGEVDYVTD-----GHRIVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO81       ---TGAIVVVTGEVDYVTD-----GHRIVGIHGGNPLMTKVVGTGCALSAVVAAC----C
THIM_ECO27       ---TGAIVVVTGEVDYVTD-----GHRIVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOL5       ---TGAIVVVTGEVDYVTD-----GRRTVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_SHIBS       ---TGAIVVVTGEMDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO24       ---TGAIVVVTGEMDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO55       ---TGAIVVVTGEVDYVTD-----GHRAVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOSE       ---TGAIVVVTGEVDYVTD-----GHRAVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO8A       ---TGAIVVVTGEVDYVTD-----GHRAVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_SHISS       ---TGAIVVVTGEVDYVTD-----GHRAVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECODH       ---TGAIVVVTGEMDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOLI       ---TGAIVVVTGEMDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOHS       ---TGAIVVVTGEMDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOLC       ---TGAIVVVTGEMDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECOBW       ---TGAIVVVTGEMDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_SHIFL       ---TGAIVVVTGEVDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_SHIF8       ---TGAIVVVTGEVDYVTD-----GHRIIGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO57       ---TGAIVVVTGEVDYVTD-----GHRAVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_ECO5E       ---TGAIVVVTGEVDYVTD-----GHRAVGIHGGDPLMTKVVGTGCALSAVVAAC----C
THIM_SHIDS       ---TGAIVVVTGVMDYVTD-----GRRTVGIHGGDPLMAKVVGTGCALSAVVAAC----C
THIM_ESCF3       ---TGAVVVVTGEVDYVTD-----GRRTVGVGGGDPLMTKVVGTGCALSAVVAAC----C
THIM_SALPA       ---IDCIVVVTGEIDYVTN-----SQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALPK       ---IDCIVVVTGEIDYVTN-----SQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALAR       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALEP       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALTY       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALG2       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALDC       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALNS       ---IDCIVVVTGEVDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALHS       ---IDCIVVVTGEVDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALA4       ---IDCIVVVTGEVDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALPB       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALTI       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALCH       ---IDCIVVVTGEIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALPC       ---IDCIVVVTREIDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_SALSV       ---IDCIVVVTGEVDYVTN-----GQRTLSIPGGDPLMTRIVGTGCALSAVVAAS----C
THIM_CITK8       ---TGAVVAVTGEVDYVTD-----GQRTVSVTGGDVLMTRVVGTGCALSAVVAAS----C
THIM_ENT38       ---THAIVAVTGEVDYVTD-----GQRTQTITGGDVMMTRVVGTGCALSAVVAAS----C
THIM_KLEP3       ---LATVVAVTGEVDYVTD-----GERVLSVAGGNPLMTRVVGTGCALSAVVAAS----A
THIM_KLEP7       ---LATVVAVTGEVDYVTD-----GERVLSVAGGNPLMTRVVGTGCALSAVVAAS----A
THIM_CROS8       ---TGAVVAVTGEVDYITD-----GERTVAVEGGTAMLTRVVGTGCALSAVVAAC----C
THIM_SERP5       ---SGAVVAVTGVVDYITD-----GQRDWAVAGGDVLMTRVVGTGCALSAVVAAF----C
THIM_YERE8       ---TQTVVAVTGEVDYITD-----GQRDVAVTGGDKLMTRVVGTGCALSAVVAAF----C
THIM_PECAS       ---VGTIVVVTGAVDYVTD-----GERDIAVTGGDSMMTRVVGTGCALSAVVAGF----C
THIM_PECCP       ---VGTIVAVTGAVDYVTD-----GERDIAITGGDSMMTRVVGTGCALSAVVAGF----C
THIM_TOLAT       ---SGAIVAVTGEIDYITD-----GERVVSIKAGDPLMTRVTGTGCALSSVVAAF----I
THIM_LARHH       ---TGAVVAVTGATDFITD-----GERVIALAGGHPLLQQVTGTGCSLSALVAAM----T
THIM_LEPIN       ---TGAVIAISGEIDYVTN-----GKETISISGGDPIMTKVTGVGCSLGGVIASF----L
THIM_LEPIC       ---TGAVIAISGEIDYVTN-----GKETISISGGDPIMTKVTGVGCSLGGVIASF----L
THIM_LEPBJ       ---TGAVVAVSGEVDYVTN-----GKETIEIYGGDPIMTKVTGVGCSLGALIASF----L
THIM_LEPBL       ---TGAVVAVSGEVDYVTN-----GKETIEIYGGDPIMTKVTGVGCSLGALIASF----L
THIM_CLAM3       ---FGTVVAISGPVDHITD-----GHRVVRVHTGDALLTKVTGGGCALGAVMAAF----A
THIM_CLAMS       ---YGTVVAVSGAVDHITD-----GHRLVRVHTGDAWLTKVTGGGCALGAVMTAF----A
THIM_CORGB       ---TGGVVAVSGAEDLIVS-----ADRVTWLRSGDPMLQLVIGTGCSLGALTAAYLGATV
THIM_CORGL       ---TGGVVAVSGAEDLIVS-----ADRVTWLRSGDPMLQLVIGTGCSLGALTAAYLGATV
THIM_COREF       ---TGGVVAVTGAEDLIVS-----RGRVSWLKSGDPMLQLVIGTGCALGAVTAAYLGATQ
THIM_CUTAK       ---YGCVVAISGPVDHILD-----ADRHVTVSSGHEWMTRVTGVGCSLGALTAAF----A
THIM_KINRD       ---TGGAVAVSGVVDVLVH-----DGRTLRVSGGHVLLTRTTGAGCSLGALVAAY----A
THIM_RHOE4       ---AD-AVSASGPVDYIVGRDGGGDVRGIRVSGGSALLPRVTSTGCSLGGLVAAY----L
THIM_BURP0       ---SGAVVAVSGPTDYVTD-----GVATLAVAGGDARLTRVTGAGCALGALIAAL----L
THIM_BURTA       ---SGAVVAVSGPIDYVTD-----GIDTLAIAGGDARLTRVTGAGCALGALIAAL----L
THIM_BURP6       ---SGAVVAVSGPTDYVTD-----GVATLAVAGGDARLTRVTGAGCALGALIAAL----L
THIM_BURPS       ---SGAVVAVSGPTDYVTD-----GVATLAVAGGDARLTRVTGAGCALGALIAAL----L
THIM_BURP1       ---SGAVVSVSGPTDYVTD-----GVATLAVAGGDARLTRVTGAGCALGALIAAL----L
THIM_GRABC       ---TGGAVAVTGATDYVTD-----GTRLIGIANGHPMMTRVTGLGCTATALIGAF----A
THIM_AKKM8       ---TGAAVLVTGRTDYSTD-----GRQVTATENGHAMMSRVTGVGCSMGALSAAC----A
THIM_RHOSK       ---SGAVVAVTGPVDFVTD-----GRRGIRCANGHPLMPRVTALGCSLTGIVGAF----A
THIM_RHOS4       ---SGAVVAVTGPVDFVTD-----GRRGIRCANGHPLMPRVTALGCSLTGIVGAF----A
THIM_RHOS1       ---SGAVVAVTGPVDFVTD-----GRRGIRCANGHPLMPRVTALGCSLTGIVGAF----A
THIM_RHOS5       ---SGAVVAVTGPVDFVTD-----GRRGIRCGNGHALMPKVTALGCSLTGIVGAF----A
THIM_RHIL3       ---QRAVVAVTGAVDFVTD-----GERAVRIEGGSALMPQVTALGCSLTCLVGAF----A
THIM_RHILW       ---QQAIVAVTGAVDFVTD-----GERAVRITGGSALMPQVTALGCSLTCLVGAF----A
THIM_RHIE6       ---QQAIVAVTGAVDFVTD-----GNRAVRIKGGSVLMPQVTALGCALTCLVGAF----A
THIM_RHIEC       ---QQAIVAVTGAVDFVTD-----GERAVRIKGGSVLMPEVTALGCSLTCLIGAF----A
THIM_AGRRK       ---HRTIVAVTGATDFVTD-----GNKASRIEGGSPLMPQVTALGCSLTCLVGAF----A
THIM_ROSDO       ---FGTVVAITGPVDYLTD-----GTREAQVSGGSSLMPQVTALGCSQTALMGAY----A
THIM_GEMAT       ---YGSVVAVTGAVDLVTD-----GTRVAMVSGGSPWMPQVTALGCSLTCLMGAF----A
THIM_PSYWF       ---YAKVVVVTGEIDWVTD-----GMNRWAINHGHPMMTQVTAIGCALTALIAGF----V
THIM_BIFLO       DASTRCAVAVSGIADLVTD-----GETVYRLPGGSAMMTKIIGAGCSLGGVAATY-----
THIM_BIFLD       DASTRCAVAVSGIADLVTD-----GETVYRLPGGSAMMTKITGAGCSLGGVAATY-----
THIM_BIFLS       DASTRCAVAVSGIADLVTD-----GETVYRLPGGSAMMTKITGAGCSLGGVAATY-----
THIM_BIFAA       SPVGAGAVAVSGAVDLVTD-----GERTFRLPGGSAMMTKITGAGCSLGGVTATY-----
THIM_BIFA0       SPTHTGAVAVSGEVDLVTD-----GRLVYRLPGGSAMMTKITGAGCSLGGVTATY-----
THIM_DICNV       ---QRAVVVVTGEIDYVTD-----GETILAVRGGHPFLGRVCGTGCVLSAMIAST-----
THIM_ACIBY       ----ASCIAISGESDYILSN---EVDAVIQVNGGSPLQPKITATGCALGALIAAY-----
THIM_ACIB3       ----ASCIAISGESDYILSN---EVDAVIQVNGGSPLQPKITATGCALGALIAAY-----
THIM_ACIB5       ----ASCIAISGESDYILSN---EVDAVIQVNGGSPLQPKITATGCALGALIAAY-----
THIM_ACIBT       ----ASCIAISGESDYILSN---EVDAVIQVNGGSPLQPKITATGCALGALIAAY-----
THIM_ACIBS       ----ADCIAISGESDYILSR---ELDAVIQVNGGSPLQPKITATGCALGALIAAY-----
THIM_ACIBC       ----ADCIAISGESDYILSN---EIDAVIQVNGGSPLQPKITATGCALGALIAAY-----
THIM_ACIAD       ----TSCVAISGETDYILSN---AMTCIVKVRGGSHLQPKITATGCALGTLIAAY-----
THIM_LACCB       ---PTTTFLATGKIDLVVS-----AKGTWYLKNGVPQLDRFTGTGDIVGALIAAL-----
THIM_LACP3       ---PTTTFLATGKIDLVVS-----AKGTWYLKNGVPQLDRFTGTGDIVGALIAAL-----
THIM_ENTFA       ---PQTVFLATGIQDVLVS-----QEQVIVLQNGVPELDCFTGTGDLVGALVAAL-----
THIM2_LEUMM      ---ADTVFVATGKKDVIVQ-----NDKHLILSNGVDELDKFVGTGDMVGAIITTL-----
THIM2_STRP2      ---PGMSFLVTGPKDLVVS-----KNQVAVLGNGCTELDWITGTGDLVGALTAVF-----
THIM2_STRPN      ---PGMSFLVTGPKDLVVS-----KNQVAVLGNGCTELDWITGTGDLVGALTAVF-----
THIM2_STRR6      ---PGMSFLVTGPKDLVVS-----KNQVAVLGNGCTELDWITGTGDLVGALTAVF-----
THIM2_STRPI      ---PGMSFLVTGPKDLIVS-----KNQVAVLENGCTELDWITGTGDLVGALTAVF-----
THIM2_STRP7      ---PGMSFLVTGPKDLVVS-----KNQVAVLENGCTELDWITGTGDLVGALTAVF-----
THIM2_STRZP      ---PGMSFLVTGPKDLIVS-----ENQVAVLENGCTELDWITGTGDLVGALTAVF-----
THIM2_STRPJ      ---PGMSFLVTGPKDLIVS-----ENQVAVLENGCAELDWITGTGDLVGALTAVF-----
THIM2_STRPS      ---PGMSFLVTGPKDLVVS-----KNQVAVLENGCTELDWITGTGDLVGALTAVF-----
THIM2_STRZT      ---PGMSFLVTGPKDLIVS-----ENQVAVLENGCTELDWITGTGDLVGALTAVF-----
THIM2_STRZJ      ---HGMSFLVTGPKDLVVS-----KNQVAVLGNGCAELDWITGTGDLVGALTAVF-----
THIM2_STRP4      ---HGMSFLVTGPKDLVVS-----KNQVAVLGNGCAELDWITGTGDLVGALTAVF-----
THIM_THEP3       ----NVVVAVSGVTDIITD-----GKRIAYVKNGHPMMGTVTGTGCMLTSVVASFCGVCE
THIM_THEPX       ----NVVVAMSGATDIITD-----GKRIAYVKNGHPMMGTITGTGCMLTSVVASFCGVCE
THIM_CALS4       ----GCVVAVSGKVDVITD-----GKKIAYVKNGHPMMGTITGTGCMLTSVVASFCAVAE
THIM_METBF       ----SSVIVMTGKEDIISD-----GERVFIVKNGHELMGSIVGTGCMAASVIGLFAAVNP
THIM_METMA       ----SSVVVMTGKEDVISD-----GNRTFVVKNGHELMGSIVGTGCMAASIIGSFASVNP
THIM_METAC       ----SCVVVMTGKEDIISD-----GDRTFIVKNGHELMGSIVGTGCMAASIVGLFAAVNR
THIM_METAR       ----GLVVAVSGATDIVTD-----GKRLIYVDNGHEMMGKLSGTGCMASSISGAFAAASK
THIM_METPE       ----SCTVAMSGATDIVTD-----GDRVVLIDNGDPRMGVVSGTGCMASSLTGAFAAGSR
THIM_METMJ       ----GTVVSMTGAVDVVTD-----GSRVFLVGNGNPAMDRLSGTGCMASSVTAAFVAVAE
THIM_METB6       ----GITVVMSGATDIISD-----GNKVLLVDNGHPLMGRISGTGCMASAVTGVIAAVEK
THIM_METHJ       ----SCTVVMSGPIDIISD-----GSRTLLCENGHPYMGRISGTGCMAASVIGSCAAVTQ
THIM_METLZ       ----GCTVVISGAEDIISD-----GKRIAGVLNGVPIMGKISGTGCMASAVCGACAAVS-
THIM_RUBXD       ----GLTVAATGAVDYVCG-----GGRALAVENGHPLLGRVVGSGCASTAVVGCFAAAAG
THIM_MOOTA       ----NTVVAVTGATDYISD-----GERLIAVDNGHPLLTFVTGTGCSATSIIAAFRAVEE
THIM_DESOH       ----EKVVAVTGPVDIVTD-----GTRTLEVHNGTPMFGRVTGTGCSATTVISCFCAVEP
THIM_DESPS       ----DTILAITGPTDLVTD-----GRRVFNVDNGHPLMPYVTGTGCSATAVVGAFAAVDR
THIM_CHLAA       ----RTVVAVTGRQDVVTD-----GKRVFLVDNGHEWLKTLTGTGCSATTVIAAFAAVER
THIM_CHLSY       ----RTVVAVTGRQDVVTD-----GKRVFLVDNGHEWLKTLTGTGCSATTVIAAFAAVER
THIM_CHLAD       ----HTVVAVTGRRDLVTD-----GSRVLAVDNGHEWLKTLTGTGCSATTVIAAFTAVER
THIM_ROSS1       ----HTVVALTGARDIITD-----GERVLTVNNGHIWLTTLTGTGCMATTMVAAFAAVER
THIM_ROSCS       ----RTVVALTGARDIITD-----GERGFIVSNGHIWLTTLTGTGCMATTMVAAFAAVER
THIM_DESAP       ----NTVTVITGQRDIVTD-----GGRVLVVDNGHEWLTTITGSGCMATALVAAFAAVEP
THIM_DESAL       ----NCTVSITGKEDVISD-----GTRTVLVDNGHEWLTTLTGTGCSSTTAVAAFSAVER
THIM_SYNFM       ----KAVVAITGAEDFITN-----GPKSARVANGHPLMGRVSGTGCVASSIVAAFCAVHP
THIM_NATPD       ----DTVVVASGETDIVAS-----PEEAYEITAGHPLMAQIVGTGCMLGVTLATFAAGME
THIM_HALWD       ----EAVVVSSGVTDIVAT-----AETAFELNVGDEMLGTLVGTGCMLGGTIAAFCGGLD
THIM_PYRAB       ----NTTVAVTGAVDYVSD-----GGKVFAIYNGHKLLERVTGTGCIVTAITGAFVAVT-
THIM_PYRHO       ----NTTVAVTGAVDYVSD-----GRRTFAVYNGHELLGRVTGTGCMVAALTGAFVAVT-
THIM_PYRFU       ----STIVAVTGKVDYVSD-----GKRVYAVYNGHELLGRVTGTGCIVAALTGAFVAVN-
THIM_METM5       ----NTVSAVTGPVDYVSN-----GKEIYAISNGHPMLSKVTGTGCASTSIIGAFSAVD-
THIM_METM7       ----NTVSAVTGPIDYVSN-----GKELYAISNGHPMLSKVTGTGCASTSIIGAFSAVD-
THIM_METM6       ----NTVSAVTGPIDYVSN-----GKEIYAISNGHPMLSKVTGTGCATTSIIGAFSAVD-
THIM_METMP       ----NTVSAVTGPVDHVSN-----GKEIYSISNGHSMLSKVTGTGCATTSIIGAFSAVD-
THIM_METVS       ----NTVSTVTGPIDYVSN-----GKEIYSISNGHEMLSKVTGTGCASTSIIGAFLAVE-
THIM_COPPD       ----NCIAAATGPDDYVSD-----GERVYVLRSGHEWLTRISGSGCWAGTLMAACLSVT-
THIM_CALMQ       ----GVTAVITGPWDYVSD-----GVRKVIVKNGTPLLQYVTGSGCMVGSVIASFMAINR
THIM_ARCFU       ----GLVVVATGKEDLISD-----GRSVYVMRNGTEMLGRITASGCMLGSVIASFMAVQK
THIM_CLOTE       ----NAVIGITGEKDVIGF-----KEEVYTVENGSSIMAKITGAGCMCTSVIASYCGA--
THIM_ALKOO       ----SCTVVITGEVDIVSD-----GNKTYAIQNGHKALSSITGTGCMSASLIGACCGT--
THIM_CLOB8       ----QCTVAITGATDIISD-----GERVVILENGTKMLSNVTGTGCMTTALIGAFCGA--
THIM_RUMCH       ----GCVVAVTGAVDVISD-----GKNVVTVLNGHKMLSNVTGTGCMTTALVGSFCGA--
THIM_CLOBA       ----NCVVAITGVDDIISD-----GKRNVILSNGHKMLANVTGTGCMSSALCGAFAGA--
THIM_CLOBB       ----NCVVAITGVDDIISD-----GKRNVILSNGHKMLANVTGTGCMSSALCGAFAGA--
THIM_ALKMQ       ----KTTVAITGATDSICD-----GTTLISVSNGHSLLSQVTGTGCMTTSLIATCLAV--
THIM_EXIS2       ----KQVIVVTGPVDFVTD-----GVRQHHLDVGTKRLGQVTGTGCMTASLIATFLGA--
THIM_CLOD6       ----ECVVVATGKIDIITN-----GKGTYKINNGTDKLKGITGTGCMTASLIASFMAV--
THIM_CLOAB       ----GAVIAITGAIDIIAN-----ESKAYVVRNGNPNMSKITGTGCMLSAMTAAYISA--
THIM_DESDA       ----GAVVVVSGAIDIVAY-----SGGAWAVRNGHPLMARITGSGCMSAAVMGCCLGV--
THIM1_METST      ----NTTIAVSGPIDIISD-----GHDVYTIENGDAMMSRITGSGCMLGCVLGAYLA---
THIM2_METST      ----NTTIAVSGAIDIISD-----GVSIYLIDNGEEVMSKITGSGCMLTCVIGSFCA---
THIM_METS3       ----DTVILASGPIDILSD-----GETTIAIDNGDEMMPYITGSGCMLSSIVGSCIG---
THIM_CLOPE       ----NLVVVVSGVVDFITN-----GEESASVKNGTYKMSKITGTGCMLGALLTLALSFYD
THIM_CLOPS       ----NLIVVVSGVVDFITN-----GEESASVKNGTYKMSKITGTGCMLGALLTLALSFYD
THIM_CLOP1       ----NLIVVVSGVVDFITN-----GEESASVKNGTYKMSKITGTGCMLGALLTLALSFYD
THIM2_CLOB6      ----GSVVAATGVVDIISN-----GTHTYIISNGCEVLSMITGTGCMLTGIIASYIS---
THIM2_CLOBK      ----GSVVAATGVVDIISN-----GTYTYIISNGCEMLSMITGTGCMLTGIIASYIS---
THIM2_CLOBL      ----GSVVAATGVVDIISN-----GTYTYIISNGCEMLSMITGTGCMLTGIIASYIS---
THIM2_CLOBJ      ----GSVVAATGVVDIISN-----GTYTYIISNGCEMLSMITGTGCMLTGIIASYIS---
THIM1_CLOBM      ----DSVVAATGVVDIISN-----GTYTYIISNGCEMLSMITGTGSMLTGIIASYIS---
THIM2_CLOB1      ----GSVVAATGVVDIISN-----GTYTYIISNGCEMLSMITGTGCMLTGLIASYIS---
THIM2_CLOBH      ----GSVVAATGVVDIISN-----GTYTYIISNGCEMLSMITGTGCMLTGLIASYIS---
THIM_FINM2       ----DSIIVATGQTDIVCA-----NE-IYLLNNGDDRLSKITATGCVVGSLIACTLS---
THIM_CAMLR       ----NRILVVSGEVDFIIS-----SEKIAKIYNGSIMATKITGAGCMCASMCGVFAGV--
THIM_DESHY       ----GCVVAATGKVDIVAD-----GQRACLIENGTEMLTRITGAGCMAGALVAGFCGAY-
THIM_DESHD       ----GCVVAATGKVDIVAD-----GQRACLIENGTEMLTRITGAGCMAGALVAGFCGAY-
THIM1_CLOB1      ----NCIVAATGEKDFVSD-----GKRGSVIKNGTEMLTKVTGAGCMLGALCAATCANF-
THIM1_CLOBH      ----NCIVAATGEKDFVSD-----GKRGSVIKNGTEMLTKVTGAGCMLGALCAATCANF-
THIM1_CLOBK      ----NCIVAATGQKDFVSD-----GKRGSVIKNGTEMLTKVTGAGCMLGALCAATCANF-
THIM1_CLOBJ      ----NCIVAATGQKDFVSD-----GKRGSVIKNGTEMLTKVTGAGCMLGALCAATCANF-
THIM1_CLOB6      ----NCIVAATGEKDFVSD-----GKRGSVIKNGTEMLTKVTGAGCMLGALCAATCANF-
THIM1_CLOBL      ----NCIVAATGQKDFVSD-----GKRGSVIKNGTEMLTKVTGAGCMLGALCAATCANF-
THIM2_CLOBM      ----NCIVAATGKKDFVSD-----GKRGSVIKNGTEMLTKVTGAGCMLGALCAATCASF-
THIM_CLOK1       ----NCVVAATGKKDFIVQ-----GKNSAIIENGTEMLTNITGAGCMLGALCAAACGAF-
THIM_CLOK5       ----NCVVAATGKKDFIVQ-----GKNSAIIENGTEMLTNITGAGCMLGALCAAACGAF-
THIM_CLONN       ----KCIVAATGVKDIVTD-----GKRTALIENGSKMLTLITGAGCMVGALTAATAGVE-
THIM_SYNWW       ----KLIAVATGEVDIVAE-----ENRYARIFNGTPLFQNITGAGCMAGGVIAACVGAAP
THIM_NATTJ       ----NTMVLATGKTDLITK-----GNITVKVSNGTPLLGRITGSGCMLGILISAFIGAS-
THIM_LACPL       ----QCCVILSGPTDVITD-----GQRVVKVANGTPLFQRHVGSGDLLSSIVAAFTAVSP
THIM_LACBA       ----DCVVILSGPTDIITD-----GTRVVKVLNGTPLFQVHVGSGDMLSSIVAAFCAVTP
THIM_LACSS       ----QTTILLSGPTDIITD-----GHHTTKVANGTPLFQVHVGSGDMLTGLCAAFVAVSP
THIM_LACF3       ----GSVIVLSGEVDIVTD-----STRLARLPYGSPAFKTHVGTGDMLSSLIGAFLATND
THIM_PEDPA       ----KNVVIASGEVDYISD-----GQQVITVHNNTKLLPAIVGSGDLLSSIVGAFSAVAE
THIM_LACRJ       ----HSIVVLTGETDIITD-----GQVVYENPFSAEMLTMNVGSGDMLSSIIAAFLGITT
THIM_LACRD       ----HSIVVLTGETDIITD-----GQVVYENPFSAEMLTMNVGSGDMLSSIIAAFLGITT
THIM_LACLM       ----GTVIIETGKVDIISN-----GHEEMYVDTDSPLFKINVGCGDMLTAVVGTFAAVSD
THIM_LACLS       ----GAVIIETGKVDIISK-----GHEEMYVDTDSPLFKINVGCGDMLTAVVGTFAAVSD
THIM_LACLA       ----GAVIIQTGKVDVISN-----GFEELFVETDSPLFKINVGCGDMLSAIVGTFAAVSD
THIM1_LEUMM      ----GAVIALSGACDVVSD-----GQYTQTLDINVEQLSSIVGTGDALSSLIGAFIA-DG
THIM_LEUCK       ----GAIIAMSGPSDVISD-----GKTTRVLPVNVPLLASNVGTGDALSAIIGAFNG-DE
                           :   *                  .        . *               

THIM_GEOTN       -----QDAVKAAVAALTYYGVAAEQAAAEA---------GQRGPGSFQVAFLDALARIGV
THIM_GEOKA       -----RDAAAAAVAALVYYGVAAEQAAAKA---------GERGPGSFQTAFLDALAYTSV
THIM_GEOSW       -----RDVLKAAAAALVIYGVAAEIAAKNA---------GDEGPGSFQIAFLDALSRVGA
THIM_BACC4       -----KDYVKAAVAALTFYGVASELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACCR       -----KDYVKAAVAALTFYGVASELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACC2       -----KDYVKAVVAALTFYGVAAELAAVKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACCQ       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACC7       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACC1       -----KDYVKAAIAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACAH       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACC3       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACAA       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACC0       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACAN       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACAC       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACHK       -----KDYVKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACCZ       -----KDYAKAAVAALTFYGVAAELAAAKT---------VEKGPGSFQIEFLNQLANTTS
THIM_BACMK       -----KDYVKAAVAALTFYGVAAEIAASKT---------VENGPGSFQIEFLNQLANTTS
THIM_BACCN       -----QDYVKAAVAALTFYGVAAEIAASKT---------VDQGPGSFQVEFLNQLANVTV
THIM_BREBN       -----KDKLIAGAAALVCYGVAAQLAAEKA---------AEVGPGSFQIEFLNALHNLTA
THIM_BACSU       -----ENPLFAAIAAISSYGVAAQLAAQQT---------ADKGPGSFQIELLNKLSTVTE
THIM_BACVZ       -----QDVLQAAVSAVSVYGSAAQLAALDT---------SHKGPGSFQIELLNKLASISE
THIM_BACLD       -----KDVCRAAVSAAAFYGTAAELAAAKT---------ESRGPGSFQIEFLNQLAAVEA
THIM_BACP2       -----ERPLHASAAALLFYGVAAEKAAQYT---------QNKGPGTFQMELLNALSHTTG
THIM_ANOFW       -----EDVMTSSVAALAYYGVAAEKAATQA-----------KAPGSFQLSFLNALHETSA
THIM_BACHD       -----DDFLEVIGYGLVAYGVAAEKAYEET---------KAKGYGSFQTAFLNQLGRLTD
THIM_BACSK       -----NSLVDAAVEALAFYGVCAEQAYEQT---------KKEGIGSFQQTFLNELGNMTD
THIM_LISMC       ------DAFRASVEACASYAVASEYAEIEL---------ERKLPGSFRPQFLDALASWSV
THIM_LISMF       ------DAFRASVEACASYAVASEYAEIEL---------ERKLPGSFRPQFLDALASWSV
THIM_LISIN       ------DAFRASVEACASYAVASEYAEIEL---------ERKLPGSFRPLFLDALASWSV
THIM_LISMO       ------DAFRASVEACASYAVASEYAEMEL---------ERKLPGSFRPLFLDALASWSV
THIM_LISMH       ------DAFRASVEACASYAVASEYAELEL---------ERKLPGSFRPLFLDALASWSV
THIM_LISW6       ------DVFRASVEACVSYAVASEYAEMEL---------ERKLPGSFRPLFLDALASWSV
THIM_HAEIN       -----GNYFSATLEACVAYTIAGECAAQGL----------TTQVGQFQIRLLDELAALSP
THIM_HAEI8       -----GNYFSATLEACVAYTIAGECAAQGL----------TTQVGQFQIRLLDELAALSP
THIM_HAEIG       -----GNYFSATLEACVAYTIAGECAAQGL----------TTQVGQFQIRLLDELAALSP
THIM_HAEIE       -----GNYFSATLEACVAYTIAGERAAQSL----------TTQVGQFQIRLLDELAALSP
THIM_HAES1       ----QKDYFDALVEGCSAYAIAGEIAAQSL---------SSTQFGQFTLGLLDQLASLTP
THIM_PASMU       ----PEQYFDAMLEACTAYAIAGELAAQGL---------KTTQHGQFYVGLLDQLAHLSP
THIM_HAEPS       ----RELAFQAACEACTVYAIAGELAAVGL---------QATQSGTFAVRLLDALAAIDA
THIM_ACTSZ       ----PQDYFSACTEACTVYAVAGELAAQGL----------SNEYGSFAMNFINQLGAIHE
THIM_EXISA       ------NALKATVTAMSGYAYCGELASERA-----------EGPGDFPIHFLNALHQLTQ
THIM_LYSSC       ------DPYSQLVETLTYYKKAAELASAFT-----------EDIGDIQIALLNALHRLSK
THIM_STAEQ       ----TQPSIDLLVEAVSVYNIAAEFAEQA--------PH-VNGPGTFLSELLDQLYQMND
THIM_STAES       ----TQPSIDLLVEAVSVYNIAAEFAEQA--------PH-VNGPSTFLSELLDQLYQMND
THIM_STAHJ       ----ENPTLQVLEEAVSIYNIAAEIAEKD--------QQ-VNGPGTFLPKLLDQMYNIDF
THIM_STAA3       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAE       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAA8       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAC       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAW       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAS       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAM       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAA9       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAN       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAA2       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAA1       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAR       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAAB       ----TEPDIEALIEAVSVFNIAAEVAAEN--------EN-CGGPGTFSPLLLDTLYHLNE
THIM_STAS1       ----ETTSISQLVEATSIYNIAAEKAEQL--------AE-DKGPGTFMTLLLDALYQVTY
THIM_STACT       ----THPSIETLIEAVSVYNIAAERAEQL--------SD-SKGPGTFLTQFIDALYRIDS
THIM_MACCJ       ----TKPSLALLTEAIATYTIAAERAAHS--------AN-GTLPGHFAVNLIDQLYLIQQ
THIM1_STRPS      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRPJ      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRP2      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRR6      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRP4      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRP7      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRZP      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRZT      ----KGQELKSLETAMLVYNIAGEIAEKR--------PN-GHLPGTFKAEFINALYEITD
THIM1_STRPI      ----KGQELKSLETAMLVYNIAGEIAEKH--------PN-GHLPGTFKVEFINALYEITD
THIM1_STRZJ      ----KGQELKSLETAMLVYNIAGEMAEKR--------PN-GHLPGTFKVEFINSLYEITD
THIM1_STRPN      ----KGQELKSLKTAVLVYNIAGEIAEKR--------PN-GHLPGTFKVEFINALYEITD
THIM_STRSY       ----EDSLLDCLEEVLSAYSIAGEMAEQK--------TS---LPGTFQIEFINSLYAIQS
THIM_STRS2       ----EDHYWIVWKSPIGLFDRWRNGRAEN--------LT---TRNLPD------------
THIM_STRA1       ----RSDDLACLTEAMTVYNVAGEIAEKV--------AK-GKGVGSFQVAFLDALSQMKS
THIM_STRA5       ----RSDDLACLTEAMTVYNVAGEIAEKV--------AK-GKGVGSFQVAFLDALSQMKS
THIM_STRA3       ----RSDDLACLTEAMTVYNVSGEIAEKV--------AK-GKGVGSFQVAFLDALSQMKS
THIM_HELPG       -----KDPLDSMVQLCALYKQAAFSAQKKVL------EN-NGSNGSFLFYFLDALSLPIK
THIM_HELPY       -----KDPLDSMAQLCALYKQAAFNAQKKVL------EN-NGSNGSFLFYFLDALSLPIE
THIM_HELPH       -----KDPLDSMAQLCALYKQASFNAQKKAL------EN-NGSNGSFLFYFLDALSLPIK
THIM_HELPS       -----KDPLDSMAQLCALYKQAAFNAQKKVS------EN-NGSNGSFLFYFLDALSLPIK
THIM_HELPJ       -----KDPLDSMVQLCAFYKQAAFSAQKKAL------EN-NGSNGSFLFYFLDALSLPIE
THIM1_OCEIH      -----STLKDQLMTAVSFYGLSASYAANQ--------EN-VHGTGSFLPVFIDSLS---K
THIM_CARHZ       -----DEPALAALAALAFYGAASEKARKIS-----------AGPGSFLVNFIDSLYNLTK
THIM_DESRM       -----EDKCLGVLSALAFYGAAAQKAALIS-----------QGPGTFAGNFLDALYGLEF
THIM2_OCEIH      -----DDFYQAGIYAVTSYGIAAELAMEKA-----------SGPGTFIPALLDEIYFLTD
THIM_DESVV       -VAVAADVLEGAVTGMAAMSAAGALAARRSQ--GPG---------SFQVAFLDVLHSLDL
THIM_DESVH       -VAVAADVLEGAVTGMAAMSAAGALAARRSQ--GPG---------SFQVAFLDVLHSLDL
THIM_DESVM       -AAVAASPLEGAVSGMAAMSAAGSMAAERAA--GPG---------SFAMHFIDALYALSE
THIM_DESAG       -AAVAGSVLDGAAAGMGVMAVAGTMASRKAK--GPG---------SFQMHFIDALYGMQS
THIM_DESMR       -LAVNPDYFAATCHAMAVMAAAGRLAAAGVA--GPG---------SLAVRFLDVVYSLTE
THIM_LEPBA       -AAVQKDQFRAATSAMAVMGIAGEMAKSKTA--SPG---------SFQVAFLDALYELNA
THIM_LEPBP       -AAVQKDQFRAATSAMAVMGIAGEMAKSKTA--SPG---------SFQVAFLDALYELNA
THIM_SYNAS       -AAVNSSFTLAAAQAMAVMGIAGEMAAEISP--GPG---------SLQLHFLDILYRLTE
THIM_CHLT3       -AAINPSMMEATAHGMAAMGIAGEIAAKNVA--GPG---------SLQVNFLDTLYSLSE
THIM_RHOFT       -CAVQPDAWRATVAAMALLGVVGEVAAEKVI--ARGKG-----VGSLQMALLDELQLLDQ
THIM_LEPCP       -AAVQPDAWRATTAAMAYLGVVGEWAAEQVI--AAGNG-----VGSLQVKLLDGLQLLDD
THIM_VIBPA       -AAIGDE---TGLAAAAVLGVVGEIAAEQAR--GPG---------SLQMHLLDELYQLDE
THIM_VIBCB       -AAVGDD---TGLAAAAVLGVVGEIAAEQAR--GPG---------SLQMNLLDELYQLDE
THIM_VIBA3       -AAVGDE---SGLAAAAVLGVVGEISAESSR--GPG---------SLQMNLLDELYQLDE
THIM_ALIF1       -AAIGDE---SGVVATAVLGVAGEIAAEQSA--GPG---------SLQMNLLDTLYQLDE
THIM_ALIFM       -AAIGDE---SGVVATAVLGVAGEIAAEQSA--GPG---------SLQMNLLDTLYQLDE
THIM_ALISL       -AAIGDH---SGVAATAVLGVAGEIAAEQSA--GPG---------SLQINLLDTLYQLDE
THIM_PSYIN       -AAVGEE---TGLAAAAVLGVAGEIAAEQSK--GPG---------SLQLNLLDALYQLDE
THIM_PHOPR       -AAIGEP---TGLAATAVLGIAGEIAARDAA--GPG---------SLQVNLLDTLYHLDE
THIM_BRAHW       -LAVSNPLI-AAASAMCIMASAGEKASKKSE--GPA---------SFAVAFIDELYKLDI
THIM_DESAH       -YAVTDNGFDAAVAASAVAAIAGELAAEKAS--GPG---------TFMPHFMDALYNMNE
THIM_CHLFF       -RSVIEDSFEATRLGVEYFSLCGMLARERCE--GPG---------LFKAYFLDELYAADF
THIM_CHLCV       -RSVIDDSFEAARLGVEYFSLCGMLARERCE--GPG---------LFKAYFLDELYAADF
THIM_CHLAB       -RSVIDDSFEATKLGIEYFTLCGMLARERCE--GPG---------LFKAYLLDELYASDF
THIM_HERA2       -AAVINDVMLATVSAIAGFGMAAEVAAMHAL--GPA---------SFRVALFDQLGAIAE
THIM_SHIB3       ALPG--DMLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOSM       ALPG--DTLENIAFACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOLU       ALPG--DMLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTP
THIM_ECO45       ALPG--DTLENIASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOK1       ALPG--DTLENIASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOUT       ALPG--DTLENIASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOL6       ALPG--DTLENIASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLAQ
THIM_ECO7I       ALPG--DTLENIASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECO81       ALPG--DTLENIASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLAQ
THIM_ECO27       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLAQ
THIM_ECOL5       ALPG--DTLENIASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_SHIBS       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECO24       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECO55       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOSE       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECO8A       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_SHISS       ALPG--DTLENVASACHWMKQAGERAVARSE--GLG---------SFVPHFLDALWQLTQ
THIM_ECODH       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOLI       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOHS       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOLC       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECOBW       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_SHIFL       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_SHIF8       ALPG--DTLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECO57       ALPG--DMLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ECO5E       ALPG--DMLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_SHIDS       ALPG--DMLENVASACHWMKQAGERAVARSE--GPG---------SFVPHFLDALWQLTQ
THIM_ESCF3       ALPG--DRLLNVASACSWMKQAGERAIVRSQ--GPG---------TFVPYFLDALWQMTQ
THIM_SALPA       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALPK       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALAR       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALEP       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALTY       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALG2       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALDC       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALNS       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALHS       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALA4       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALPB       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALTI       ALPG--AALDNVASACCWMKLAGQVAAERSE--GPG---------SFIPAFLDALYHLDM
THIM_SALCH       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALPC       ALPG--AALDNVASACCWMKLAGQAAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_SALSV       ALPG--AALDNVASACCWMKLAGQTAAERSE--GPG---------SFIPAFLDALYHLDV
THIM_CITK8       ALPG--NTLDNVASACSWMKQAGQSAAERSQ--GPG---------SFIPAFLDALYHLNA
THIM_ENT38       SLPG--DRLNNVAAACGFMKQAGSVAVKESR--GPG---------SFASAFIDALWNLEA
THIM_KLEP3       ALPG--DRLENVAAACGLMKQAGEIAARQG---GPG---------SFIPAFLDALYQEVQ
THIM_KLEP7       ALPG--DRLENVAAACGLMKQAGAIAARQG---GPG---------SFIPAFLDALYQEVQ
THIM_CROS8       ALPG--DRLENVATACWLMKRAGEEALTVSR--GPG---------SFASALLDNLHAQAF
THIM_SERP5       SLPG--DRLDNVATACRVMSHCGEMATRRAA--GPG---------SFTPAFLDALYQLRP
THIM_YERE8       ALEG--DRLHHVATACRIMSQVGGQVSQHVA--GPG---------SFVPAFLDGLYQLET
THIM_PECAS       SLEG--DRLSHVTAACYVMALAGQQATSVSQ--GTG---------SFIPHFLDRLYTLRA
THIM_PECCP       SLEG--DRVSHVAAACYVMALAGQQAASVSQ--GTG---------SFIPNFLDRLYTLRA
THIM_TOLAT       AGCEEKDRLDAVASACAVMAIAGQRAAAKAK--GPG---------SFVPAFLDNLYLLDA
THIM_LARHH       AMTD--DPLSGAAVACALMKLAGERAADKAA--GPG---------SFAVHLLDEIAALTP
THIM_LEPIN       GVQK--DPLRATASASAVFAIAGTRSAKISK--GSG---------SFAVNFLDQLNLLST
THIM_LEPIC       GVQK--DPLRATATASAVFAIAGTRSAKISK--GSG---------SFAVNFLDQLNLLST
THIM_LEPBJ       GIQK--DPLRASASASAVFAIAGSRSAKKSN--GPG---------SFAINFIDQLSQLSI
THIM_LEPBL       GIQK--DPLRASASASAVFAIAGSRSAKKSN--GPG---------SFAINFIDQLSQLSI
THIM_CLAM3       SLDP--DPLRAAVAATSVYTIAAEIAAEGAS--GPG---------SFAVGLLDALDAVTP
THIM_CLAMS       STDP--DPLRAAVAATSGYTIAADIAAEGAR--GPG---------SFAVGLLDALDAVTP
THIM_CORGB       DSDI--SAHDAVLAAHAHVGAAGQIAAQKAS--APG---------SFAVAFIDALYDVDA
THIM_CORGL       DSDI--SAHDAVLAAHAHVGAAGQIAAQKAS--APG---------SFAVAFIDALYDVDA
THIM_COREF       DTDI--DPHDAVVAAHAHLGAAGRIAATRAT--APG---------SYAVALIDALHQLDR
THIM_CUTAK       GIQN--DHLIAAVSATAMLCVVAERAAERSA--GPG---------AFAQALVDELFLVSP
THIM_KINRD       AVED--DPLVAAAAAHVHVAIAAERAAARAA--RPG---------SFATAWIDELDAVDA
THIM_RHOE4       AVTP--TALDGLVAAHTHVAVASEIAEENAS--GPG---------SFAVAYLDALYTVNA
THIM_BURP0       AQRG--AALAAASAAHAIYATAAER-AADAR--GTA---------SFAVRFVDELSLLDP
THIM_BURTA       AQRG--AALAAAAAAHAIYAIAAER-AADAR--GTG---------SFAVRFVDELSLLDP
THIM_BURP6       AQRG--AALAAASAAHAIYATAAER-AADAR--GTA---------SFAVRFVDELSLLDP
THIM_BURPS       AQRG--AALAAASAAHAIYATAAER-AADAR--GTA---------SFAVRFVDELSLLDP
THIM_BURP1       AQRG--AALAAASAAHAIYATAAER-AADAR--GTA---------SFAVRFVDELSLLDP
THIM_GRABC       AVEP--DPLVAACAGLCATGLAGELAAIRAD--GPG---------SLQVEFLDALYALDS
THIM_AKKM8       AVSP--TPLQAAVSTAVLMGIAGEMAFEQSP--SPG---------SFAVSLLDSLYALSP
THIM_RHOSK       AIRP---PFEATAAALAFFGLAGEEAAKTAT--GPG---------SFQVAFLDALHALSP
THIM_RHOS4       ATRP---PFEATAAALAFFGLAGEEAAKTAT--GPG---------SFQVAFLDALHTLSP
THIM_RHOS1       AIRP---PFEATAAALAFFGLAGEEAAKTAT--GPG---------SFQVAFLDALHALSP
THIM_RHOS5       AGQP---AFEATAAGLAFFGLAGEEAARRAA--GPG---------SFQVAFLDALHAMTP
THIM_RHIL3       ATAPE-DIFGATVAALSTFAIAGEEAALGAA--GPG---------SFSWRFLDALAALDA
THIM_RHILW       ATAPE-DLFGATVAALATFAIAGEEAALGAA--GPG---------SFAWRFLDALHALDA
THIM_RHIE6       ATAPE-DLFGATVAALATFAVAGEDAALGAA--GPG---------SFAWRFLDALAALDG
THIM_RHIEC       ATAPE-DLFGATVAALATFAVAGEDAALGAA--GPG---------SFAWRFLDALAALDG
THIM_AGRRK       ATRPD-HPLDATVAALAAFAVAGERAGRQVD--GPG---------SFSWRFLDALAALDE
THIM_ROSDO       ATGP---AFDAALAALAHFKVAGSTAAQRAD--GPG---------SFQMHFLDALANTQP
THIM_GEMAT       AVTA---PLEATVAALTLFAEAGARAHAHSE--GPG---------SFAWRFLDALAAVTP
THIM_PSYWF       GANKK-AMAQAAVTALCYYGQAAEHAMQIAQ--GPG---------SFYIHFLDSLYALQA
THIM_BIFLO       --LAVSDPLTAALSASLLYNRAGEVADTTSH--GPG---------SFQVAFLDALWNVTA
THIM_BIFLD       --LAVSDPLTAALSASLLYNRAGEVADTTSH--GPG---------SFQVAFLDALWNVTA
THIM_BIFLS       --LAVSDPLTAALSASLLYNRAAEIADTTSH--GPG---------SFQVAFLDALWNVTA
THIM_BIFAA       --LAVAEPLVAALAASLLYDRASEIAEVKSD--GPG---------SFQVALLDALWNVTA
THIM_BIFA0       --LAVADALVASLAASMLYNVSSGAAERASH--GPG---------SFQTAFLDALWNVTP
THIM_DICNV       --VLCGDVLYGAASACALMKRAGERAGLTTS--GLG---------SFYVALLDNLTFPMR
THIM_ACIBY       --SAVTTPTIAALSAHIHFAIAGKLAANQAQ--TMG---------SFSSIFMDYIHMLDA
THIM_ACIB3       --SAVTTPTIAALSAHIHFAIAGKLAANQAQ--TMG---------SFSSIFMDYIHMLDA
THIM_ACIB5       --SAVTTPTIAALSAHIHFAIAGKLAANQAQ--TMG---------SFSSIFMDYIHMLDA
THIM_ACIBT       --SAVTTPTIAALSAHIHFAIAGKLAANQAQ--TMG---------SFSSIFMDYIHMLDA
THIM_ACIBS       --SAVTTPTIAALSAHIHFAIAGKLAANQAQ--TMG---------SFSSIFMDYIHMLDA
THIM_ACIBC       --SAVATPTIAALSAHVHFAIAGKLAANQAQ--TMG---------SFSSIFMDYIHMLDD
THIM_ACIAD       --CAVAPVHLATIAAHIHFAIAGKLAYDQAQ--TIG---------SFNTMFMDYIHMMDA
THIM_LACCB       -LGTGLDNDAAVVVAVSYFNCCGEVAAAQNRTGGLA---------AFREGTLNQLSLLAA
THIM_LACP3       -LGTGLDNDAAVVVAVSYFNCCGEVAAAQNRTGGLA---------AFREGTLNQLSLLAA
THIM_ENTFA       -LGEGNAPMTAAVAAVSYFNLCGEKAKTKSQ--GLA---------DFRQNTLNQLSLLMK
THIM2_LEUMM      -LAVGEDPWVASQFAISYLNVAAEKALSLTN--GME---------NFRREVLNQIDLLGR
THIM2_STRP2      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRPN      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRR6      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRPI      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRP7      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRZP      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRPJ      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRPS      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRZT      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRZJ      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM2_STRP4      -LSQGKTGFEASCLAVSYLNIAAEKIVVQGM--GLE---------EFRYQVLNQLSLLRR
THIM_THEP3       ------DYFAATVEAFVAFGIAGERAAQSS---NV------KGPGSFKVTFFDEIYNLTP
THIM_THEPX       ------DYFETTIEAFVAFGIAGERAAQSS---NV------KGPGSFKVTFFDEIYNLTP
THIM_CALS4       ------DYFDGTLEAFVAFGIAGEKAAQNP---KV------EGPGSFKVAFFDEIYNLSP
THIM_METBF       ------DYFEASREALCYFGVAGELAARES-----------NGPGSFKVNLYDEVFNLSD
THIM_METMA       ------DYCDAAKDALCYFGAAGELAAKNS-----------AGPGSFKVNLYDEVFNLSD
THIM_METAC       ------DYCDAAKDALCYFGASGELAAAKS-----------SGPGSFKVHLYDEVFNLSD
THIM_METAR       ------DYVTSTAAALASFGVAGEKAAKRC-----------EGPASFKIALLDEIYRLTA
THIM_METPE       ------DQVCSTAAALAAFGLAGEKAAKRA-----------FGPSSFKVALMDEVAALTP
THIM_METMJ       ------DYAVASAAALAAFGLAGEWGAAGA-----------RGPYTFRTALFDELAGLSP
THIM_METB6       ------DRLIAAATALAAFGLAGERAAAAS-----------RGPGSFKPALFDAMAELGP
THIM_METHJ       ------DYLSASATGVSAFGIAGERAAVDA-----------AGPGSFKCRLFDSMASVRS
THIM_METLZ       ------DSMDGCITAMAALGIAGEEAAKTA-----------KGPGSFKPAFFDAVTSLTN
THIM_RUBXD       S-----ADPETVAHALAYFGCAGEEAARGA-----------GGPGTFEARLLDALAALSS
THIM_MOOTA       ------DGVTASTAALAYYGLAAERAAAVS-----------QGPASFQVALLDTLYNLAG
THIM_DESOH       ------DLLVASAAALGYYGLAGEEAARIS-----------NGPGSFQAALLDTLYNLPE
THIM_DESPS       ------DYLRAATTALAFFGLAGEMAGKAA-----------TGPGSFMIHLLDALYNMSP
THIM_CHLAA       ------EYPFAAAAALACFGLAAELAAPAA-----------RGPASFKVAFYDAIYHLSA
THIM_CHLSY       ------EYPFAAAAALACFGLAAELAAPAA-----------RGPASFKVAFYDAIYHLSA
THIM_CHLAD       ------DYLFAAAAGLACFGLAAELAAPQA-----------RGPASFKVAFYDAIYHLAA
THIM_ROSS1       ------DYLLAAAGGLAMFGLAAELAAEKA-----------HGPASFKVALFDQIYNLTP
THIM_ROSCS       ------DYLLAAAGGLAMFGLAAELAAEKA-----------HGPASFKTALFDQIYNLTP
THIM_DESAP       ------DFLVAAAGALAAYGLAAELAAREA-----------RGPASFRTALLDRIYSLTP
THIM_DESAL       ------IPVTAAACALMCYGLAAEIAAPQA-----------KGPASFKVAFYDALYNLNA
THIM_SYNFM       ------DPLVAATAGLSVLGIAGELAARDN-----------PGPGTFHHLLLDALDAMET
THIM_NATPD       NA----TPLDAALAGTVGFGLAGEKAAEE--GE-Y------NGPASYKTAFLDTVAGLEA
THIM_HALWD       D------PLTAALTGTVAFGLAGEAAANGEFGE-Y------AGPASYETTVLDAAAGTDP
THIM_PYRAB       ------EPLRAAISSLVVFGIAAEKAYEEA-----------KYPGSFHVKLYDWLYRIDG
THIM_PYRHO       ------EPLKATTSALVTFGIAAEKAYEEA-----------KYPGSFHVKLYDWLYRINE
THIM_PYRFU       ------DPLTSAVSSLVVFEVAAEKAAEEA-----------KAPGTFHAKLYDWLYLLTP
THIM_METM5       ------EPLKAAVSGLTVYGISAEMAFSEA-----------PYPGTFQAKVYDWLYRIDE
THIM_METM7       ------EPLKAAVSGLTVYGISAEMAFAEA-----------PYPGTFQAKVYDWLYRIDE
THIM_METM6       ------EPIKAAVSGLTVYGISAEMAFGEA-----------PYPGTFQAKVYDWLYRIDE
THIM_METMP       ------DPLKAAVSGLVVYGISAEMAFTEA-----------PYPGTFQAKVYDWLYRIDE
THIM_METVS       ------EPLKASVSGLVTYGISAEMAFEES-----------FYPGTFQAKLYDWLYRIDE
THIM_COPPD       ------EPLPAAMSALSLMGAASQIAAEQS-----------DGPGTFRIRMFDVMYQITQ
THIM_CALMQ       ------DFVKASVEGLVAFEIAAEKAEAKS-----------KAPGTFKQYLIDELFNLTG
THIM_ARCFU       ------DFLLASLEGLACYNVAGELAAEKS-----------SGTASFRSNLIDEISKITA
THIM_CLOTE       ---E-ENYLQATLSGVVSMGIAGEIAYEKTK---------NLGPSSFRTALIDSIYNLEE
THIM_ALKOO       ---G-KGILQGAILGTMIMGIAGEKANERLKV--------HEGLGSFKVYLMDAVSNFDQ
THIM_CLOB8       ---G-SDYFIGAVSGIISMGISGEIALDKAG---------KIGTGSFHIAIIDAISNLTS
THIM_RUMCH       ---V-KDYFKAAVAGVTVMGISGEIAYEAAG---------HKGTGSYHIAIIDAISRMDE
THIM_CLOBA       ---S-DDYFIAAICAVLTMSISGEIAYEKSK---------GIGMGTFHISLIDAISMMNE
THIM_CLOBB       ---S-NDYFIAAICAILTMGISGEIAYEKSK---------GIGMGTFHTSLIDAISMMNE
THIM_ALKMQ       ---T-DQALLAALAGVLIMDLAGEGAYASLKA--------HESIGTFKVRIFDHIHQLTE
THIM_EXIS2       ---G-YGRFDAAVFGTYAMGKAGETAGN------------RPGIGSFRTGLFDAVSLMTE
THIM_CLOD6       ---T-ENILEAATMGVLTMSLSGELANLN-----------NPPIGTFKENLMNAIYQMDI
THIM_CLOAB       --NV-DSPLEATLASVCAMGICGELAYNRLSKRDG--------NSSYRNYIIDEVFNLDG
THIM_DESDA       --AP-YEMPQACLCAVSALGVAGEIAAETMVGGGGEMGGLGGGTGSYRALLLDAMSLLDG
THIM1_METST      ---V-TNPLEAAITGTLVMGIAGELAAKTARDNNK-------GTGSFGIYLIDELSKLNK
THIM2_METST      ---I-TSPLEAAIIGSLSMAISGELARRKMEINNE-------GSGSFRTYLIDMMYNMND
THIM_METS3       ---A-TNPLEGTMVAALLMTIAGEKARSKVDSENA-------GTGSFRAYLIDYLYKLDG
THIM_CLOPE       --HK-DLRFKEVVKAVSTWGICGELAEERLR-EKE-------GLMTFKHNLLDELSIIND
THIM_CLOPS       --HK-DLRFKEVVKAVSTWGICGELAEERLR-EKE-------GLMTFKYNLLDELSIIND
THIM_CLOP1       --HK-DLRFKEVVKAVSTWGICGELAEERLR-EKE-------GLMTFKHNLLDELSIIND
THIM2_CLOB6      ---S-GNILEGTALAIVLMGICGELSQHVK------------GTGSFRNELIDNIFSISD
THIM2_CLOBK      ---S-GNILEGTALAIVLMGICGELSQHVK------------GTGSFRNELIDNIFSISD
THIM2_CLOBL      ---S-GNILEGTALAIVLMGICGELSQHVK------------GTGSFRNELIDNIFSISD
THIM2_CLOBJ      ---S-GNILEGTALAIVLMGICGELSQHVK------------GTGSFRNELIDNIFSISD
THIM1_CLOBM      ---S-GNILEGTALAIAIMGICGELSQNVK------------GTGSFRNELIDNMFSISD
THIM2_CLOB1      ---S-ENILDGTVLAVALMGICGELSQHAK------------GTGSFRNELTDNMFSISD
THIM2_CLOBH      ---S-ENILDGTVLAVALMGICGELSQHAK------------GTGSFRNELTDNMFSISD
THIM_FINM2       ---V-SQSIKACVLAISMMNISCEMVDKSV------------GLSSFKLGLYDNLSRIKW
THIM_CAMLR       ---I-EDKFQASLQAMLSFDIACEMAEEISN-----------GSGSFRVNLIDALSNLND
THIM_DESHY       -----EDAFGATVAALLTMSLAGELAQETSGGEL---------PGTFRAHLIDQLSLVDE
THIM_DESHD       -----EDAFGATVAALLTMSLAGELAQETSGGEL---------PGTFRAHLIDQLSLVDE
THIM1_CLOB1      -----EDKLVSTTAAILSMNIAGEKAYEEAQL-----------PGSFRIALIDNIYMISD
THIM1_CLOBH      -----EDKLVSTTAAILSMNIAGEKAYEEAQL-----------PGSFRIALIDNIYMISD
THIM1_CLOBK      -----EDKLVSTTAAILSMNIAGEKAYEKAQL-----------PGSFRIALIDNIYMISD
THIM1_CLOBJ      -----EDKLVSTTAAILSMNIAGEKAYEKAQL-----------PGSFRIALIDNIYMISD
THIM1_CLOB6      -----EDKLVSTTAAILSMNIAGEKAYEKAQL-----------PGSFRIALIDNIYMISD
THIM1_CLOBL      -----EDKLVSTTAAILSMNIAGEKAYEKAQL-----------PGSFRIALIDNIYMISD
THIM2_CLOBM      -----EDKLVSTTAAILSMNIAGEKAYEKAQL-----------PGSFRIALIDNIYMISD
THIM_CLOK1       -----EDKFMAVVGAILSINIASEEAYKEAKA-----------PGSFRVKLIDCIYELSE
THIM_CLOK5       -----EDKFMAVVGAILSINIASEEAYKEAKA-----------PGSFRVKLIDCIYELSE
THIM_CLONN       -----DDKFIATITSILSMNIAAEHTEKEVIG-----------PGSFKVKLIDNIYLLKE
THIM_SYNWW       -----EEAWLASITGLLAFNLAGERAASQAGNR----------PGTFRTLLFDELFVLRG
THIM_NATTJ       -----DNDWEAGIAATVSMGVVGEMAEESISSSTD--------LGSFRVKIFDHMAALTS
THIM_LACPL       T-----DVYQAAQVACLVLAGAGELVASQL---------TADRPATFAIDLIDRLSLVTV
THIM_LACBA       ------DTFEAAQTACLVFAAIGQRVVQTV---------PDVGAGSFTVHLLDALQSTTV
THIM_LACSS       D-----NPYQAAIDAATTFAVAGQLVAEAM---------PTPLPGSFYPQLLDCLFNITA
THIM_LACF3       ------DAFDAAVDAVTTFTLCGQAVEDQ-------------RPGNWYPGLLNNLDAVTD
THIM_PEDPA       ------NTLDAAVTASLVLSCAGERAAAQLD--------QQNRPGSFLSYLLDELANITP
THIM_LACRJ       ------NTWDACIVATVLVSAAGVLANRYS-----------VGLGSWQVQFFDQLSIMDT
THIM_LACRD       ------NTWDACIVATVLVSAAGVLANRYS-----------VGLGSWQVQFFDQLSIMDT
THIM_LACLM       D-----LFTAAYEATKFFGEAGMIATKQVQN--------L---PGNFVNSLLDTLYQTTH
THIM_LACLS       D-----LFTAAYEATKFFGEAGMIATKQVQN--------L---PGNFVNSLLDTLYQATQ
THIM_LACLA       D-----LFKAAYEATEFFGESGVKATEQVEN--------L---PGNFVNRFLDKIYQATQ
THIM1_LEUMM      L-----KVPNVMNAMATFKLAGQKAATKTNQ------------PGSFTNQLLDELFVIDN
THIM_LEUCK       I-----SLDNTVRAMAMMKLAGLTASHQVTT------------PGYFANQVLDELYLLSE
                                                                             

THIM_GEOTN       DDVKREGRVEQR--------------
THIM_GEOKA       DDVKRHGRVEQR--------------
THIM_GEOSW       DEISRYGRIEQGE-------------
THIM_BACC4       GDIEKYGKIEELE-------------
THIM_BACCR       SDIEKYGKIEELE-------------
THIM_BACC2       ADIEKYGKIEELE-------------
THIM_BACCQ       GDIEKYGEIEVI--------------
THIM_BACC7       GDIEKYGEIEVI--------------
THIM_BACC1       GDIEKYGKIEVI--------------
THIM_BACAH       GDIEKYGKIEVI--------------
THIM_BACC3       GDIEKYGKIEVI--------------
THIM_BACAA       GDIEKYGKIEVI--------------
THIM_BACC0       GDIEKYGKIEVI--------------
THIM_BACAN       GDIEKYGKIEVI--------------
THIM_BACAC       GDIEKYGKIEVI--------------
THIM_BACHK       GDIEKYGKIEVI--------------
THIM_BACCZ       SDIEKYGKIEVI--------------
THIM_BACMK       DDIEKYGKIEVIQ-------------
THIM_BACCN       SDIEQYGKAEEVR-------------
THIM_BREBN       EDVRRLGYIEKRE-------------
THIM_BACSU       QDVQEWATIERVTVS-----------
THIM_BACVZ       QEAAELAAIERVIEK-----------
THIM_BACLD       MDIKERGRIREVE-------------
THIM_BACP2       NDVLTLGKIGRNVT------------
THIM_ANOFW       EEVDQYARIQGE--------------
THIM_BACHD       EDVKQHGRFERS--------------
THIM_BACSK       EKAAALKRVEQIC-------------
THIM_LISMC       EKTRAKAKIQESGEHK----------
THIM_LISMF       EKTRAKAKIQESGEHK----------
THIM_LISIN       EKTRAKAKIQESGEHK----------
THIM_LISMO       EKTRAKAKIQESGEHK----------
THIM_LISMH       EKTHAKAKIQESGEHK----------
THIM_LISW6       EKTRAKAKILESGEHK----------
THIM_HAEIN       ETIGQRGRINE---------------
THIM_HAEI8       ETIGQRGRINE---------------
THIM_HAEIG       ETIGQRGRINE---------------
THIM_HAEIE       ETIRQRGRINE---------------
THIM_HAES1       EQINQYARISYE--------------
THIM_PASMU       ETINQYARISYE--------------
THIM_HAEPS       TQTEQLMKAEWII-------------
THIM_ACTSZ       TRLADKARVLAQHE------------
THIM_EXISA       YTIPTNRIEVSTS-------------
THIM_LYSSC       EGEASCIL------------------
THIM_STAEQ       ITYKNQVKKVEI--------------
THIM_STAES       ITYKNQVKKVEI--------------
THIM_STAHJ       NTYQQQVKRQEVE-------------
THIM_STAA3       TTYQQRIRIQEVE-------------
THIM_STAAE       TTYQQRIRIQEVE-------------
THIM_STAA8       TTYQQRIRIQEVE-------------
THIM_STAAC       TTYQQRIRIQEVE-------------
THIM_STAAW       TTYQQRIRIQEVEKYV----------
THIM_STAAS       TTYQQRIRIQEVEKYV----------
THIM_STAAM       TTYQQRIRIQEVE-------------
THIM_STAA9       TTYQQRIRIQEVE-------------
THIM_STAAN       TTYQQRIRIQEVE-------------
THIM_STAA2       TTYQQRIRIQEVE-------------
THIM_STAA1       TTYQQRIRIQEVE-------------
THIM_STAAR       TTYQQRIRIQEVE-------------
THIM_STAAB       TTYQQRICIQEVE-------------
THIM_STAS1       DDYSNQSDIQEVQ-------------
THIM_STACT       DAVAENCNLEEVK-------------
THIM_MACCJ       DDIAKESRVKEV--------------
THIM1_STRPS      EDVKEFKRVK----------------
THIM1_STRPJ      EDVKEFKRVK----------------
THIM1_STRP2      EDVKEFKRVK----------------
THIM1_STRR6      EDVKEFKRVK----------------
THIM1_STRP4      EDVKEFKRVK----------------
THIM1_STRP7      EDVKEFKRVK----------------
THIM1_STRZP      EDVKKFKRVK----------------
THIM1_STRZT      EDVKEFKRVK----------------
THIM1_STRPI      EDVKEFKRVK----------------
THIM1_STRZJ      EDVKEFKRVK----------------
THIM1_STRPN      EDVKEFKRVK----------------
THIM_STRSY       EEVEENKKVIHYE-------------
THIM_STRS2       --------------------------
THIM_STRA1       EMIMDK--------------------
THIM_STRA5       EMIMDK--------------------
THIM_STRA3       EMIMDK--------------------
THIM_HELPG       LENSLIKEEW----------------
THIM_HELPY       LENSLIKEEW----------------
THIM_HELPH       LENSLIKEVL----------------
THIM_HELPS       LENSLIKEEL----------------
THIM_HELPJ       LENSLIKEEL----------------
THIM1_OCEIH      MPQELTEGE-----------------
THIM_CARHZ       EEFLELTTEKVQGLR-----------
THIM_DESRM       DEFKKILEAPKI--------------
THIM2_OCEIH      EKVEKYKQVHEL--------------
THIM_DESVV       V---TVRDEVEVVRA-----------
THIM_DESVH       V---TVRDEVEVVRA-----------
THIM_DESVM       A---DIRARVRVGRP-----------
THIM_DESAG       F---DVEAGVEIVR------------
THIM_DESMR       A---EIAAGARVSA------------
THIM_LEPBA       D---TIKQKLNAK-------------
THIM_LEPBP       D---TIKQKLNAK-------------
THIM_SYNAS       E---DIARRLRIVAGE----------
THIM_CHLT3       A---DVHSHLKICA------------
THIM_RHOFT       G---TFEQRLKLEVAQW---------
THIM_LEPCP       A---TFRARLKMTVHG----------
THIM_VIBPA       E---TLATRLKLQVR-----------
THIM_VIBCB       E---TLAKRLKMQVS-----------
THIM_VIBA3       E---TLIQRLKVQ-------------
THIM_ALIF1       E---TLTRRLKLTVNA----------
THIM_ALIFM       E---TLTRRLKLTVNA----------
THIM_ALISL       E---TLMNRLKLTVNA----------
THIM_PSYIN       A---TLIQRLKLS-------------
THIM_PHOPR       A---VLREYIRINLVEEGCH------
THIM_BRAHW       N---DAANRVKE--------------
THIM_DESAH       K---NLAARLKVESTAS---------
THIM_CHLFF       D---RMRRYHNQ--------------
THIM_CHLCV       D---RMRRYYEQ--------------
THIM_CHLAB       S---RMRQYYDR--------------
THIM_HERA2       L---IDNSRLSYRMEQHDAD------
THIM_SHIB3       E---VQA-------------------
THIM_ECOSM       E---VQA-------------------
THIM_ECOLU       E---VQA-------------------
THIM_ECO45       E---VQA-------------------
THIM_ECOK1       E---VQA-------------------
THIM_ECOUT       E---VQA-------------------
THIM_ECOL6       E---VQA-------------------
THIM_ECO7I       E---VQA-------------------
THIM_ECO81       E---VQA-------------------
THIM_ECO27       E---VQA-------------------
THIM_ECOL5       E---VQA-------------------
THIM_SHIBS       E---VQA-------------------
THIM_ECO24       E---VQA-------------------
THIM_ECO55       E---VQA-------------------
THIM_ECOSE       E---VQA-------------------
THIM_ECO8A       E---VQA-------------------
THIM_SHISS       E---VQA-------------------
THIM_ECODH       E---VQA-------------------
THIM_ECOLI       E---VQA-------------------
THIM_ECOHS       E---VQA-------------------
THIM_ECOLC       E---VQA-------------------
THIM_ECOBW       E---VQA-------------------
THIM_SHIFL       E---VQA-------------------
THIM_SHIF8       E---VQA-------------------
THIM_ECO57       E---VQA-------------------
THIM_ECO5E       E---VQA-------------------
THIM_SHIDS       E---VQA-------------------
THIM_ESCF3       E---VEA-------------------
THIM_SALPA       E---AANATN----------------
THIM_SALPK       E---AANATN----------------
THIM_SALAR       E---AANATN----------------
THIM_SALEP       E---AANATN----------------
THIM_SALTY       E---AANATN----------------
THIM_SALG2       E---AANATN----------------
THIM_SALDC       E---AANATN----------------
THIM_SALNS       E---AANATN----------------
THIM_SALHS       E---AANATN----------------
THIM_SALA4       E---AANATN----------------
THIM_SALPB       E---AANATN----------------
THIM_SALTI       E---AANATN----------------
THIM_SALCH       E---AANEEN----------------
THIM_SALPC       E---AANEEN----------------
THIM_SALSV       E---AANEEN----------------
THIM_CITK8       E---EQV-------------------
THIM_ENT38       Q---A---------------------
THIM_KLEP3       G-------------------------
THIM_KLEP7       G-------------------------
THIM_CROS8       G---GAYETH----------------
THIM_SERP5       E---DLQ-------------------
THIM_YERE8       L---TY--------------------
THIM_PECAS       E---DLA-------------------
THIM_PECCP       E---DLA-------------------
THIM_TOLAT       V---TIAEALA---------------
THIM_LARHH       A---DLAQRWPA--------------
THIM_LEPIN       E---K---------------------
THIM_LEPIC       E---K---------------------
THIM_LEPBJ       E-------------------------
THIM_LEPBL       E-------------------------
THIM_CLAM3       E---LVAQRERLA-------------
THIM_CLAMS       E---LVAQSERLS-------------
THIM_CORGB       Q---AVASLVDVREA-----------
THIM_CORGL       Q---AVASLVDVREA-----------
THIM_COREF       N---QLANLTHLREENR---------
THIM_CUTAK       D---EVGERGGLRDVTA---------
THIM_KINRD       D---AVR--ADLETSGRLA-------
THIM_RHOE4       D---TIRSRARIESFDLPAGVQN---
THIM_BURP0       A---ESSRDRSAGQIGAKRRE-----
THIM_BURTA       G---E---------------------
THIM_BURP6       A---ESSRDRSAGQIGAKRRE-----
THIM_BURPS       A---ESSRDRSAGQIGAKRRE-----
THIM_BURP1       A---ESSRDRSAGQIGAKRRE-----
THIM_GRABC       A---ILRDAARWVLP-----------
THIM_AKKM8       E---DVVRRARFLSL-----------
THIM_RHOSK       E---ALDRGARLEAA-----------
THIM_RHOS4       E---ALDRGARLEAA-----------
THIM_RHOS1       E---ALDRGARLEAA-----------
THIM_RHOS5       D---DLDRGAKLEAA-----------
THIM_RHIL3       E---TLDARARISAA-----------
THIM_RHILW       E---TLDARARISAA-----------
THIM_RHIE6       E---ALDARARVSIA-----------
THIM_RHIEC       E---ALDARARVSLA-----------
THIM_AGRRK       K---AIDSEARVISL-----------
THIM_ROSDO       F---ELAQVIR---------------
THIM_GEMAT       D---DLTGTERVSWNAP---------
THIM_PSYWF       T---DVSQQARVTLYE----------
THIM_BIFLO       E---QVAESEILVQ------------
THIM_BIFLD       E---QVAESEILVQ------------
THIM_BIFLS       E---QVAESEILVQ------------
THIM_BIFAA       D---QVAASDIIETN-----------
THIM_BIFA0       E---EIASAPLYLA------------
THIM_DICNV       Y---QD--------------------
THIM_ACIBY       N---LIEQYADVKLLNKQA-------
THIM_ACIB3       N---LIEQYADVKLLNKQA-------
THIM_ACIB5       N---LIEQYADVKLLNKQA-------
THIM_ACIBT       N---LIEQYADIKLLNKQA-------
THIM_ACIBS       N---LIEQYADIKLLDKQA-------
THIM_ACIBC       N---LIEQYADIKLLNIQA-------
THIM_ACIAD       N---LIEQYACIELISDD--------
THIM_LACCB       T---ADWLQMVKGEAL----------
THIM_LACP3       T---ADWLQMVKGEAL----------
THIM_ENTFA       E---KDWFEAVKGRVL----------
THIM2_LEUMM      N---QQWATKIKYSNF----------
THIM2_STRP2      D---ENWLDTIKGEVYE---------
THIM2_STRPN      D---ENWLDTIKGEVYE---------
THIM2_STRR6      D---ENWLDTIKGEVYE---------
THIM2_STRPI      D---ENWLDTIKGEVYE---------
THIM2_STRP7      D---ENWLDTIKGEVYE---------
THIM2_STRZP      D---ENWLDTIKGEVYE---------
THIM2_STRPJ      D---ENWLDTIKGEVYE---------
THIM2_STRPS      D---ENWLDTIKGEAYE---------
THIM2_STRZT      D---ENWLDTIKGEAYE---------
THIM2_STRZJ      D---ENWLDTIKGEVYE---------
THIM2_STRP4      D---ENWLDTIKGEVYE---------
THIM_THEP3       ---EIIEKDKKVEYE-----------
THIM_THEPX       ---EIIEKDKKVEV------------
THIM_CALS4       ---GVLASERKIDLIVKG--------
THIM_METBF       ---EKVRSMMNFEEQ-----------
THIM_METMA       ---EKVQAMMKVEEL-----------
THIM_METAC       ---EKVKSMKNFEEK-----------
THIM_METAR       ---DEVAHNIKVRFA-----------
THIM_METPE       ---PVLSAGAKIRIL-----------
THIM_METMJ       ---DDLAGHARIEER-----------
THIM_METB6       ---QDLAADARVRSA-----------
THIM_METHJ       ---DDVDRYGRIRSV-----------
THIM_METLZ       ---EQFIKSARISEYQ----------
THIM_RUBXD       ---DPSRLSGRLRVGDAGAG------
THIM_MOOTA       ---EELARGVKIRLL-----------
THIM_DESOH       ---KIIQEKLRIREVLP---------
THIM_DESPS       ---EQLEKGCRIKESSATRS------
THIM_CHLAA       ---DQIRAGARVTAVAG---------
THIM_CHLSY       ---DQIRAGARVTAVAG---------
THIM_CHLAD       ---DQIRAGARVVDLSTEQSKAVAQS
THIM_ROSS1       ---EQVANGARVVEGGS---------
THIM_ROSCS       ---EQVAAGARIAELEW---------
THIM_DESAP       ---EQVAEGARVERLRQP--------
THIM_DESAL       ---EQIEKGGRVREVS----------
THIM_SYNFM       ---RNIEEKGRIAVSWEQ--------
THIM_NATPD       ---APDDPAGRIERVLSVT-------
THIM_HALWD       EMIAAVDIDNRVNRVLAEAK------
THIM_PYRAB       E---VIRKYAKVREVGV---------
THIM_PYRHO       N---VIRTYAKVREVEL---------
THIM_PYRFU       E---DVERLKKIEVVKV---------
THIM_METM5       K---LVFEKAKVNKFEI---------
THIM_METM7       K---LVLEKAKVNKFEI---------
THIM_METM6       E---LVLEKAKVNKFEI---------
THIM_METMP       K---LVLEKAKVNKFEI---------
THIM_METVS       K---LILEKAKVNRIDI---------
THIM_COPPD       NP--HAFSFPQWELMEV---------
THIM_CALMQ       D---DYVKMAKVEVVQ----------
THIM_ARCFU       E---KVIERLNLERVV----------
THIM_CLOTE       S---SFNERGKVYNA-----------
THIM_ALKOO       D---DIRKRGKVDEI-----------
THIM_CLOB8       N---IIEKMNKIKEI-----------
THIM_RUMCH       N---IFGEKARINEI-----------
THIM_CLOBA       N---VIKEKARVTTINR---------
THIM_CLOBB       N---IIKEKAKVTTINR---------
THIM_ALKMQ       Q---TILEGGSLDVSYR---------
THIM_EXIS2       E---SLPE---VQMNGQ---------
THIM_CLOD6       D---ALSKNSNIEFLN----------
THIM_CLOAB       D---KLDDAARYESY-----------
THIM_DESDA       L---ALGSRADVTRIQM---------
THIM1_METST      S---TILSQSKLNKM-----------
THIM2_METST      E---TIMKYGKLYKLE----------
THIM_METS3       Q---TLINKSNIEIL-----------
THIM_CLOPE       E---TIKEREKVIYE-----------
THIM_CLOPS       E---IIKEREKVIYE-----------
THIM_CLOP1       E---TIKEREKVIYD-----------
THIM2_CLOB6      D---IIIKKIRINSY-----------
THIM2_CLOBK      D---IIIKKIRINSY-----------
THIM2_CLOBL      D---IIIKKIRINSY-----------
THIM2_CLOBJ      D---IIIKKIRINSY-----------
THIM1_CLOBM      D---IIIKKIRINSY-----------
THIM2_CLOB1      D---IIIKKIRINSY-----------
THIM2_CLOBH      D---IIIKKIRINSY-----------
THIM_FINM2       E---QIKENIDAKKVES---------
THIM_CAMLR       E---DVKKRAKYEII-----------
THIM_DESHY       A---LIEKRGRVQWL-----------
THIM_DESHD       A---LIEKRGRVQWL-----------
THIM1_CLOB1      E---EIWERGNVEWK-----------
THIM1_CLOBH      E---EIWERGNVEWK-----------
THIM1_CLOBK      E---EIWERGNVEWK-----------
THIM1_CLOBJ      K---EIWERGNVEWK-----------
THIM1_CLOB6      E---EIWERGNVEWK-----------
THIM1_CLOBL      E---EIWERGNVEWK-----------
THIM2_CLOBM      E---EIWERGNVEWK-----------
THIM_CLOK1       E---KLKKEGKIAWN-----------
THIM_CLOK5       E---KLKKEGKIAWN-----------
THIM_CLONN       N---HLRKEGKIKWI-----------
THIM_SYNWW       E---ELMKEGRLEW------------
THIM_NATTJ       K---ELQERGNVSEL-----------
THIM_LACPL       SEIQTIAKVD----------------
THIM_LACBA       AQIEAVAAYE----------------
THIM_LACSS       ADVQTHAQVTEVLTHE----------
THIM_LACF3       QQLAAWQ-------------------
THIM_PEDPA       EQVQDLMKIGEA--------------
THIM_LACRJ       KALLEFFDESEEDYLD----------
THIM_LACRD       KALLEFFDESEEDYLD----------
THIM_LACLM       EIK-----------------------
THIM_LACLS       EIK-----------------------
THIM_LACLA       EVI-----------------------
THIM1_LEUMM      IDVQNFVKESVLNHG-----------
THIM_LEUCK       SKLETFIAKEVKKYE-----------