CLUSTAL format seed alignment for MF_00229

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HUTH_AGRRH       -----MTIVLRPGSVPLHHLADIYWNNGSAKLDPSFDAAVLKGAARIAEIAAGNAPVYGI
HUTH_AGRFC       --MTMKTITLHPGAVTLADLAAIYWENGTAKLDRSFDAGIEKAAARIAEIAAGNAPVYGI
HUTH_RHIME       -----MTVILRPGSVPLSDLETIYWTGAPARLDAAFDAGIAKAAARIAEIVAGNAPVYGI
HUTH_CAUVC       ----MTELVLNPGAVPLAEWKAIYR-GASARLAESAWPVIAESAAAVQRILAKGEPVYGI
HUTH_RHILO       ----MTELTLKPGNATLADWRAIYR-GAVPKLDEACRPKIKASAEAVARIVAKGEPVYGI
HUTH_XANAC       ---MSVSIVLQPGQVTLAQWRALYR-GAEVALDDACAAAVLRSAQTVEAIVARGEPVYGV
HUTH_XANCP       ---MSASVVLQPGQVTLAQWRALYR-GAEVTLDPACAQAVLRSAQTVEAIVARGEPVYGV
HUTH_PSEAE       -----MSLHLKPGQLTLADLRQAYLAPVRLSLDPSADAPIAASVACVENIIAEGRTAYGI
HUTH_PSEPU       ----MTELTLKPGTLTLAQLRAIHAAPVRLQLDASAAPAIDASVACVEQIIAEDRTAYGI
HUTH_YERPE       ----MKTITLRPGQMTLADLRHIYQHPVHITLDESAYVPIQQSVDCVQAILAEQRTAYGI
HUTH_SALTI       ----MNTMTLTPGQLSLSQLYDVWRHPVQLRLDASAIDGINASVACVNDIVAEGRTAYGI
HUTH_SALTY       ----MNTMTLTPGQLSLSQLYDIWRHPVQLRLDASAIDGINASVACVNDIVAEGRTAYGI
HUTH_VIBCH       ----MLHLMIKPGQLSLKQLRQVSRSPVVLSLDPEAIPAIAESAQVVEQVISEGRTVYGI
HUTH_RALSO       -MTTPSILTLHPGEMTFADLRRVWLAPTPVTLSGDCAAAIEASAATVQAIVARGEPAYGI
HUTH_DEIRA       --------MILDRDLNLEQFISVVRHGEQVELSAAARERIARARTVIEQIVEGDTPIYGV
HUTH2_FUSNN      ---MQKIIEINGSNLTIEDVVAVARYGAKVKLDEKQKDKILESRKYVEEALSNKMPIYGI
HUTH_CALS4       ----MKKVVIDGNNLTIEDVVKVARDKWEVVLSEVAKERIVHSREIVDRYVKEGKVVYGI
HUTH_STRP1       ---MTRVINLDGESLTIEDVIAIARQGVACHIDDSAIEAVNASRKIVDDIVSEKRVVYGV
HUTH_STRP8       ---MTRVINLDGESLTLEDVIAIARQGVACRIDDSAIEAVNASRKIVDDIVSEKRVVYGV
HUTH1_FUSNN      MEVFILELVLGSKNITLEDLINVTRKGYKVSISEEAYEKIDKARALVDKYVEEGKVSYGI
HUTH_BACHD       ---MTNLKLLDGRSLSLHDLHRIIYEGETVGASDESMEKVKQSRKAVEQIVADEKIIYGI
HUTH_BACSU       ------MVTLDGSSLTTADVARVLFDFEEAAASEESMERVKKSRAAVERIVRDEKTIYGI
HUTH_STAAM       -----MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGI
HUTH_STAAW       -----MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGI
HUTH_THEAC       ------MIEIDGRSLRVEDVYAVAVEYDRVSISDDTLKAVEEKHEAFLKLINSGKTVYGV
HUTH_THEVO       ------MIEIDGDNLTLEDVYSVSVLHEPVELSTKARNKVAEIHRKFLDLISSGQTIYGV
HUTH_STRCO       ----MHTVVVGTSGVTASDVLAVARAGARIELSEEAVAALAAARSVVDALAAKPDPVYGV
HUTH_STRGR       ----MHTVVVGTSGTTAEDVVAVARHGARVELSAAAVEALAAARLIVDALAAKPEPVYGV
HUTH_HALSA       --MTTEGVVIDGESLTPAAVDAVARHDAPVSIAAGAREAVRESRARIADVLGGDEAVYGV
                          :                             :      .          **:

HUTH_AGRRH       NTGFGKLASIKIDAADLATLQRNLILSHCCGVGAPLPENVVRLIMALKLISLGRGASGVR
HUTH_AGRFC       NTGFGKLASIKIDAADVATLQRNLILSHCCGVGVPLPENVVRLIMALKLVSLGRGASGVR
HUTH_RHIME       NTGFGKLASIKIDSSDVATLQRNLILSHCCGVGQPLTEDIVRLIMALKLISLGRGASGVR
HUTH_CAUVC       NTGFGKLASVRIGDADLETLQRNIVLSHAAGVGEPSPVPVIRLMMALKLASLAQGASGVR
HUTH_RHILO       NTGFGKLASVRIPAGDLETLQRNIVLSHAAGVGEPMPVAIARLMMALKLASLAQGASGVR
HUTH_XANAC       NTGFGKLASVRIEREDLQALQRNIVLSHAAGVGEPTPVPVVRLMMALKLTSLAQGASGVQ
HUTH_XANCP       NTGFGKLASVRIERDDLQTLQRNIVLSHAAGVGDPTPVPVVRLMMALKLTSLAQGASGIQ
HUTH_PSEAE       NTGFGLLASTRISPADLEKLQRSIVLSHAAGVGEALDDAMVRLVMLLKVNSLARGFSGIR
HUTH_PSEPU       NTGFGLLASTRIASHDLENLQRSLVLSHAAGIGAPLDDDLVRLIMVLKINSLSRGFSGIR
HUTH_YERPE       NTGFGLLASTRIATEDLENLQRSIVLSHAAGVGEANDDAIVRLIMVLKINSLARGFSGIR
HUTH_SALTI       NTGFGLLAQTRIADEDLQNLQRSLVLSHAAGVGDPLDDAMVRLIMVLKINSLARGFSGIR
HUTH_SALTY       NTGFGLLAQTRIADEDLQNLQRSLVLSHAAGVGDPLDDAMVRLIMVLKINSLARGFSGIR
HUTH_VIBCH       NTGFGLLANTKIAPQDLETLQKSIVLSHAAGIGELMSDETVRLMMLLKINSLARGYSGIR
HUTH_RALSO       NTGFGKLARTQIATHELEHLQRNLILSHAVGTGQDLDDNVARLVLLMKAASLARGYSGVR
HUTH_DEIRA       NTGFGKFENVQIDRSQLAQLQHNLIVSHAIGMGEPLPAEVVRGMLLLRAQSLSLGHSGVR
HUTH2_FUSNN      NTGFGKFENVPISEEELELLQKNLIYSDACGVGEAFDTEIVRAMMILRANAISKGFSGVM
HUTH_CALS4       TTGFGKFSDVVISKEDTEALQKNLIMSHSCAVGDPLPEEVVRAIMLLRANALAKGFSGVR
HUTH_STRP1       TTGFGSLCNVSISPEDTVQLQENLIRTHASGFGDPLPEDAVRAIMLIRINSLVKGYSGIR
HUTH_STRP8       TTGFGSLCNVSISPEDTVQLQENLIRTHASGFGDPLPEDAVRAIMLIRINSLVKGYSGIR
HUTH1_FUSNN      TTGFGKFAEVSISKEQTGQLQKNIVMSHSCNVGNPLPIDIAKGIVLLRAVNLAKGYSGAR
HUTH_BACHD       TTGFGKFSDIFIDPDDVENLQHNLIYSHACGVGSPFPETVSRTMLVLRANALLKGFSGVR
HUTH_BACSU       NTGFGKFSDVLIQKEDSAALQLNLILSHACGVGDPFPECVSRAMLLLRANALLKGFSGVR
HUTH_STAAM       TTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGAT
HUTH_STAAW       TTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGAT
HUTH_THEAC       NTGFGSLLNVHIERDQEIELQKNLIRSHSSGVGDYLENRYVRAIMAVRLNSLAAGYSAVS
HUTH_THEVO       NTGFGGLLNIKISREEEIELQRNLIRSHSAGVGKYLPTDVVRSIMVIRANTLAKGYSAVS
HUTH_STRCO       STGFGALATRHISPELRGRLQRNIVRSHAAGMGPRVEREVVRALMFLRLKTVCSGRTGVR
HUTH_STRGR       STGFGALASRHIGTELRAQLQRNIVRSHAAGMGPRVEREVVRALMFLRLKTVASGHTGVR
HUTH_HALSA       NTGFGSMSDTRIDAADREALQANLVRSHAAGAGSELDTAAVRALLVTRLNALAKGYSGIR
                 .**** :    *       ** .:: :..   *          ::  :   :  * :.  

HUTH_AGRRH       IELIRLIEGMLEKGVIPVIPEKGSVGASGDLAPLAHMSATMMGEGEAF-YQGVQMPSKDA
HUTH_AGRFC       LELVRLIEAMLEKGVIPVIPEKGSVGASGDLAPLAHMAAVMMGEGEAF-YEGAPLPAGEA
HUTH_RHIME       LELVRLIEAMLDKGVIPLIPEKGSVGASGDLAPLAHMAAVMMGHGEAF-FAGERMKGDAA
HUTH_CAUVC       VETVRMLEEMLVEGLTPVVPCQGSVGASGDLAPLSHMAATMIGVGEIF-VGGQRLPAAQA
HUTH_RHILO       PETIDLLQAMLANDVIPVVPAQGSVGASGDLAPLSHMTAVMIGVGECF-TPHGRFPAKVA
HUTH_XANAC       PDTLALLDAMLRAGITPVVPCQGSVGASGDLAPLSHLAAAMIGVGEAF-VGAQRLPAADA
HUTH_XANCP       PDTLALLEAMLRQGITPVVPCQGSVGASGDLAPLSHLAAVMIGVGEAF-VGDQRLPAADA
HUTH_PSEAE       RKVIDALIALINAEVYPHIPLKGSVGASGDLAPLAHMSLVLIGESRAR-HRGEWLPAAEA
HUTH_PSEPU       RKVIDALIALVNAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGEGKAR-YKGQWLSATEA
HUTH_YERPE       LEVIQALITLVNAGVYPHIPLKGSVGASGDLAPLAHMSLLLLGEGKAR-YQGEWLPAHTA
HUTH_SALTI       LSVIEALIALVNAGVYPLIPAKGSVGASGDLAPLAHLSLTLLGEGKAR-WQGEWLPAQAA
HUTH_SALTY       LSVIEALIALVNAGVYPLIPAKGSVGASGDLAPLAHLSLTLLGEGKAR-WQGEWLPAQTA
HUTH_VIBCH       LEVIQALIELVNNQIYPCVPKKGSVGASGDLAPLAHMSTVLLGEGQAR-YNGKIISGLEA
HUTH_RALSO       RVVIDTLLAMLNAGIVPCIPSKGSVGASGDLAPLAHMTLAMLGEGDAR-VNGVRKPAREA
HUTH_DEIRA       VEVVELLLALLNADALPVVPSQGSVGASGDLAPLAHLALGLIGLGDIE-YQGQVRPAADV
HUTH2_FUSNN      IETVECLLNMLNAGVHPIVRSKGSVGSSGDLCPLAHMVLPMIGEGEAE-YKGEILSGKEA
HUTH_CALS4       LETVETLIEMINKNVVPVIPEKGSLGASGDLAPLAHMVLVMIGRGEAF-YAGERVSGEEA
HUTH_STRP1       LSTIEKLLELLNKGVHPYIPEKGSLGASGDLAPLAHMVLPMLGLGKAY-YKGELLSGQEA
HUTH_STRP8       LSTIEKLLELLNKGVHPYIPEKGSLGASGDLAPLAHMVLPMLGLGKAY-YKGELLSGQEA
HUTH1_FUSNN      RIVIEKLVELLNKDVTPWIPEKGSVGSSGDLSPLAHMSLVLIGLGKAY-YKGELLEAKDA
HUTH_BACHD       PLVIERLLALVNANIHPVIPQQGSLGASGDLAPLSHLALVLLGEGEVF-YKGTKTKASFA
HUTH_BACSU       AELIEQLLAFLNKRVHPVIPQQGSLGASGDLAPLSHLALALIGQGEVF-FEGERMPAMTG
HUTH_STAAM       LELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVL-YRGEEKDSDDV
HUTH_STAAW       LELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVL-YRGEEKDSDDV
HUTH_THEAC       ADLLNMMVEMLNRDVIPAVPKYGSVGASGDLAPLAHIGLAMMGEGKAF-FEGRLMDSARA
HUTH_THEVO       TELIDALLAMINKDVVPAVPEFGSVGASGDLAPLAHIGLAMMGEGQAF-LNGELMRSDIA
HUTH_STRCO       PEVAQTMADVLNAGITPVVHEYGSLGCSGDLAPLSHCALTLMGEGDAEGPDGTVRPAGEL
HUTH_STRGR       PEVAQTMADVLNAGITPVVHEYGSLGCSGDLAPLSHCALTLMGEGEAEGPDGTVRPAGEL
HUTH_HALSA       ERVLDVLVGLLNEGVHPVVPSRGSLGASGDLAPLAHMSRVLIGEGQAD-VAGERMPAAEA
                       :  .:     * :   **:*.****.**:*    ::* .           .   

HUTH_AGRRH       LAKAGLSPV-VLAAKEGLALINGTQTSTALALAGLFRAHRAAQSALVTGALSTDAAMGSS
HUTH_AGRFC       LAKAGLTPV-VLAAKEGLALINGTQTSTALALAGLFRAHRAAQAALITGALSTDAAMGSS
HUTH_RHIME       LKAAGLSPV-TLAAKEGLALINGTQVSTALALAGLFRAHRAGQAALITGALSTDAAMGSS
HUTH_CAUVC       LAQAGLEPL-TLGPKEGLALLNGTQFSTANALAGLFEAERLFQSALVTGALSTEAAKGSD
HUTH_RHILO       FVSHGLEPV-TLGAKEGLALLNGTQFSTAYALAALFEAEVLYQSALVAGALSTDAAKGSD
HUTH_XANAC       LAHAQLQPR-VLGAKEGLALLNGTQFSTACALAGLFEIETVLQAALVTGALSVEAAKGSD
HUTH_XANCP       LARAQLQPR-VLGAKEGLALLNGTQFSTACALAGLFEIETVLQAALVTGALSVEAAKGSD
HUTH_PSEAE       LAVAGLEPL-TLAAKEGLALLNGTQVSTAYALRGLFEAEDLFAAATVCGGLSVEAMLGSR
HUTH_PSEPU       LAVAGLEPL-TLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSR
HUTH_YERPE       LAQAGLQPL-TLAAKEGLALLNGTQVSAAYALRGLFEAEDLYAAASVFGCLTVDAALGSR
HUTH_SALTI       LKKAGLEPV-ALAAKEGLALLNGTQASTAFALRGLFEAQELFASAVVCGALTTEAVLGSC
HUTH_SALTY       LKKAGLEPV-ALAAKEGLALLNGTQASTAFALRGLFEAQELFASAVVCGALTTEAVLGSR
HUTH_VIBCH       MKIAGLEPI-TLAPKEGLALLNGTQASTAFALEGLFVAEDLFASATVCGAMSVEAALGSR
HUTH_RALSO       LAAAGIAPI-ALAAKEGLALINGTQVSTALALNGLFLAERLLQAATVAGALSVDAAKGSD
HUTH_DEIRA       LAELGLSPV-QLQAKEGLALINGTQLMGSLLALALHDAQVLLGTANLAAAMTVEARYGSH
HUTH2_FUSNN      MKKAGVSTI-TLKAKEGLALINGTQAMMGNAVLAVYDAEKLLKQADIVASLSIDALGGII
HUTH_CALS4       MRRAGIPTI-TLSSKEGLALINGTQVMSALGCLNVYDAKRIIAVADAVASITLEALRGII
HUTH_STRP1       LDKAGIDKI-SLAAKEGLALINGTTVLTAVGALATYDAIQLLKLSDLAGALSLEVHNGIT
HUTH_STRP8       LDKAGIDKI-SLAAKEGLALINGTTVLTAIGALATYDAIQLLKLSDLAGALSLEVHNGIT
HUTH1_FUSNN      LAKADIEPIPALSSKEGLALTNGTQALTSTGAHVLYDAINLSKHLDIAASLTMEGLHGII
HUTH_BACHD       LKEEEIEPI-TLTAKEGLALINGTQAMTAMGVIAYLEAEKLAFQSEIIASLTMEGLRGII
HUTH_BACSU       LKKAGIQPV-TLTSKEGLALINGTQAMTAMGVVAYIEAEKLAYQTERIASLTIEGLQGII
HUTH_STAAM       LRELNRQPL-NLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGII
HUTH_STAAW       LRELNRQPL-NLQAKEGLALINGTQAMTAQGVISYIESEDLGYQSEWIAALTHQSLNGII
HUTH_THEAC       LEKAGLKPY-QFKEKEGVALINGTSFMSGILSIAVMDAHDILENAIRSALLSFEALGGTS
HUTH_THEVO       LSKVGLKPY-EFKEKEGVALINGTSMMAGIMALVTSRAYRTIENAVRSSLLSFEALRGTS
HUTH_STRCO       LAAHGIAPV-ELREKEGLALLNGTDGMLGMLVMALADLDTLYKSADITAALTMEALLGTD
HUTH_STRGR       LAAHGIAPV-ELREKEGLALLNGTDGMLGMLVMALADLRNLYTSADITAALSLEALLGTD
HUTH_HALSA       LAAADLEPV-TLQAKEGLALINGTQLTTGVAALALVDAERVLRSADTAGALTTEVTMSTT
                 :          :  ***:** ***    .                   . :: :   .  

HUTH_AGRRH       APFHPDIHTLRGHKGQIDAGSALRNLLQGSEIRESHIEGDERVQDPYCIRCQPQVDGACL
HUTH_AGRFC       APFHPDIHSLRGHKGQIDAGAALRNLLEGSEIRVSHIEGDERVQDPYCIRCQPQVDGACL
HUTH_RHIME       APFHPDIHTLRGHKGQIDTAAALRQLLTGSPIRQSHIEGDERVQDPYCIRCQPQVDGACL
HUTH_CAUVC       TPFDPRIHTLRRHVGQIETAAALRALMSASEIRASHLKEDERVQDPYCLRCQPQVMGAAL
HUTH_RHILO       APFDPRIHLLRKHRGQIETAEALRNLMAGSAIRESHRVGDERVQDPYCLRCQPQVMGAAL
HUTH_XANAC       TPFDARIHALRGQPGQIATAAALRALMADSAIRESHRLGDVRVQDPYCLRCQPQVMGAAL
HUTH_XANCP       TPFDARIHALRGQPGQIATAAALRALMAESAIRESHRLGDVRVQDPYCLRCQPQVMGAAL
HUTH_PSEAE       APFDARIHAARGQRGQIDVAAAYRDLLTASSEVARSHEKCDKVQDPYSLRCQPQVMGACL
HUTH_PSEPU       SPFDARIHEARGQRGQIDTAACFRDLLGDSSEVSLSHKNCDKVQDPYSLRCQPQVMGACL
HUTH_YERPE       SPFDARIHAVRGQRGQIDAASTYRHLLGERSEISESHKNCDKVQDPYSLRCQPQVMGACL
HUTH_SALTI       RPFDARIHAARGQQGQIDVARLFRHLLTDTSAIAESHHHCHKVQDPYSLRCQPQVMGACL
HUTH_SALTY       RPFDARIHAARGQQGQIDVARLFRHLLTDTSAIAESHHHCHKVQDPYSLRCQPQVMGACL
HUTH_VIBCH       RPFDPRIHRVRGHRTQMDAATAYRHLLDVSSEIGQSHSNCEKVQDPYSLRCQPQVMGACL
HUTH_RALSO       APFDPRVHTVRGQAGQIATAAVYRGLLAGSAIRRSHLVGDTRVQDPYSLRCQPQVMGACL
HUTH_DEIRA       RPFQPDVVGLRPHPGALAVAAELREFLAGSEIAPSHLTGDGKVQDAYSLRAVPQVHGATW
HUTH2_FUSNN      DAFDERIHLIRPHKGQIYSAENLRKLLKGSK--RTTRQGEKRMQDAYSLRCTPQVHGASR
HUTH_CALS4       DAFDDRVQMVRPHKGQIVSAKNVRKMVEGSE--LITRQGEIRVQDAYTLRCIPQVHGAVR
HUTH_STRP1       SPFEENLHTIRPQSGQLATARNIRNLLEGSQ--NTTVATQSRVQDPYTLRCMPQIHGASK
HUTH_STRP8       SPFEENLHTIRPQSGQLATARNIRNLLEGSQ--NTTVATQSRVQDPYTLRCMPQIHGASK
HUTH1_FUSNN      DAYDPRIGEVRGHLGQINTAKNMRNILAGSK--NVTKQGVERVQDSYVLRCIPQIHGASK
HUTH_BACHD       DAFDEQIHFARGYVEQVDVARRMESYLQDSQ--LTTRQGELRVQDAYSLRCIPQVHGATW
HUTH_BACSU       DAFDEDIHLARGYQEQIDVAERIRFYLSDSG--LTTSQGELRVQDAYSLRCIPQVHGATW
HUTH_STAAM       DAYRHDVHSVRNFQEQINVAARMRDWLEGST--LTTRQAEIRVQDAYTLRCIPQIHGASF
HUTH_STAAW       DAYRHDVHAVRNFQEQINVAARMRDWLEGST--LTTRQAEIRVQDAYTLRCIPQIHGASF
HUTH_THEAC       KAFTPWILGARPHLGQVAIGNRFREYLTGSD--IVKRADSVKVQDAYTLRCIPQVYGSVA
HUTH_THEVO       KAFSDWIVSARPHLGQIAIAEKMRKYLAGSK--NVEKSDKEKVQDAYTLRCIPQVYGAVL
HUTH_STRCO       RVLAPELHAIRPHPGQAASAANMAAVLKGSGLTGHHQDDAPRVQDAYSVRCAPQVAGAGR
HUTH_STRGR       KVLAPELHAIRPHPGQGVSADNMSRVLAGSGLTGHHQDDAPRVQDAYSVRCAPQVNGAGR
HUTH_HALSA       ASCAPAIHEVRPHDGQAVSARHIRNLTAGSEVLDHHRD-CDRVQDAYSIRCLPQVHGAVR
                       :   *        .                     ::**.* :*. **: *:  

HUTH_AGRRH       DLLASVARTLEIEANAVTDNPLVLSD--NS----------VVSGGNFHAEPVAFAADQTA
HUTH_AGRFC       DLLRQVARTLEIEANAVTDNPLVLSD--NS----------VVSGGNFHAEPVAFAADQTA
HUTH_RHIME       DLLRSVAATLTIEANAVTDNPLVLSD--NS----------VVSGGNFHAEPVAFAADQIA
HUTH_CAUVC       DILRQAATTLATEANCVSDNPLIFPEA-DE----------ALSGGNFHAEPVAFAADMIA
HUTH_RHILO       DVLRKAADTLGTEANGVTDNPLIFAED-DT----------ALSGGNFHAEPVAFAADMIA
HUTH_XANAC       DVMRQAARTLEIEANGVSDNPLVFSDT-GE----------ALSGGNFHAEPVAFAADMLA
HUTH_XANCP       DVMRQAARTLEIEANGVSDNPLVFSDT-GE----------ALSGGNFHAEPVAFAADMLA
HUTH_PSEAE       TQMRQAAEVLEIEANAVSDNPLVFAAE-GD----------VISGGNFHAEPVAMAADNLA
HUTH_PSEPU       TQLRQAAEVLGIEANAVSDNPLVFAAE-GD----------VISGGNFHAEPVAMAADNLA
HUTH_YERPE       GQIRQAAEVLAIESNAVSDNPLVFAEQ-GD----------VLSGGNFHAEPVAMAADNLA
HUTH_SALTI       TQLRQTKEVLLAEANAVSDNPLVFAEA-GE----------VISGGNFHAEPVAMAADNLA
HUTH_SALTY       TQLRQTKEVLLAEANAVSDNPLVFADA-GE----------VISGGNFHAEPVAMAADNLA
HUTH_VIBCH       QQIRSAAEVLEVEANSVSDNPLVFAED-GD----------IISGGNFHAEPVAMAADNLA
HUTH_RALSO       DLIRQAGATLLTEANAVTDNPLVYADA-GE----------VISGGNFHAEPVAFAADMLA
HUTH_DEIRA       DALAQAERVLAVEFASVTDNPLIFPET-GE----------VVSGGNFHGQPLAVTIDALK
HUTH2_FUSNN      LAFDYVKQTVETEINSVTDNPLIFPGENGA----------CISGGNFHGQPIAIAMDTLG
HUTH_CALS4       DAISYIERVLGVEINSATDNPLIFP-DDGE----------VISGGNFHGEPVALAMDFLS
HUTH_STRP1       DSIAYVKSKVDIEINSVTDNPIICK-D-GH----------VISGGNFHGEPMAQPFDFLG
HUTH_STRP8       DSIAYVKSKVDIEINSVTDNPIICK-D-GH----------VISGGNFHGEPMAQSFDFLG
HUTH1_FUSNN      DTLEYVKQKVELELNAVTDNPIIFV-DTDE----------VISGGNFHGQPMALPFDFLG
HUTH_BACHD       QTLRYVKEKLEIEMNAATDNPLIFD-NGQK----------VISGGNFHGQQIALAMDFLG
HUTH_BACSU       QTLGYVKEKLEIEMNAATDNPLIFN-DGDK----------VISGGNFHGQPIAFAMDFLK
HUTH_STAAM       QVFNYVKQQLEFEMNAANDNPLIFE-EANET--------FVISGGNFHGQPIAFALDHLK
HUTH_STAAW       QVFNYVKQQLEFEMNAANDNPLIFE-EANET--------FVISGGNFHGQPIAFALDHLK
HUTH_THEAC       DVIDYVENVLSVEINSATDNPLFNG---EE----------VVSGGNFHGEPVALAADFLA
HUTH_THEVO       DTLEYVSSVLVTEINSATDNPLFNG---KE----------VVSGGNFHGEPIALAADFLS
HUTH_STRCO       DTMAHAGLVAERELAAAVDNPVVLPDGRVE------------SNGNFHGAPVAYVLDFLA
HUTH_STRGR       DTLDHAALVAGRELASSVDNPVVLPDGRVE------------SNGNFHGAPVAYVLDFLA
HUTH_HALSA       DALDHLRAAVATELNSATDNPLVFAGDRVGPRASGTDRAAVVSGGNFHGEVLALRLGYAA
                   :         *     ***:.                   *.****.  :*   .   

HUTH_AGRRH       LAVCEIGAIAQRRIALLVD-PALSYGLPAFLSKKPGLNSGLMIAEVTSAALMSENKQMSH
HUTH_AGRFC       LAICEIGAIAQRRVALLVD-PALSYGLPAFLSKKPGLNSGLMIAEVTSAALMSENKQMAH
HUTH_RHIME       LAVCEIGAISQRRIALLVD-PALSYGLPAFLAKKPGLNSGLMIAEVTSAALMSENKQLSH
HUTH_CAUVC       LAVCEIGSIAERRIAMLVD-PALS-GLPAFLTPKPGLNSGFMIPQVTAAALVSENKQRAY
HUTH_RHILO       LAVCEIGSLSERRIAMLVD-PALS-GMPAFLTPKPGLNSGFMIPQVTAAALVSENKQKAY
HUTH_XANAC       MAVCEIGSISERRTAMLVD-PALS-GLPAFLTPRPGLNSGFMIPQVTAAALVSENKQRAY
HUTH_XANCP       LAVCEIGSISERRTAMLVD-PALS-GLPAFLTPRPGLNSGFMIPQVTAAALVSENKQCAY
HUTH_PSEAE       LALAEIGSLSERRISLMMD-MHMS-QLPPFLVANGGVNSGFMIAQVTAAALASDNKALAH
HUTH_PSEPU       LAIAEIGSLSERRISLMMD-KHMS-QLPPFLVENGGVNSGFMIAQVTAAALASENKALSH
HUTH_YERPE       LALAEVGSLSECRISLMMD-KHMS-QLPPFLVENGGVNSGFMIAQVTAAALTSENKGLAF
HUTH_SALTI       LAIAEIGALSERRITLMMD-KHMS-QLPPFLVKNGGVNSGFMIAQVTAAALASENKALAH
HUTH_SALTY       LAIAEIGALSERRIALMMD-KHMS-QLPPFLVKNGGVNSGFMIAQVTAAALASENKALAH
HUTH_VIBCH       LAIAEIGSLSERRMALLID-SALS-KLPPFLVDNGGVNSGFMIAQVTAAALASENKTLAH
HUTH_RALSO       LAIAEIGALSERRIALLID-STLS-GLPPFLVEQPGLNSGFMIAHVTAAALASENKSLAH
HUTH_DEIRA       VAVAELGSISERRTEQLLN-PALS-GLPAFLTPNGGLNSGFMIAQYTSAALVSENKVLSH
HUTH2_FUSNN      ILMSEIANISERRIEKLVN-PALSHGLPAFLVKNGGINDGFMIPQYVAAALVSENKVLAH
HUTH_CALS4       IALSEIANISERRIERLVN-YQLND-LPPFLTEKGGLNSGMMIAQYTAASLVSENKVLSH
HUTH_STRP1       IAISEIGNVSERRVERLVN-SQLSK-LPSFLVKYPGLNSGFMITQYACASLASENKVLAH
HUTH_STRP8       IAISEIGNVSERRVERLVN-SQLSK-LPSFLVKYPGLNSGFMITQYACASLASENKVLAH
HUTH1_FUSNN      IALSEMANVSERRIEKMVN-PAINNGLPAFLVEKGGLNSGFMIVQYSAASLVSENKVLAH
HUTH_BACHD       IAMAELANISERRIERLVN-PQLN-DLPPFLSAAPGVQSGVMILQYCAASLVSENKTLAH
HUTH_BACSU       IAISELANIAERRIERLVN-PQLN-DLPPFLSPHPGLQSGAMIMQYAAASLVSENKTLAH
HUTH_STAAM       LGVSELANVSERRLERLVN-PQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAH
HUTH_STAAW       LGVSELANVSERRLERLVN-PQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAH
HUTH_THEAC       IALTDLGNMVERRIARLVD-TNLS-GLPPFLTPDSGLNSGYMIPQYTAAALCNRNKVLAY
HUTH_THEVO       IALTDMGNMIERRIARLVD-TNLS-GLPPFLVKNSGLNSGYMIPQYTAAALCNRNKVLSY
HUTH_STRCO       VAVADLGSIAERRTDRLLD-KNRSHGLPPFLADDAGVDSGLMIAQYTQAALVGELKRLAV
HUTH_STRGR       IVAADLGSICERRTDRLLD-KNRSHGLPPFLADDAGVDSGLMIAQYTQAALVSEMKRLAV
HUTH_HALSA       SALAELAAISERRTDRLLNPETQEPHLEPFLAPDSGLHSGLMIPQYTAASLVNDLRSLGQ
                     ::. : : *   :::    .  : .**    *:..* ** .   *:* .  :  . 

HUTH_AGRRH       PASVDSTPTSANQEDHVSMACHGARRLLAMTDNLFGILGIEALAAVQGVELRG-P-LKTS
HUTH_AGRFC       PASVDSTPTSANQEDHVSMACHGARRLLPMTDNLFAILGIEALSAVQGVELRG-P-LKTS
HUTH_RHIME       PASVDSTPTSANQEDHVSMACHGARRLLQMTENLFSIIGIEALAAVQGIEFRA-P-LTTS
HUTH_CAUVC       PASVDSIPTSANQEDHVSMAAHGARRLLAMVENADAVLGIELLAAAQGCDFHA-P-LRSS
HUTH_RHILO       PASVDSIPTSANQEDHVSMAAHGARRLIGMVENATAVIGIELLAAAQGCDFHQ-P-LASS
HUTH_XANAC       PASVDSIPTSANQEDHVSMAAHGARRLLAMAENAAHVIGIELLAAVQGCDFHA-P-LRSS
HUTH_XANCP       PASVDSIPTSANQEDHVSMAAHGARRLLAMADNAAHVIGIELLAAVQGCDFHA-P-LRSS
HUTH_PSEAE       PASVDSLPTSANQEDHVSMAPNAGKRLWAMAENVRGILAVEWLGACQGLDFRE-G-LKSS
HUTH_PSEPU       PHSVDSLPTSANQEDHVSMAPAAGKRLWEMAENTRGVLAIEWLGACQGLDLRK-G-LKTS
HUTH_YERPE       PASVDSIPTSANQEDHVSMAPRAGKRLWEMAENVRNILAIEWLAACQGLDLRK-G-LRTS
HUTH_SALTI       PHSVDSLPTSANQEDHVSMAPAAGRRLWEMAANTRGVIAVEWLAACQGIDLRE-G-LTSS
HUTH_SALTY       PHSVDSLPTSANQEDHVSMAPAAGRRLWEMAANTRGIIAVEWLAACQGIDLRE-G-LTSS
HUTH_VIBCH       PASVDSLPTSANQEDHVSMATFAARRLRDMGENTRGILAVEYLAAAQGLDFRA-P-LKSS
HUTH_RALSO       PASVDSLPTSANQEDHVSMATFAGRRLAEMAGNTATIVGIEALAAAQGIDFHR-P-LATS
HUTH_DEIRA       PASVDSIPTSANQEDHVSMGAHAARQLRQIVANVQTVLSIELLCAAQGLDFQQ---LRAG
HUTH2_FUSNN      PASVDSIPTSANQEDHVSMGTIGARKARTIVDHAQHVVSIELLCAAQAADFWD-S-KNLG
HUTH_CALS4       PASVDSIPSSANQEDHVSMGTIAARKAREVLKNVTTVLAIELLTASQALEFRK-G-FKRG
HUTH_STRP1       PASVDSIPSCENQEDFVSMGTTAARKAFEILKNSRRIVATEIMAACQALDLKP-ENHELG
HUTH_STRP8       PASVDSIPSCENQEDFVSMGTTAARKAFEILKNSRRIVATEIMAACQALDLKP-ENHELG
HUTH1_FUSNN      PASVDSIPTSANQEDHVSMGSVAAKKSKDIFENVRKVIGMELITACQAIDLKE-AKDKLS
HUTH_BACHD       PASVDSIPSSANQEDHVSMGTIGSRHAYQIIQNVRNVLAIELICAMQAVDIRG-R-EKMA
HUTH_BACSU       PASVDSIPSSANQEDHVSMGTIAARHAYQVIANTRRVIAIEAICALQAVEYRG-I-EHAA
HUTH_STAAM       PASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKG-V-EGLS
HUTH_STAAW       PASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKG-V-EGLS
HUTH_THEAC       PSSADTIPTSANQEDHVSMGATGSLKLLEIIDNVRYIIAIEYLLGSQALEFTD-K--GMS
HUTH_THEVO       PSSADSIPTSANQEDHVSMGSTSTLKLLEIEENLEYIVAIEFLLGAQALEFSQ-D--PIS
HUTH_STRCO       PASADSIPSSAMQEDHVSMGWSAARKLRTAVDNLARVIAVELYAATRAIQLR--EGLTPA
HUTH_STRGR       PASADSIPSSAMQEDHVSMGWSAARKLRTAVDNLARIVAVELYAATRAIELRAAEGLTPA
HUTH_HALSA       P-TLDNASVSGAQEDHVSMSAGAAYNFREAVEKAATVVGVELLCGAQGREFLD-PDLALG
                 * : *. . .  ***.***.  .  .      :   ::. *   . :. :         .

HUTH_AGRRH       PELEKAAAVLRSAVPVLED-DR--YMATDLKAAIEVVASGALVSAISSGILPVLEA----
HUTH_AGRFC       PELQKVIAVLRVVVPSLEE-DR--YMAPDLKAAAELIASGALVSTISGGILPKLEA----
HUTH_RHIME       PELQKAAAAVRGVSSSIEE-DR--YMADDLKAAGDLVASGRLAAAVSAGILPKLEN----
HUTH_CAUVC       AALEAVRALTRSKVPHLSD-DR--HFHPDMEAANTLVRSGAVIAAVGA--LPGVTA----
HUTH_RHILO       DALEAVRKLVRAEVPHLDN-DR--HFHPDMEKAIAMVRSGATVRAAGAVALPSIAGAA--
HUTH_XANAC       TALEAARALLRAQVPTLQD-DR--YFHPDMLAASALVRSGALAQTVAIP-LPGVEQDV--
HUTH_XANCP       AALEAARALLRAQVPTLQD-DR--YFHPDMLAASALVRSGALATAVGIV-LPGVELSA--
HUTH_PSEAE       PKLEQARRLLRDKVPYYQE-DR--FFAPDIEAASQLLASGCLNALLPARLLPSL------
HUTH_PSEPU       AKLEKARQALRSEVAHYDR-DR--FFAPDIEKAVELLAKGSLTGLLPAGVLPSL------
HUTH_YERPE       AILEPARQLLRQHVTYYDK-DR--FFAPDIEVASQLIAQRHMNELMPAKLLPSL------
HUTH_SALTI       PLLEQARQTLRERVAHYTQ-DR--FFAPDIECATTLLAQGALQRLVPDFM----------
HUTH_SALTY       PLLEQARQTLREQVAHYTQ-DR--FFAPDIECATALLAQGALQRLVPDFM----------
HUTH_VIBCH       PRIEEARQILREKVPFYDK-DR--YFAPDIEKANALLQLAVHNRLMPDQLLPSQH-----
HUTH_RALSO       DALARAHTCIRSRVAYYGE-DR--LFAPDIEAARRLVLDGDLGDSCRAHLADLALA----
HUTH_DEIRA       RGVQAAYEYVRTFVPTLTE-DR--YFRPDLLRLRGELVSGELLRVAQAADTQAPAPAKLP
HUTH2_FUSNN      VGTKEAYRTLREKVDFMEN-DV--IFYPLMDKSFEIIKSAILLANVEKIIG-LLK-----
HUTH_CALS4       KGTDRIYRLVREKVNPLVE-DR--ELYIDINACFDIIRSGRIEEVLKEEGI-MLE-----
HUTH_STRP1       KGTKVAYDLFRKEVNFIEH-DKHIEIYDELNKASAVIEDPSFLEAVEQAVELSIQF----
HUTH_STRP8       KGTKVAYDLFRKEVNFIEH-DKHIEIYDELNKASAVIEDPSFLEAVEQAVELSIQF----
HUTH1_FUSNN      PATKVAYDEVRKIISYVSE-DR--PMYIDIHAAEDLIKTNKIVENVEKAIG-KLEF----
HUTH_BACHD       SFTKKILEKGREHVPYIDQ-DR--MFAKDIERAAKWLKDGSWDFTKMREKERTNHY----
HUTH_BACSU       SYTKQLFQEMRKVVPSIQQ-DR--VFSYDIERLTDWLKKESLIPDHQNKELRGMNI----
HUTH_STAAM       PKTRRKYEEFRSIVPSITH-DR--QFHKDIEAVAQYLKQSIYQTTACH------------
HUTH_STAAW       PKTRRKYEEFRSIVPSITH-DR--QFHKDIEAVAQYLKQSIYQTTACH------------
HUTH_THEAC       PSTRKIYEKIREKVEKLDH-DR--PPSFDIETIRKMMDKKEFISALP-------------
HUTH_THEVO       PVTKAIYTKIREYVKPLDK-DR--PSYLDIEKIREIMNKNELINAA--------------
HUTH_STRCO       PASQAVVEAVRAAGVEGPGPDR--HLAPDLAAADAFVRAGHLV-AAAESVTGPLR-----
HUTH_STRGR       PASEAVVAALRAAGAEGPGPDR--FLAPDLAAADTFVREGRLV-AAVEPVTGPLA-----
HUTH_HALSA       AGTAAAYDLVREVSEPVAG-DR--ALADDMAAVGDLVRAGLVEDAVARALDAPLA-----
                           *         *        :      :                       

HUTH_AGRRH       -------------
HUTH_AGRFC       -------------
HUTH_RHIME       -------------
HUTH_CAUVC       -------------
HUTH_RHILO       -------------
HUTH_XANAC       -------------
HUTH_XANCP       -------------
HUTH_PSEAE       -------------
HUTH_PSEPU       -------------
HUTH_YERPE       -------------
HUTH_SALTI       -------------
HUTH_SALTY       -------------
HUTH_VIBCH       -------------
HUTH_RALSO       -------------
HUTH_DEIRA       DSGDEDRDTTSRH
HUTH2_FUSNN      -------------
HUTH_CALS4       -------------
HUTH_STRP1       -------------
HUTH_STRP8       -------------
HUTH1_FUSNN      -------------
HUTH_BACHD       -------------
HUTH_BACSU       -------------
HUTH_STAAM       -------------
HUTH_STAAW       -------------
HUTH_THEAC       -------------
HUTH_THEVO       -------------
HUTH_STRCO       -------------
HUTH_STRGR       -------------
HUTH_HALSA       -------------