CLUSTAL format seed alignment for MF_00230

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COBU_SINSX      -MSASGLPFDDFRELLRNLPGPDAAALVAARERDAQLTKPPGALGRLEEIAFWLAAWTG-
COBT_RHIME      -MSASGLPFDDFRELLRNLPGPDTAALVAARERDGQLTKPPGALGRLEEIAFWLAAWTG-
COBT_AGRFC      -MSMSGLPFDDFRALLRELPGPDTHALVAAKERNAQLTKPAGSLGRLEEIAMWLAAWSG-
COBT_BRUME      -MSASGLPFDDFRELIRNLPGPDLGAERAVREREVTLTKPAGSLGRLEEIVAWLATWTGK
COBT_BRUSU      -MSASGLPFDDFRELIRNLPGPDLGAERAVREREVTLTKPAGSLGRLEEIVAWLATWTGK
COBT_METC4      MGEIGGNALDGIHARVRTAPLADQAAIAAVRQRDRLLTKPPGSLGRLEAIVEWLAAWQGK
COBT_RHILO      ---MPFKSLDELRAACLDLPAGSDTAAKAVASRQDTLTKPQGSLGRLETIAAWLARWQGR
COBT_RHOCB      --MLQLNSFAEISTLADRLPVADEAARAAALARQNSLTKPVGSLGRLEELALHWAAWRAT
COBT_PSEPK      ---------MTQAWWRDACQPLDNAAMDQARARQQQLTKPAGSLGQLEALAIQLAGLQGL
COBT_PSESM      ---------MSNSWWLKPAQAIDVPMREAALARQQQLTKPAGSLAQLERLAVQLSGLQGR
COBT_PSEAE      ---------MSLQWWRDTCREADPQMRRRAAERQDRLTKPRGSLGRLEQVAIDLAALQGR
COBT_XANAC      ---------MRSDWIFGACAVPDARMRSAALARQEQLTKPPGALGRLEHLAVQLAAWQRT
COBT_XANCP      ---------MSIEWIQGACAVPDARVQAASLARQEQLTKPPGALGRLEQLAVQFAAWQRN
COBT_BRADU      ---------MLPEWVYHKCPEISAVHRDAAIVRQAQLTKPTGALGRLEQLAIELAGLQAT
COBT_VIBPA      ---------------------MDCSFSADIQTRIDNKTKPLGALGVLEKVALQLALIQSQ
COBT_VIBVU      --------------------MLEQQFAAEIQHIIDNKTKPLGALGQLEQVALQLALIQSQ
COBT_VIBCH      --------------------MLDRSFSAEIQQRIDQKTKPLGALGQLERVAHHLALIQSQ
COBT_SHEON      ---------MSQSSLSFQIEPVSKAQDQVIQQKIDLKTKPPGALGMLESLALQIARIQGP
COBT_LEPIN      --------------------MNPDQLSTKLQNKIDLKTKPPGSLGMLESIALQIGLIQNT
COBT_RALSO      --------------MHTDISSFDPALAARLRAAVDSKTKPLGALGRLESLAVQIGLIQDT
COBT_BACHD      --------MQKVKEMIGSINELDTKAQQQMEQHLNTLTKPLGSLGLLESLAIKIAGITG-
COBT_CHLTE      -------MTDRFQQLLASIKPVDMNLTSTVKAHLDDLTKPQGSLGRLEEIVMKYCIATG-
COBT_CLOAB      ---------MNIENLIKGINGLDNKVMSKIQKRLDNLTKPLGSLGTLEDIVKQLGGITG-
COBT_CLOTE      ----MVIIMKLLEETLRRIKPADEEVIKKAWSRMDSLSKPIGSLGKLEEIAVQISGITG-
COBT_CLOPE      ----------MLNEVLKGIEGLDNDMIVKAKNRVDSLAKPLGSLGKLEDIAIRLSGITG-
COBT_FUSNN      -----MKDKNCLFDLINKIESIDNVSIKKAQTELDRKMKPKDSLGVLEDICKKTAGIYG-
COBT_ECOLI      --------MQILADLLNTIPAIDSTAMSRAQRHIDGLLKPVGSLGKLEVLAIQLAGMPGL
COBT_ECOL6      --------MQILADLLNTIPAINSAAMSRAQRHVDGLLKPVGSLGKLEALAIQLAGMPGL
COBT_ECO57      --------MQTLANLLNTIPAIDPAAMSRAQRHIDGLLKPVGSLGRLEALGVQLAGMPGL
COBT_SALTI      --------MQTLHALFRDIPAPDAEAMARAQQHIDGLLKPPGSLGRLETLAVQLAGMPGL
COBT_SALTY      --------MQTLHALLRDIPAPDAEAMARAQQHIDGLLKPPGSLGRLETLAVQLAGMPGL
COBT_COREF      --------MMVPAELFARVEFPDQQVLADAREYQNTLVKPAGSLSRLEDVGCFIAACQGQ
COBT_CORGL      ---------MVPAELFARVEFPDHKILAQTKDFHDSLTKPPGSLGKLEQIGCFISACQGQ
COBT_MYCLE      -------------MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQ
COBT_MYCTU      ------------MIGFAPVSTPDAAAEAAARARQDSLTKPRGALGSLEDLSVWVASCQQR
COBT_STRAW      ------MSSLNLDDFSDLIERPDGGVRRDAEARRERQIVPPGSLGRLDDLGEWLAAAQSA
COBT_STRCO      ------MSSLNLDDFTDLIERPDGGVRRDAEARRERQVVPPGSLGRLDDLGEWLSAAQSA
COBT_DEIRA      MAMDTGRDSSALTDLLGRLQPADAEAMARARERQAQLTKPAGALGDLEELSVRLAGVFGT
                                                       * .:*. *: :          

COBU_SINSX      KAPVV------NRPLVAIFAGNHGVTRQGVTPFPSSVTAQMVENFAA------GGAAINQ
COBT_RHIME      RPPAV------NRPLVAIFAGNHGVTRQGVTPFPASVTAQMVENFAA------GGAAINQ
COBT_AGRFC      RSPAV------TRPLVAIFAGNHGVTRHGVTPYPTSVTQQMVENFAA------GGAAINQ
COBT_BRUME      RTPQV------NRPLVAVFAGNHGVTAKNITPFPPSVTAQMVENFAA------GGAAINQ
COBT_BRUSU      RTPQV------NRPLVAVFAGNHGVTAKNITPFPPSVTAQMVENFAA------GGAAINQ
COBT_METC4      SPPVL------ESAAAVVFAGNHGVAKHGVSAYPAEVTAQMVANFEA------GGAAINQ
COBT_RHILO      DMPKL------DRVKVFVFAGNHGVTAQGVSAYPSEVTVQMVANFAG------GGAAINQ
COBT_RHOCB      ERPTI------TKAQALCFAGNHGVCAQGVNVFPQEVTHLMVKNFEM------GGAAINQ
COBT_PSEPK      ERPTL------DQVAITIFAGDHGVVEEGISAYPQAVTGQMLRNFVG------GGAAISV
COBT_PSESM      ERPAA------DKLWIAIFAGDHGVVAEGVSAYPQEVTGQMLHNFVN------GGAAISV
COBT_PSEAE      ERPSL------ERIWVTVFAGDHGVVAEGISAYPQAVTGEMLRNFVR------GGAAISV
COBT_XANAC      ERPGA------QRVWIAVYAADHGVAAEGVSAFPQAVTGEMVRNFAR------GGAAIAV
COBT_XANCP      EQPTV------QRIWIAVYAADHGVAAEGVSMFPQAVTGEMVRNFAR------GGAAIAV
COBT_BRADU      EQPRA------ARVPIIIFAGDHGIVAQGVSAYPQAVTIAMMANFAS------GGAAISV
COBT_VIBPA      DQAQAVEEIVIRKPTMLVFAGDHGVAKEGISIAPSEVTQQMVANFLA------GGAAINC
COBT_VIBVU      GKEQAATHIELKQPQMLLFAGDHGVADEGVSIAPSAVTQQMVLNFLA------GGAAINC
COBT_VIBCH      NQDQAVTQLAIHQPTVLVFAADHGIAAQGVSIAPSAVTEQMVQNFLA------GGAAINC
COBT_SHEON      QQ------LQIVKPTMLVFAGDHGIAAEGVSIAPSEVTHQMVQNFAE------GGAAINV
COBT_LEPIN      DS------PELKNPHILVFAGDHGLAESGVSAFPKEVTHQMVFNFLN------GGAAINA
COBT_RALSO      EA------PVLIRPAMVVFAADHGVAQAGVSAYPQAVTAQMVLNFIA------GGAAVNV
COBT_BACHD      HTQPE-----IDPATVIVMVADHGVAAEGVSAYPSEVTQQMVHNFIT------GGAAINV
COBT_CHLTE      TTKPS-----LSKKKVFCFAGDHGVAAEGVSAFPAEVTPQMVYNMLG------GGAAINV
COBT_CLOAB      EVYPS-----VKNKTVIIMCADNGIVEENVSSCPKSVTASVTRNFMK------GFTGINV
COBT_CLOTE      KVKNE-----INKKMTVIMCSDNGICEEGVSACPQELTALLAENYVK------EITGIGV
COBT_CLOPE      NMFNN-----IDKKCVIIMSSDNGVEEEGVASAPQCVTLLQTKNFIK------GTTGVAT
COBT_FUSNN      YPLKK-----LEKKCHIVVAADNGIIEEGVSSCPIEYTSIVSEAMLN------QIACIGI
COBT_ECOLI      NGIPH-----VGKKAVLVMCADHGVWEEGVAISPKEVTAIQAENMTR------GTTGVCV
COBT_ECOL6      NGIPH-----VGKKAVLVMCADHGVWEEGVAISPKEVTAIQAENMTR------GTTGVCV
COBT_ECO57      NGIPH-----VGKKAVLVMCADHGVWEEGVAISPKEVTAIQAENMTR------GTTGVCV
COBT_SALTI      NGTPQ-----VGEKAVLVMCADHGVWDEGVAVSPKIVTAIQAANMTQ------GTTGVCV
COBT_SALTY      NGTPQ-----VGEKAVLVMCADHGVWDEGVAVSPKIVTAIQAANMTR------GTTGVCV
COBT_COREF      VPPRRLD-----RPRIVVFAGDHGVAARGVSAYPASVSLQMAQSMLD------GGAAINV
COBT_CORGL      IPPRPLN-----NSKIVVFAGDHGVATKGVSAYPSSVSLQMAENITN------GGAAINV
COBT_MYCLE      CPPRQFQ-----RARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDR------GGAAINA
COBT_MYCTU      CPPRQFE-----RARVVVFAGDHGVARSGVSAYPPEVTAQMVANIDA------GGAAINA
COBT_STRAW      VPVRPVE-----RPRVVLFAGDHGVASLGVSARPAGSADQLVRAVLE------GASPASI
COBT_STRCO      VPVRPVV-----RPRVVLFAGDHKVAELGVSARPAGSAGELVREVLE------GGRPVSV
COBT_DEIRA      ERPEPR------GAAVLVAAGDHGVAAEGVSAYPPEVTPAMVANFLADTPAGPGGAAVSA
                                    .:: :   .:   *   :                      

COBU_SINSX      ICVSHDLGLKVFDLALE----------------------YPTGDITEEAALSERDCAATM
COBT_RHIME      ICVAHDLGLKVFDLALD----------------------YPTGDITEEPALSERDCAATM
COBT_AGRFC      ICVANDLGLKIFDLALD----------------------YPTGDITCEPALSERDCAATM
COBT_BRUME      ICIANDLGLKVFDLALE----------------------HPTGDITEEAAMDERTCAATM
COBT_BRUSU      ICIANDLGLKVFDLALE----------------------HPTGDITEEAAMDERTCAATM
COBT_METC4      IAKANGLKLSIVPIDLD----------------------RPTADIIIADAMSVQECAAAV
COBT_RHILO      LARIAGAELDVIPLDLD----------------------HPTGDFTQVPAMDEKAFLAAV
COBT_RHOCB      LCRAAGADLQVISLDLD----------------------RPTQDFTQGPAMTEAETVAAL
COBT_PSEPK      LARQLQASLDVVDLGTIDAQLELP-------GVRHLRLGTGTANFARQPAMTENQLQAAL
COBT_PSESM      LARQLSAQLDVVDLGTV-SPMDLP-------GVRHLRIGAGTANFVDGPAMTVEQGLAAL
COBT_PSEAE      LARELGAGLEVVDLGTAFPLEALP-------GVRHLRLAAGTANFVEAPAMGAEECLLAL
COBT_XANAC      LARELGARLEVVNLGVVNDPGDLP-------RVRRAWIAPSSANICEQPAMTATQLRDAI
COBT_XANCP      LARELGARLEVVNLGVVNDPGELP-------RVRRAWIAPACANICEQAAMTPAQLRDAL
COBT_BRADU      LARELGSHLEVVDAGTL-SQDEMI-------GIVTDRPRHGTRDFSVEAALTLAELAFAF
COBT_VIBPA      FCDVNQIEFKVIDCGMLAPIEVMVPEFKSHPNLIEQRLGNGTANFSKQAAMSSEQVALGL
COBT_VIBVU      FCALHSIDLTVVDCGILLPVD------SDAPNLILRRLGSRTANFAFESAMTIEQVEQAL
COBT_VIBCH      FCRTEHAAMRVIDCGILRAQP-------AHADLIEQRLGAGTHNLAEQAAMSSEQVQEGI
COBT_SHEON      FCRQLGLTLEVIDCGILTPVE-------GVEGIIDQRLGAGTGAIHLEPAMSLDCVDKGF
COBT_LEPIN      FCKQNSIRLKVVDSGVDFKFPH--DTVSLHPDFIDAKVGFGTKNILIEPAMTKEQCNQAL
COBT_RALSO      FCRQHGFALEIVNAGVAMPLWS-----LGVPGLIDAPIGAGTRNFAHEPAMTAAERDRAM
COBT_BACHD      LSRVSNASVQIVDIGVN-GTL-QL------PGLINKNVRHGTNNMAQGPSMEREEAIAAI
COBT_CHLTE      LSRHAGADLEVVDMGVN-HDFAEH------PMLRRCKVKHGSANMAEGPAMSIEETLQAI
COBT_CLOAB      FTRHAGADIEVIDIGVDADINEE--------GIINKKIRRGTSNMIKGAAMTRDEALKGL
COBT_CLOTE      LSKHVNADMCVVDIGIKSDVKDS--------RILNKKVAYGTKNMAKEPAMTREEAVKAI
COBT_CLOPE      LAKANGTDLMVFDVGINSDEVVE--------GVINRKISKGTKNIYKEPAMTYEEAKKSL
COBT_FUSNN      FTKTLGIDLNVVDIGMKNDIKRNY------PNLIHKKIRRGTNNFYKERAMSINECLEAI
COBT_ECOLI      LAEQAGANVHVIDVGIDTAEPIP--------GLINMRVARGSGNIASAPAMSRRQAEKLL
COBT_ECOL6      LAAQAGANVHVIDVGIDTAEPIP--------GLINMRVARGSGNIASAPAMSRRQAEKLL
COBT_ECO57      LAAQAGANVHVIDVGIDTAEPIP--------GLINMRVARGSGNIASAPAMSRRQAEKLL
COBT_SALTI      LAAQAGAKVHVIDVGID-AEPIP--------GVVDMRVARGCGNIAVGPAMSRSQAEALL
COBT_SALTY      LAAQAGAKVHVIDVGID-AEPIP--------GVVNMRVARGCGNIAVGPAMSRLQAEALL
COBT_COREF      LARAAGASVRVADISLDHEA--------TGPE----RVRRSCGSIDIEDAMTGEEVLQAL
COBT_CORGL      IARTTGTSVRLIDTSLDHEA--------WGDE----RVSRSCGSIDVEDAMTQEQVERAL
COBT_MYCLE      LASIADATIRIADLAVDADP--------LSQQIGIHKVRRGSGDIAIQDALTEDETARAI
COBT_MYCTU      LADVAGATVRVADLAVDADP--------LSERIGAHKVRRGSGNIATEDALTNDETAAAI
COBT_STRAW      LARRLNVPVRVVDMALDCEPD------ALPESVVRHRVRRGSGRIDVEDALTLEEAEAAF
COBT_STRCO      LARRLDVPVRVVDMALDCDPE------TLPAEVAGHRVRRGGGRIDIEDALTPEEAEAAF
COBT_DEIRA      LARTLGAEVYVMDAGVNADL-------PEHPALTRAARRRGTRNLRREAAMTREETVALM
                :       . :                                 :    ::        .

COBU_SINSX      AFGME----AIAGGTDLLCIGEMGIGNTTIAAAINLGLYGGTAEEWVGPG-TGSEGEVLK
COBT_RHIME      AFGME----AIAGGTDLLCIGEMGIGNTTIAAAINLGLYGGTAEEWVGPG-TGSEGEVLM
COBT_AGRFC      AFGME----AIAGGTDLLCVGEMGIGNTTIAAAINLALYGGTAEEWTGPG-TGSEGEVMA
COBT_BRUME      AFGME----AIAGGTDLLCIGEMGIGNTTIAAAIALALFGGTAEDWVGPG-TGSTGELMQ
COBT_BRUSU      AFGME----AIAGGTDLLCIGEMGIGNTTIAAAIALALFGGTAEDWVGPG-TGSTGELMQ
COBT_METC4      NLGAS----VAAADLDLLCIGEMGIGNTTPASAILQALFGGPAHIWVGPG-TGVERDALT
COBT_RHILO      SAGYD----AVTKDLDLVCFGEMGIGNTTPAAAISAALFGGGAEKWTGRG-TGVDDAGLK
COBT_RHOCB      NVGAG----AVDVTADALIIGEMGIGNSTIAAALAAAIYGGTAKDFVGPG-TGSDAAGIA
COBT_PSEPK      QAGRDSAQRAAEQGAQLFIGGEMGIGNTTAAAALASVLLGCPASELSGPG-TGLDNAGVQ
COBT_PSESM      QAGRDSVLRAKAVGTELFIGGEMGIGNTAAASAVACSVLECAAPLLVGPG-TGLNAEGIV
COBT_PSEAE      EAGRESVRRAEQAGSQLFIGGEMGIGNTTAAAAMACALLDAPASALVGPG-TGLDASGVA
COBT_XANAC      AAGADSIAQARSCDTQLFVGGEMGIGNTTSAAALACALLSQFPQAMAGAG-TGLDAEGIA
COBT_XANCP      AAGAESIAQARTCGTQLFVGGEMGIGNSTAAAALSCALLSQFPQAMAGAG-TGLDAEGIA
COBT_BRADU      EAGERAVARAAASQPDLLIFGEMGIGNTTTSAAIAASLLGVSAEEIAGSG-TGVDAAGRA
COBT_VIBPA      EYGARVAQSTIYSGSNLLMFGEMGIGNTSSASALLAALSPLEVNHCVGLG-TGINSEQLS
COBT_VIBVU      RNGQQIAAEKIAQGADLLMFGEMGIANTSSAAALLSALSGHEVDHCVGRG-TGINEEQLS
COBT_VIBCH      ALGKALIHREVESGCNLLMFGEMGIGNTSSAAAILAALSGLPIEVCVGRG-TGITDEQYQ
COBT_SHEON      AMARELIERHHQAGCNLVAFGEMGIGNTSSAAAIMAAIMQLEVADCVGRG-TGINSETLA
COBT_LEPIN      ENGARISQKSVSENCNVIGFGEMGIGNTSSASLITASILKKSLKEVTGKG-TGLNDQGFQ
COBT_RALSO      ALGAQRVAAHAELGSNVIALGEMGIGNTASAACLMARLCDLPLAQCVGRG-AGLDDAGLA
COBT_BACHD      EVGIEVAQAAIQNGAKLLALGEMGIGNTTASSAMLAALEQVPVEQIVGFG-TGLSHEGKE
COBT_CHLTE      MAGAELAIEARNQGYELLATGEMGIANTTPATALYATLLGLPVEAITGRG-TGIDDERLH
COBT_CLOAB      EVGIEAVKELKDKGVNLIGTGEMGVGNTTTSSAVASVLTGCPVDEMVGIG-SGLTKEAFR
COBT_CLOTE      ETGIELVDKFVKEGYDLFGTGEAGIGNTATSAAVISVLSQIDSDKIVGKG-SGLTDEGFL
COBT_CLOPE      EIGIEAVKIAKEKGYKILGVGEMGIGNTTTSAAVLKALIGCETSQVVGKG-GGINNDSFE
COBT_FUSNN      FTGIDIINE-KSKDYDMFSNGEMGIANTTTSSALLYSVTRQNIDDIVGRG-GGLSDEGLN
COBT_ECOLI      LDVICYTQELAKNGVTLFGVGELGMANTTPAAAIVSTITGRDPEEVVGIG-ANLPTDKLA
COBT_ECOL6      LDVICYTRELAKNGVTLFGVGELGMANTTPAAAIVSTITGRDPEEVVGIG-ANLPTDKLA
COBT_ECO57      LDVICYTRELAKNGVTLFGVGELGMANTTPAAAIVSTITGRDPEEVVGIG-ANLPTDKLA
COBT_SALTI      LEVSRYTCDLAKRGVTLFGVGELGMANTTPAAAMVSVFTGSDAKEVVGIG-ANLPPSRID
COBT_SALTY      LEVSRYTCDLAQRGVTLFGVGELGMANTTPAAAMVSVFTGSDAKEVVGIG-ANLPPSRID
COBT_COREF      QIGIRIADQEIDSGADILIPGDLGIGNTTPAAALIGTFTLAEPVVVVGRG-TGIDDEGWK
COBT_CORGL      KIGKRIADQEVDAGADILIPGDLGIGNTTTAAALVGTFTLAEPVVVVGRG-TGIDDEAWK
COBT_MYCLE      IAGQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFG-TGIDDASWA
COBT_MYCTU      TAGQQIADEEVDAGADLLIAGDMGIGNTTAAAVLVAALTDAEPVAVVGFG-TGIDDAGWA
COBT_STRAW      RAGVAVADEEADAGTDLVVLGDVSVGGTTAAAVLIAALCGTDASVVTGRGGLAIDDLAWM
COBT_STRCO      RAGMAVADEEADSGTDLVVLGDVSVGGTTAAGTLVAALCGTDASVVTGRGGLPIDDLAWM
COBT_DEIRA      LAGAALADRAMDAGADFIIPGEMGIGNTTPAAALTARLLGVDPADVTGRG-TGVDDERLA
                                 .  *: .:..:: :  :   .         * *          

COBU_SINSX      RKIAAVEKAVA-LHRDHLSDPLELMRRLGGREIAAMAGAILAARVQKVPVIIDGYVATAA
COBT_RHIME      RKIAAVEKAVA-LHRDHLSDPLEVMRRLGGREIAAMAGAILAARMQKVPVIIDGYVATAA
COBT_AGRFC      RKIAAVKAAVE-FHKDHLSDPLEIMRRLGGREIAAIAGAILAARVQRIPVLIDGYVATAA
COBT_BRUME      RKLAAVRLAVA-LHQPHLQDPLEVLRCLGGREIAAMAGAILAARMEKIPVIVDGFVASAA
COBT_BRUSU      RKLAAVRQAVA-LHQPHLQDPLEVLRCLGGREIAAMAGAILAARMEKIPVIVDGFVASAA
COBT_METC4      NKIRAVESAVARVIGTDGTSPLEFLRRLGGREIAALVGAIIEARHRRIPVLIDGFVATAA
COBT_RHILO      RKVVAIEAGLK-RHAAALADPLGVAAALGGRELAAIFGATLAARHLGIPVLLDGFVCTAA
COBT_RHOCB      RKIAAIDKGLA---LHGGLGGMETLAALGGREIAAMCGAVLGARAARIPVILDGFISTAA
COBT_PSEPK      HKAEVIERALR-LHGLRAEDPLQALACVGGFEIAALAGAYLGCAQAGVTVLVDGFICSVA
COBT_PSESM      HKTRVIERALA-LHAEHAGDPLQSLFCLGGFEIAALTGAYLACAQEGIVAMVDGFICSVA
COBT_PSEAE      HKAAVIERALA-LHGAHRADPFETLRRLGGLEIAALAGAYLACAQKGMVALVDGYICSVA
COBT_XANAC      HKATVITRALA-LHA-DASSPLERLRRLGGFEIAALVGAYIAAAQAGIPVLVDGFITTAA
COBT_XANCP      HKATVITRALA-VHA-DAATPLERLRRLGGFEIAALVGAYIAAAQAGIPVLVDGFISTAA
COBT_BRADU      HKARVIDAAIV-RHGVAAASPEKILCAVGGLEIAAICGAIIAAAQRRIPVLIDGFIVSVA
COBT_VIBPA      RKLKLVAQGVS-RCRGLDA--KAVLSQVGGFEIVQMVGAFLEAKRLKTPVLVDGFIVSVA
COBT_VIBVU      HKIKVVAQGVG-RCEGLSV--NAILAEVGGFEIVTMAGAFIAAAEHKTPVLVDGFIVSVA
COBT_VIBCH      RKRALVTQGVE-RCLGAAP--QDVLQQVGGFEIVQMVGAFMGAYEKQTPVLVDGFIVTVA
COBT_SHEON      RKLTLVELALL-SHQSAMTGPKQVLACLGGFEIVQMTGAMLAAAERKMLVVVDGFIATAA
COBT_LEPIN      KKIEILEKCFE-KHKTNLKTAFDVLQTFGGFEIAMMVGAMIDSVKKGRIILIDGFIATSA
COBT_RALSO      RKCAVLEAALA-AHADARA-PLDALACFGGFEIAAMAGAMLEAARRRMVILVDGFIASAA
COBT_BACHD      KKVAVIKRAIE-VNQPNAADPIDVLAKVGGLEIAGLAGIVLGAAAWRIPVLVDGFITAVA
COBT_CHLTE      HKVAVIEKAIE-VNRANLATPLEVLAALGGFEIAGICGLILGAASVGMPVVVDGFISSSA
COBT_CLOAB      NKIQIVKEAIA-LNKPNKEDPIDVLSKVGGFDIAGLAGCFLGAAIYRIPIVIDGFISASA
COBT_CLOTE      NKKRAVKQAIE-INKPNKEDVIDVIAKIGGFDIAGICGCFLGAAKNRVPIVIDGIISASA
COBT_CLOPE      KKKRIVEEVVK-KHNINFDDSIDIISKVGGYDIGAMTGVFLGAAFYRIPVVIDGFISVVT
COBT_FUSNN      KKKKVIIEACE-RYNTFEMDAVEMLASVGGFDLACMLGIYVGAALNKKLILVDGFISSVA
COBT_ECOLI      NKIDVVRRAIT-LNQPNPQDGVDVLAKVGGFDLVGIAGVMLGAASCGLPVLLDGFLSYAA
COBT_ECOL6      NKIDVVRRAIT-LNQPNPQDGVDVLAKVGGFDLVGIAGVMLGAASCGLPVLLDGFLSYAA
COBT_ECO57      NKIDVVRRAIT-LNQPNPQDGVNVLAKVGGFDLVGMAGVMLGAASCGLPVLLDGFLSYAA
COBT_SALTI      NKVDVVRRAIA-INQPNPRDGIDVLSKVGGFDLVGMTGVMLGAARCGLPVLLDGFLSYSA
COBT_SALTY      NKVDVVRRAIA-INQPNPRDGIDVLSKVGGFDLVGMTGVMLGAARCGLPVLLDGFLSYSA
COBT_COREF      RKVTAVRDAMF-RVRTLRQDPITVARMISSPDLTAMAAFIAQAAVRRTPVILDGAVVTAA
COBT_CORGL      LKVSAIRDAMF-RARDLRQDPIAIARKISSPDLAAMAAFIAQAAVRRTPVLLDGVVVTAA
COBT_MYCLE      RKTAAVRDALC-RIRLVLPDPVGLLRCCGGADLAAMAGFCAQAAVRRTPLLLDGMVVTAA
COBT_MYCTU      RKTAAVRDALF-RVRPVLPDPVGLLRCAGGADLAAIAGFCAQAAVRRTPLLLDGVAVTAA
COBT_STRAW      RKCAAVRDALR-RARPVLGDQLQLLAAVGGADLAAMTGFLLQSAARKTPVILDGVVSAAC
COBT_STRCO      RKCAAIRDALR-RARPVLGDQLQLLATVGGADLTAMTGFLLQSAVRKVPVILDGVVTAAC
COBT_DEIRA      HKVDVVREAL---ARTAVTDPLDVLAEFGGFEIAAMLGMMLAAAARRRAVILDGFVEGSA
                 *   :                      .. ::  : .    .       ::**      

COBU_SINSX      ASILKAANPSALDHCLIGHVSGEPGHLRAIEKLGKTPLLALGMRLGEGTGAALAAGIVKA
COBT_RHIME      AAILKAANPAALDHCLIGHVSSEPGHMRAIEKLGKTPLLALGMRLGEGTGAALAAGIVKA
COBT_AGRFC      AALLKAANSSALDHCLIGHVSGEPGHLAAVEKLGKTPLLALGMRLGEGTGAALAAGIVKA
COBT_BRUME      AAVLYAANPEAIDHCMFGQVSAEPGHRKLLAKMGKEPLLDLGMRLGEGTGAALAANIVKA
COBT_BRUSU      AAVLYAANPEAIDHCMFGHVSAEPGHRKLLAKMGKEPLLDLGMRLGEGTGAALAANIVKA
COBT_METC4      AAVVHAIEPGAIDHCLIGHLSAEPAHRRAVQALGKTPILELNMRLGEASGAALAAGIVRS
COBT_RHILO      AAPLARLHPTGLSHTIAAHVSAESGHRRLLEALGLPPLLDLGMRLGEGSGACLAVNIVRS
COBT_RHOCB      VSTLFKVDPRLLDHCVVGHTSAEPGHQKVLTTMGKRALLQMEMRLGEGTGAALALGVVRA
COBT_PSEPK      ALVAVRLNPQCRAWLLFAHQGAEPGHKTLLAALQAEPLLALGLRLGEGSGAALAVPLLRL
COBT_PSESM      ALVAVRLNPSCRDWLLFGHRGAEPGHRHLLETLQAEPLLDLGLRLGEGSGAALAVPLVRL
COBT_PSEAE      ALCAVRLNPACRDWLLFAHSGAEPGHRHVLEALAAQPLLDLGLRLGEGSGAALAVPLLRQ
COBT_XANAC      ALVATRLNPGVREWLLFGHRSQERGHAALLRALDAEPLLQLDLRLGEASGAAVAIPLLRS
COBT_XANCP      ALVAVHLNPGVREWLLFGHRSQERGHAALLRALEAEPLLQLDLRLGEASGAAVAIPLLRT
COBT_BRADU      ALAAVRLNPSCQPFLLPSHQSAEQGHRLVLRALNVQPLISLDLRLGEGSGAAIALPLVRS
COBT_VIBPA      AYVATLLDEETRDYMLFAHRSEENGHKFVLESLKAEPLLDLGLRLGEGTGAALALPLLKA
COBT_VIBVU      AYIATLLKPEVRDYLLFAHRSEEQGHQIVLSLLEAKPLLDLGLRLGEGTGAALAYPLLKA
COBT_VIBCH      AYVATLIEPNVRDFLLFAHCSQETGHRAVLEMLAAEPLLDLGLRLGEGTGAVLALGLVRA
COBT_SHEON      ALVAVTINANVRDYLIFAHRSEEQGHQRMLEHLQAKPLLSLGLRLGEGTGAALALPLIQA
COBT_LEPIN      FLIAHKMEPSILKNAVFCHKSVEPGHSYLLEEWNIKPLLDLGLRLGEGTGCAIAFPILIS
COBT_RALSO      ALVATRVAPEVQRFCVFAHLSDEHGHRALLAALGAEPLLQLSMRLGEGSGAVLAYPLVVS
COBT_BACHD      ALTAVRIAPLCVHYLIASHQSVEPGHVCVNKLLGLTPLVNLNLRLGEGSGTAIALPIVRS
COBT_CHLTE      AVCAIKLSCTVSDYLFFSHLSNEQGHRAVMQKLGARPILDLDLRLGEGTGAAMAMQVIEA
COBT_CLOAB      ALLAVKINPLVKNFIIPSHGSAEPGSKWIMKELDLEPMLNLKMRLGEGTGAALAFQIVDM
COBT_CLOTE      ALCAYKMNANVKDFLISSHLSAEPGIEYVTGAIGLKPCLHMEMRLGEGSGCPLQFFMIES
COBT_CLOPE      ALLANRLNPLVKEFCFTSHKSQEIGYELAIKELGLDPMLDLNMRLGEGSGCPIAFSVIDF
COBT_FUSNN      ALLACSLNKNIQDYLLFTHKSEEPGVNIILDYLKEKTFLNMNMRLGEGTGAVLACPIIDC
COBT_ECOLI      ALAACQMSPAIKPYLIPSHLSAEKGARIALSHLGLEPYLNMEMRLGEGSGAALAMPIIEA
COBT_ECOL6      ALAACQMSPAIKPYLIPSHLSAEKGARIALSHLGLEPYLNMDMRLGEGSGAALAMSIIEA
COBT_ECO57      ALAACQMSPAIKPYLIPSHLSAEKGARIALSHLGLEPFLNMDMRLGEGSGAALAMPIIEA
COBT_SALTI      ALAACQIAPAVRPYLIPSHFSAEKGARIALAHLSMEPYLHMAMRLGEGSGAALAMPIVEA
COBT_SALTY      ALAACQIAPAVRPYLIPSHFSAEKGARIALAHLSMEPYLHMAMRLGEGSGAALAMPIVEA
COBT_COREF      ALLANKLAPGARRWFIAGHRSPEPAHPIALDALGLTPLVDLGMRLGEGSGAAAALPLVKT
COBT_CORGL      ALLANKLAPGARRWFIAGHRSTEPAHSVALNALALDPILELGMSLGEGSGAATALPLVKI
COBT_MYCLE      ALVAERLAPGSWQWWQAGHQSTEPGHALALAALDLDPILDLRMRLGEGTGATAALLVLRA
COBT_MYCTU      ALVAERLAPGAHRWWQAGHRSSEPGHGLALAALGLDPIVDLHMRLGEGTGAAVALMVLRA
COBT_STRAW      ALVGQRIAFRAPDWWLAGQNSGEPAQAKALDRMALEPLLNHGVTVGEGAGALLALPLVQA
COBT_STRCO      ALVGQRVAFRAPDWWLAAHDSGEPGQAKALDRMAMEPLLTQGVKVGEGAGGLLALPLVQA
COBT_DEIRA      ALVGVALAPALRDFLFPAGECAERGHAAQLADLGLKPMFNLGLRLGEGTGGVLALPLLRG
                                      * .           . .   : :**.:*      ::  

COBU_SINSX      AAACHSGMATFAQAGVSNKE---------------------
COBT_RHIME      AAACHSGMATFAQAGVSNKE---------------------
COBT_AGRFC      AAACHSGMATFEAAGVDTRISPRTEH---------------
COBT_BRUME      AALCHSGMATFEQAGVSASK---------------------
COBT_BRUSU      AALCHSGMATFEQAGVSASK---------------------
COBT_METC4      ALAVHTGMATFAEAGVTDRQT--------------------
COBT_RHILO      ALECHARMASFAEAGVSEK----------------------
COBT_RHOCB      ALECHNGMVTYAEAGITA-----------------------
COBT_PSEPK      ACALHGQMATFAEAAVADRPA--------------------
COBT_PSESM      ACELHNGMATFAEAAVADRPA--------------------
COBT_PSEAE      ACALHAGMATFAEAAVSDRPA--------------------
COBT_XANAC      ACALHNGMATFAEAGVSDA----------------------
COBT_XANCP      ACALHNGMATFAEAGVSDA----------------------
COBT_BRADU      ACALHNGMATFAQANVPDRPA--------------------
COBT_VIBPA      AAQFYNKMASFESAGVTV-----------------------
COBT_VIBVU      AAQFYNNMASFESAGVTV-----------------------
COBT_VIBCH      AVEFYNHMASFADAGVTV-----------------------
COBT_SHEON      AANFYNQMASFSDAGIEAVV---------------------
COBT_LEPIN      AVTFLKEMASFESAKVDQKL---------------------
COBT_RALSO      AVAFLREMATFASAGVSEQAPPALDPAA-------------
COBT_BACHD      AIRIAHEMATFEQAGVSGAIEDVGKEK--------------
COBT_CHLTE      SVKIYNEMATFSSAGVSGKND--------------------
COBT_CLOAB      AVFSYLEMGTFENAEIEPYKPLK------------------
COBT_CLOTE      ALCLMNNMATLAEASIVDSEFLVDIREK-------------
COBT_CLOPE      ATAMMNNMATFEEGNIDNSYLEDVKDEECYIVL--------
COBT_FUSNN      AIEMINTMKSPEEVYNLFNK---------------------
COBT_ECOLI      ACAIYNNMGELAASNIVLPGNTTSDLNS-------------
COBT_ECOL6      ACAIYNNMGELAASNIVLPGNTTSDLNS-------------
COBT_ECO57      ACAIYNNMGELAASKIVLPGNTTSDLNS-------------
COBT_SALTI      ACAMFHNMGELAASNIVLPEGNANAT---------------
COBT_SALTY      ACAMFHNMGELAASNIVLPEGNANAT---------------
COBT_COREF      AVDLMIDMSTMNDAGVDRADGADNSADSGASAGTVASDPTV
COBT_CORGL      AVDLMNDMSTFSSAGVDGPLNASSEAPEQNTE---------
COBT_MYCLE      AVAALTSMTTFAEAGVAGTS------TSPPS----------
COBT_MYCTU      AVAALSSMATFTEAGVSTRSVDGVDRTAPPAVSP-------
COBT_STRAW      AAALAAELPEKPEELEAGEGPEAAEESSPEPENPEALAE--
COBT_STRCO      AASLAAELPTTADGEAVTDGE--------------------
COBT_DEIRA      AAATLREMRTFEEAAVPGGGAA-------------------
                :      :