CLUSTAL format seed alignment for MF_00233

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LOLB_CHRVO      --------------MIRRVLLLSLALLLAGCANE----------------ALFRP--KPA
LOLB_NEIMA      ---------------MKHTVSASVILLLTACAQL---------------PQNNENLWQPS
LOLB_NEIMB      ---------------MKHTVSASVILLLTACAQL---------------PQNNENLWQPS
LOLB_COXBU      MSLISNNEERSLRVRYCIAIALSA-LLISGCTTL--------RLPNQSTSVYHQQTWAQR
LOLB_PSEAE      -------------MRLRLFLAASALALLSGCAGL--------TSHEALEGQGDAQTWKTH
LOLB_PSEPK      -------------MFLRHCITFTLIALLAGCAGF--------GSREALQGHGDPQQWRAH
LOLB_PSESM      -------------MFLRHVIVFSFIALLAGCAGL--------TSREAVQGKGDPAQWREH
LOLB_BORBR      --MSACPAPRSPFRWLHAFTLCLLLAVLAGCVSV-------------------PKPMAGA
LOLB_BORPE      --MSACPAPRSPVRWLHAFTLFLLLAVLAGCVSV-------------------PKPMAGA
LOLB_BORPA      --MSVCPAPRSPVRWLHAFTLCLLLAVLAGCVSV-------------------PKPMAGA
LOLB_RALSO      -------MATVFSRALGALVLGVACALLAGCASV----------------RPANDLFAGT
LOLB_XANAC      ----------MSKTVRTLALGGLVLAGLSACVSV-PRGQGSGAAVVDHVSDSARQAEAAR
LOLB_XANCP      ----------MSQVIRTLALTGLALAGLSGCVSVPRGQGGAAPAVVGQVSESAQQAETAR
LOLB_XYLFA      ----MTVYLHDVNRGLGVFLLVVSF-LLPGCSSS----GGRRASVPVMVDATAQVVEQAR
LOLB_XYLFT      ----MKVYLHDVNRGLGVFLLAVSF-LLPGCSSS----GGRRASVPVTVDATAQVVEQAR
LOLB_NITEU      -------------MACRSWVLG-ILLVLVGCAG---------PEVHQGEVTTVVIQPVQE
LOLB_ECOLI      --------MPLPDFRLIRLLPLAA-LVLTACSVT------TPKGPGKSPDS---PQWRQH
LOLB_ECO57      --------MPLPDFRLIRLLPLAA-LVLTACSVT------TPKGPGKSPDS---PQWRQH
LOLB_SHIFL      --------MPLPDFRLIRLLPLAA-LVLTACSVT------TPKGPGKSPDS---PQWRQH
LOLB_ECOL6      --------MPLPDFRFIRLLPLAA-LVLTACSIT------TPKGPGKSPDS---PQWRQH
LOLB_SALTI      --------MTLPDFRLIRLLPLAS-LVLTACTL---------PGHKGPGKSPDSPQWRQH
LOLB_SALTY      --------MTLPDFRLIRLLPLAS-LVLTACTL---------PGHKGPGKSPDSPQWRQH
LOLB_PHOLL      -------MKPIQKLSLFRLLPLSCVLLLTACTLT----------QPGGTGSADSPQWRAH
LOLB_YERPE      --------MPMRKRHFYRLLPLAS-LLLAACTI---------PVSKGPATSPTSPQWRQH
LOLB_VIBVY      ------------MFRRTYFWLMLLPLFMVGCTGL--------------PDHPTSVEWQSH
LOLB_VIBVU      ------------MFRRTYFWLMLLPLFMVGCTGL--------------PDHPTSVEWQSH
LOLB_VIBPA      -----------MTLRSFLIFFLSS-LILAGCSSV--------------PESVTSVEWQAH
LOLB_VIBCH      ----------MNALVRRLLPGLASLLLLAGCATA--------------PLQPVNVQWQSH
LOLB_AGGAC      ----------MKKLKSYVLLVLAV-LFLTACVTD------QERPTNVKYIEKTDRTWQQH
LOLB_HAEIN      ---------MNNMKTFKFFTALFATAILTACTLD------MERPTNVQYIDKTDAIWQQH
LOLB_PASMU      ----------MVMKKQHFLLPIIASFFLFACTLD------TERPTDVKYISHTDPTWQQH
LOLB_HAEDU      -------------MKKSTLLFSLMAMALSGCNSV--LNAPIEVKKLVYQIEHTDPAWQQH
LOLB_SHEON      -----MNNLKRFTKSIFSCIALSGLLFLGGCETL-------PPMTDLSPITVDNA-----
                                           : .*                             

LOLB_CHRVO      LESAAD-APFSV-SGRLSANLD-----GKGHVANFDWRHLP-PRDEVAINSPLGNTVAKV
LOLB_NEIMA      EHT----RSFTA-EGRLAVKAE-----GKGSYANFDWTYQP-PVETININTPLGSTLGQL
LOLB_NEIMB      ----EHISSFAA-EGRLAVKAE-----GKGSYANFDWTYQP-PVETININTPLGSTLGQL
LOLB_COXBU      YYDLSRISQWNI-DGAFSIQQP-----GKTIIAAYDWQQKG-MNYRIRIHSSLDIYSVNI
LOLB_PSEAE      KQQLSELDAWQI-DGKVGIRAP-----RDSGSGTLFWLQRQ-GYYDIRLSGPLGRGAARL
LOLB_PSEPK      KAQLSSLDGWQI-NGKVGIRAP-----RDSGSGTLFWLQRQ-DYYDIRLAGPLGRGAARL
LOLB_PSESM      KQQLSSLDGWQI-NGKVGIRAP-----KDSGSGTLFWLQRQ-DYYDIRLSGPLGRGAARL
LOLB_BORBR      GEDV-----FSRV-GRFAITVTESDGKQQAVQGGFAWRDDG-GSYLLDLTNPLGSTEARV
LOLB_BORPE      GEDV-----FSRV-GRFAITVTESDGKQQAVQGGFAWRDDG-GSYLLDLTNPLGSTEARV
LOLB_BORPA      GEDV-----FSRV-GRFAITVTESDGKQQAVQGGFAWRDDG-GSYLLDLTNPLGSTEARV
LOLB_RALSO      QDGDATITRYQ---GRFSARYVQDDA-QQSAVGSFLWRERG-ADVQLELMSPLGQTLAIV
LOLB_XANAC      QAWLQAHPHWSF-QGRVAISKD-----RNGGSGRIDWQQDG-PRYRVQLSAPVTRQSWVL
LOLB_XANCP      QAWLQAHPAWSF-QGRVAISKG-----RDGGSGRLDWQQDG-PRYHVQLSAPVTRQSWVL
LOLB_XYLFA      QTWLQEHPNWGF-HGRAAISQG-----RDGGSVRVEWEQHG-RGYRIVLSAPMSRQSWVL
LOLB_XYLFT      QTWLQEHPNWSF-YGRAAIRQG-----SDGGSVRVEWEQHG-RGYRIVLSAPMSRQSWVL
LOLB_NITEU      QADIAN-EPFVL-TGRLAVNAR-----QHRFSGGIRWQHTG-QSDEIYLFSPLGQIVAEI
LOLB_ECOLI      QQDVRNLNQYQT-RGAFAYISD-----QQKVYARFFWQQTGQDRYRLLLTNPLGSTELEL
LOLB_ECO57      QQDVRNLNQYQT-RGAFAYISD-----QQKVYARFFWQQTGQDRYRLLLTNPLGSTELEL
LOLB_SHIFL      QQDVRNLNQYQT-RGAFAYISD-----QQKVYARFFWQQTGQDRYRLLLTNPLGSTELEL
LOLB_ECOL6      QQDVRNLNQYQT-RGAFAYISD-----QQKVYARFFWQQTGQDRYRLLLTNPLGSTELEL
LOLB_SALTI      QQEVRHLNQYQT-RGAFAYISD-----DQKVYARFFWQQTGQDRYRLLLTNPLGSTELEL
LOLB_SALTY      QQEVRHLNQYQT-RGAFAYISD-----DQKVYARFFWQQTGQDRYRLLLTNPLGSTELEL
LOLB_PHOLL      TQQLQQLNQYQT-RGSFAYLSN-----EKKVYARFFWQQYHPERYRLLLTNPLGSTELEL
LOLB_YERPE      EQQLQQLGQFET-RGAFAYLSD-----KQKVYARFFWQQTSPERYRLLLTNPLGSTELEL
LOLB_VIBVY      QAKLSQIQSFQA-VGKLGYISP-----DQRQNLNFYWKHS-PEQSNLRFTTFLGQTALNL
LOLB_VIBVU      QAKLSQIQSFQA-VGKLGYMSP-----DQRQNLNFYWKHS-PAQSNLRFTTFLGQTALNL
LOLB_VIBPA      EQRLETIHDFQA-TGKLGYIGP-----DQRQSLNFFWKHS-TALSQLRLTTVLGQTALKL
LOLB_VIBCH      QVTLEQIQHYQL-TGKLGYIAP-----DQRQSFNFQWQKS-PQKLSLRLSNFLGQTVLNL
LOLB_AGGAC      FTQLKQIQGYPA-LGQLGYISS-----KERFSTRFDWQYNNPRDYTLQLYSTISSETLQI
LOLB_HAEIN      LQKIQKIQSYQA-KGQIGYISP-----TERFSSRFEWQYQNPKSYTLKLYSLISKSTLWI
LOLB_PASMU      LSQLKKIRDYTN-QGQLGYISQ-----KERFSTRFDWQYQNPTNYRLTLSSTLSPTTLSI
LOLB_HAEDU      LKQLAEIKNYEV-KGQFGYISP-----TERFSAHFDWQYKTPIDFTLALSSNLSTKLLKL
LOLB_SHEON      ----AQAKAWEL-QGKLAIRTP-----EDKLSANLYWRHS-EERDELTLTTMLGTTVLTL
                         :    *  .          .       *         : :   :      :

LOLB_CHRVO      LR--DPGGVTLL-ADGKRWQADDVESLTRQVMGWPLPLSNLVWWIRGLPAP-GVESRVDA
LOLB_NEIMA      CQ--DRDGALAVDGKGNVYQAESAEELSRQLVGFKLPIQYLHIWADGRPVA-GAPYRILP
LOLB_NEIMB      CQ--DRDGALAVDGKGNVYQAESAEELSRQLVGFKLPIQYLHIWADGRRVA-GAPYRILP
LOLB_COXBU      SG--RPGMVTLWRSPRQHYTASTPEQLMQQQLGWQLPLSNLYYWIRGIPAP-GA-YQADF
LOLB_PSEAE      TG--REGAVSLEVAGQGRYQAESPEALLEEQLGWRLPVSHLLWWVRGLPAP-DSKSRLTL
LOLB_PSEPK      TG--RPGGVVLEVANQGRYEATSPEALLEEQLGWQLPVSHLVWWVRGLPAP-DSKSKLTL
LOLB_PSESM      TG--RPGAVALEVANQGRYEAPTPETLLQDQLGWKLPVSHLVWWVRGLPAP-DSKSNVTL
LOLB_BORBR      EG--RPGMAVLTRANGERLAAEHPDALAEDALGSPVPVTGLRDWLRGRLMAGAAPDGLER
LOLB_BORPE      EG--RPGMAVLTRANGERLAAEHPDALAEDALGSPVPVTGLRDWLRGRLMAGAAPDGLER
LOLB_BORPA      EG--RPGMAVLTRANGERLAAEHPDALAEDALGSPVPVTGLRDWLRGRLMAGAAPDGLER
LOLB_RALSO      SQ--NRQGATLELPNQPPRRAAEVDTLMQDALGFSLPVSGLRDWLRARPTP-GTPARVAR
LOLB_XANAC      TGDTTSGAGRLEGLEGGPRSGPDAEQVLLEATGWTIPVNQMPDWVRALRIAGAGAARVDL
LOLB_XANCP      TGDTTTGAGRLEGLDGGPRAGADAEQVLLEATGWTIPVNQMPDWVRALRIADAGAARVDL
LOLB_XYLFA      SG-SSSGPARLEGVGGWVRVGEVAEQVLFEATGWQVPMGLLPDWVRGRNSGGGD---VQL
LOLB_XYLFT      SG-SSSGPARLEGVGGWVRVGEVAEQVLFEATGWQVPMGLLPDWVRGRNSD-SGGGDVQL
LOLB_NITEU      FR--DQTGVRLVTSEPAIYRAQNAEYLTSQVLGWELPLAGMRFWVRGTHFPDTVA-EKDL
LOLB_ECOLI      NA--QPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGD-ATDYKLDD
LOLB_ECO57      NA--QPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGD-ATDYKLDD
LOLB_SHIFL      NA--QPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGD-ATDYKLDD
LOLB_ECOL6      NA--QPGNVQLVDNKGQRYTSDDAEEMIGKLTGMPIPLNSLRQWILGLPGD-ATDYKLDD
LOLB_SALTI      NA--QPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGD-ATDYKLDD
LOLB_SALTY      NA--QPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGD-ATDYKLDD
LOLB_PHOLL      IV--QPNMTQLTDSQGKKYFSDNPEEIIYQFTNMDIPLDNLRHWITGLPGD-AKNFKLDA
LOLB_YERPE      VV--QPGVTQLTDNQGKRYVSDDPQEMIQKLTGMSIPLESLRQWILGLPGD-TSDFTLDD
LOLB_VIBVY      TM--TPQGARVETYDDQILTAANATALVQQLTGLVIPVEQLSDWIIGLPNG-ADDFQLNE
LOLB_VIBVU      TM--TPQGARVETYDDQILTAANATALVQQLTGLVIPVEQLSDWIIGLPNG-ADDFQLNE
LOLB_VIBPA      TI--TPQGATVETYDDQVLSARNANQLIYRLTGLMMPVDHMPDWLLGLPTD-ADTFQLSP
LOLB_VIBCH      QV--DEQGARVETYDDQIYRDQDAQSLIRNLTGLDIPVEQLEDWILGLPTQ-ATHYELNE
LOLB_AGGAC      QM--HAQGMTISDNKGRQRSAADAKMLLREIIGMDFPLEQFAFWLKGQPED-NADYQVGE
LOLB_HAEIN      QM--HQSGMTISDNNGNQQSAANSKLLLQEIIGMDVPLEHLAYWLKGQPAM-NADYQVGT
LOLB_PASMU      EV--RHNVMHLSDNKGPLRSAQDAKRLLKEIVGMDLPLDQFALWLKGQPDE-SREYRVAE
LOLB_HAEDU      QR--SHQGLTVSDSEGYSRTEADIHALMQEIIGVSFPIDQFAYWVKGQPAQ-EGNYIVNE
LOLB_SHEON      EA--TPNSAHLH-IDGKDFRDTNAQALLERVSGWSIPINDLPLWITGQIGSLDRVIAVDS
                                          :     .  .*:  :  *  .             

LOLB_CHRVO      DGN-----LEQQG--WHIRFIR--DADVDSD-----------HPKRVEM----QREG--L
LOLB_NEIMA      DGI-----LEQYG--WTVGRTA-------DSGGQV---------RTLQL----NNGN--L
LOLB_NEIMB      DGI-----LEQYG--WTVGRTA-------DSGGQV---------RTLQL----NNGN--L
LOLB_COXBU      DTYTHLIALQQSG--WHIRFSQYTTV----GSVDL--------PRTLQL----SNGS--L
LOLB_PSEAE      DADSRLARLEQDG--WQIEYTRYAEQN----GYWL--------PERLKL----HGQD--L
LOLB_PSEPK      DGDSRLASLDQDG--WQVQYLSYTEQN----GYWL--------PERLKL----HGKD--L
LOLB_PSESM      DGDSRLASLEQDG--WQVEYLSYVEQN----GYWL--------PERVKL----HGQD--L
LOLB_BORBR      DAQGRPTAFEQDG--WNARLSRYDA----------------QGPQLLVLQRQEPGRR--I
LOLB_BORPE      DAQGRPTAFEQDG--WNARLSRYDA----------------QGPQLLVLQRQEPGRR--I
LOLB_BORPA      DAQGRPTAFEQDG--WNARLSRYDA----------------QGPQLLVLQRQEPGRR--I
LOLB_RALSO      DAQSRPETIEQNG--WTVHYVAWSDDGDNSTANARVRRLDLDRPQGA------GGAPGPL
LOLB_XANAC      DAAGRPRTVQQDG--WTIDFLAWTPASA--EQPEL--------PQRIEA----RSGE--A
LOLB_XANCP      DEHGRPRTVQQDG--WTIDFLEWTPASA--AQPEL--------PRRIEA----RNGD--A
LOLB_XYLFA      DAEGRPHRVYQRG--WQLRFLDWFPSSVG--RPVL--------PRQIEA----SRGS--A
LOLB_XYLFT      DAEGRPHRVYQGG--WQLRFLDWFPSSVG--RPML--------PRQIEA----SRGS--A
LOLB_NITEU      DKNRRTVAIRQDG--WQVVYQNYYPAQ--EGMSVL--------PRLLEF----SRPD--V
LOLB_ECOLI      QYRLSEITYSQNGKNWKVVYGGYDT----KTQPAM--------PANMEL----TDGG--Q
LOLB_ECO57      QYRLSEITYSQNGKNWKVVYGGYDT----KTQPAM--------PANMEL----TDGG--Q
LOLB_SHIFL      QYRLSEITYSQNGKNWKVVYGGYDT----KTQPAM--------PANMEL----TDGG--Q
LOLB_ECOL6      QYRLSEITYSQNGKNWKVVYGGYDT----KTQPAM--------PANMEL----TDGG--Q
LOLB_SALTI      QYRLSEVNYHQDGKNWKVVYGGYDS----KTQPAM--------PANMEL----SDGS--Q
LOLB_SALTY      QYRLSEVNYRQDGKNWKVVYGGYDS----KTQPAM--------PANMEL----SDGS--Q
LOLB_PHOLL      NYLLKTVNYQQNGATWQVNYQSYDT----STTPAL--------PNRLEL----IQGD--R
LOLB_YERPE      KYRLKKLTYQQNGVTWVVDYQEYNT----QVTPSL--------PSRLEL----NQDG--Q
LOLB_VIBVY      QNTLSSLEKDLNFQRWHIAYTQYRDVEFHQQVVPL--------PAKLSL----TQQD--I
LOLB_VIBVU      QNTLSSLEKDLNFQRWHIAYTQYRDVEFHQQVVPL--------PAKLSL----TQQD--I
LOLB_VIBPA      ANTLQTLDKQIGLNDWKIAYERYGDVEWHEQTLPL--------PNKLKL----TTSD--V
LOLB_VIBCH      QNTLATLTKLASTEEWHVEYQRYQAIEWQHQPIPL--------PDKLKL----QQNK--T
LOLB_AGGAC      NHLLATFSRTIDGKPWTADYLSYHV----NRRPPM--------PENILL----KTEG--Q
LOLB_HAEIN      NHLLGAFTYHVDGSQWTADYLTYHSNN------SM--------PENILL----KNDSTKQ
LOLB_PASMU      NHLLAHFSYPIDNQQWTADYLSYH-----QLPLPL--------PKDILL----KTEG--Q
LOLB_HAEDU      KRQLSQFSYPINQQIWQARYVEYHE----NRVPYL--------PKLIVL----ENGQ--Q
LOLB_SHEON      AGQAKQLQNMQTPPPWLVTFLSWQS----QSGAKV--------PYQLTL----ERGD--L
                               *                                            

LOLB_CHRVO      TVKVVVQSWQ----------------
LOLB_NEIMA      NIRLVFTEIGMPSETETQEQCAARIQ
LOLB_NEIMB      NIRLVFTEIGMPSETETPERCAARTR
LOLB_COXBU      AVKIVVKHWQ----------------
LOLB_PSEAE      DVTLVIKDWQPRQLGR----------
LOLB_PSEPK      DVTLVVKDWQPRQLGH----------
LOLB_PSESM      DVTLVIKDWQPRKLGQ----------
LOLB_BORBR      LVRLVITQ--P---------------
LOLB_BORPE      LVRLVITQ--P---------------
LOLB_BORPA      LVRLVITQ--P---------------
LOLB_RALSO      SVRLVLDQ------------------
LOLB_XANAC      KVRLLVDQWTVSP-------------
LOLB_XANCP      KVRLLVDQWTLSP-------------
LOLB_XYLFA      RIRLIVDQWDELIP------------
LOLB_XYLFT      RIRLIVDQWDELIP------------
LOLB_NITEU      KMRLLVDQWQGETKSGDATGRKLP--
LOLB_ECOLI      RIKLKMDNWIVK--------------
LOLB_ECO57      RIKLKMDNWIVK--------------
LOLB_SHIFL      RIKLKMDNWIVK--------------
LOLB_ECOL6      RIKLKMDNWIVK--------------
LOLB_SALTI      RIKLKMDNWIVK--------------
LOLB_SALTY      RIKLKMDNWIVK--------------
LOLB_PHOLL      RIKLKMDNWTTK--------------
LOLB_YERPE      RIKLKMDSWTIK--------------
LOLB_VIBVY      KLNIVVSKWTLK--------------
LOLB_VIBVU      KLNIVVSKWTLK--------------
LOLB_VIBPA      KINLVITKWNITQ-------------
LOLB_VIBCH      SIQLVISQWTLLP-------------
LOLB_AGGAC      TLKIRVDEWLF---------------
LOLB_HAEIN      TLKIRVDEWIY---------------
LOLB_PASMU      TLKIRIDNWTY---------------
LOLB_HAEDU      TLKIRLDHWNY---------------
LOLB_SHEON      QLKLQLNQWQALGKPSILLGEKP---
                 : : .