CLUSTAL format seed alignment for MF_00235

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KAD_BURP1       ------------------------------------------------------------
KAD_BURPS       ------------------------------------------------------------
KAD_BORPE       ------------------------------------------------------------
KAD_NEIG1       ------------------------------------------------------------
KAD_NEIMB       ------------------------------------------------------------
KAD_CHLTE       ------------------------------------------------------------
KAD_PSEAE       ------------------------------------------------------------
KAD_COXBU       ------------------------------------------------------------
KAD_ECOLI       ------------------------------------------------------------
KAD_SHIDS       ------------------------------------------------------------
KAD_SALTY       ------------------------------------------------------------
KAD_YERPE       ------------------------------------------------------------
KAD_VIBCH       ------------------------------------------------------------
KAD_ALIF1       ------------------------------------------------------------
KAD_SHEON       ------------------------------------------------------------
KAD_HAEIN       ------------------------------------------------------------
KAD_FRATT       ------------------------------------------------------------
KAD_BUCAI       ------------------------------------------------------------
KAD2_CANAL      -----------------MSIEDLKNTVTKLQERIQELEK--KAGIIPDVP----KS----
KAD2_YARLI      ----------------MSTIEDLKATVERLAARVHELEASAKSKIAPEVP----KS----
KAD2_YEAST      ----------------------------------------------MSSS----ES----
KAD2_ASPFU      -----------MAPITEEVVHGLKDMIEKLENRVQELEARLG---GESKPKSIAEQ----
KAD2_EMENI      -----------MAPITDDVVAGLKSTIGKLEARIEDLESRLG---GEPKPKSIAEH----
KAD2_COCIM      -----------MAPTKDETVDSLKSIIRDLEARVVQLEQKLVHGEGSSKVNSLADG----
KAD2_SCLS1      -----------MAPIGDDATQTLHDLVNKLESRVKELEDKLAHAAGGSAP-SSSEG----
KAD2_PHANO      -----------MAPTTDPAVNELKSTVHKLEQRIAELEGRLSGHGGGSSS--AQES----
KAD2_NEUCR      ------------MGFIDDEVKRLGDVIASLEDRVRSLETRDFSGKPVTTA----EQ----
KAD2_SCHPO      -----------------------------------------------------MAG----
KAD2_COPC7      -------------MGASEELEYLKSLVAQLNDKIASLEAKAKGPASK---TPAQQL----
KAD2_USTMA      ------<MKGDTISGGSTELSYLKSLVSQLNDKIAQLESKASSTISSITGSTPSGV----
KAD2_CRYNJ      -------------MSGNSEVEYLKSLVSQLQDKIHHLEKSTSTSVSNTISSVTSALSPSS
KAD2_HUMAN      -------------------------------------MAPSVPAAEP----EYPKG----
KAD2_PONAB      -------------------------------------MAPSVPAAEP----EYPKG----
KAD2_BOVIN      -------------------------------------MAPNVPAAEPV--PESPKG----
KAD2_MOUSE      -------------------------------------MAPNVLASEP----EIPKG----
KAD2_RAT        -------------------------------------MAPNALAPEP----EHPEG----
KAD2_DANRE      -------------------------------------MAPSTQEDDTV--SGIRKG----
KAD2_XENTR      -------------------------------------MAPREAAPAER--GSVMEG----
KAD2_AEDAE      -------------------------------------MAPNAAAVAPKPEQEQATG----
KAD2_ANOGA      -------------------------------------MAPNAAELKVKPASD-STG----
KAD2_DROME      -------------------------------------MAPNAAVPVERYEPE-NIG----
KAD2_DROPS      -------------------------------------MAPNLAVPVERYEPQ-TIG----
KAD2_CAEBR      -------------------MDKKSDFGQIFLVPKTQPAAQPAVTPSTGPSETLARG----
KAD2_CAEEL      -----------------------------MGVPKTQQSAQPA-TQSAGPTETLARG----
KAD4_ARATH      ----------------------MATGGAAA-DLEDVQTVDLMSELLRRLKCSQKPD----
KAD3_ARATH      ----------------------MATSSAASVDMEDIQTVDLMSELLRRMKCASKPD----
KAD3_ORYSJ      ----------------------------MAANLEDVPSMELMTELLRRMKCSSKPD----
KAD4_ORYSJ      --------------------------MAAAANLEDVPSMDLMNELLRRMKCSSKPD----
KAD2_DICDI      -------------------------MEPQFKVKIDNDSARILKELAEKKRDEG-------
KAD_AQUAE       ------------------------------------------------------------
KAD_PROMA       ------------------------------------------------------------
KAD_THET8       ------------------------------------------------------------
KAD_XANCP       ------------------------------------------------------------
KAD_AGRFC       ------------------------------------------------------------
KAD_CAUVC       ------------------------------------------------------------
KAD_FUSNN       ------------------------------------------------------------
KAD_GLOVI       ------------------------------------------------------------
KAD1_SYNY3      ------------------------------------------------------------
KAD_BACAN       ------------------------------------------------------------
KAD_BACCR       ------------------------------------------------------------
KAD_GEOSE       ------------------------------------------------------------
KAD_BACSU       ------------------------------------------------------------
KAD_LISMO       ------------------------------------------------------------
KAD_SPOGL       ------------------------------------------------------------
KAD_ENTFA       ------------------------------------------------------------
KAD_LACPL       ------------------------------------------------------------
KAD_LACLA       ------------------------------------------------------------
KAD_STRR6       ------------------------------------------------------------
KAD_CLOAB       ------------------------------------------------------------
KAD_CLOBH       ------------------------------------------------------------
KAD_MOOTA       ------------------------------------------------------------
KAD_GEOSL       ------------------------------------------------------------
KAD_THEYD       ------------------------------------------------------------
KAD_ARCFU       ------------------------------------------------------------
KAD_THEMA       ------------------------------------------------------------
KAD_METAC       ------------------------------------------------------------
KAD_MYCTU       ------------------------------------------------------------
KAD_MYCS2       ------------------------------------------------------------
KAD_CORGL       ------------------------------------------------------------
KAD_STRCO       ------------------------------------------------------------
KAD_RHOBA       ------------------------------------------------------------
KAD_BIFLO       ------------------------------------------------------------
KAD_SALRD       ------------------------------------------------------------
KAD_THEEB       ------------------------------------------------------------
KAD_BACTN       ------------------------------------------------------------
KAD_FLAPJ       ------------------------------------------------------------
KAD_LEPIN       ------------------------------------------------------------
KAD_PYRFU       ------------------------------------------------------------
KAD_THEKO       ------------------------------------------------------------
KAD_MYCMS       ------------------------------------------------------------
KAD1_ARATH      --------MARLVRVARSSS-----LFGFGNRFYSTSAEASHASSPSPFLHGGGASRVAP
KAD1_SOLTU      --------MAAMIRLFRSSSSSSSNSISLISRSLSTAAASETVKSQS-YPHNPHSTSVDP
KAD_MYCPN       ------------------------------------------------------------
KAD_HALSA       ------------------------------------------------------------
KAD_BORBU       ------------------------------------------------------------
KAD_CHLTR       -----------------------------------------------------------M
KAD3_HUMAN      ---------------------------------------------------------MGA
KAD3_PONAB      ---------------------------------------------------------MGA
KAD3_MOUSE      ---------------------------------------------------------MGA
KAD3_RAT        ---------------------------------------------------------MGA
KAD3_BOVIN      ---------------------------------------------------------MGA
KAD4_HUMAN      -----------------------------------------------------------M
KAD4_PONAB      -----------------------------------------------------------M
KAD4_BOVIN      -----------------------------------------------------------M
KAD4_MOUSE      -----------------------------------------------------------M
KAD4_RAT        -----------------------------------------------------------M
KAD3_YEAST      --------------------------------------------------MKADAKQITH
KADY_CAEEL      ------------------------------------------------------------
KADB_DICDI      -----------------------------------------------MALNLLRNYSTKI
KADC_MAIZE      -----------------------------------------------------------A
KAD2_ARATH      MTGCVNSISPPPVTLYRHRASPSRSSFSLSGDALHSLYRHRRVSRSPSIIAPKFQIVAAE
KAD_CAMJE       ------------------------------------------------------------
KAD_HELPY       ------------------------------------------------------------
KAD1_HUMAN      --------------------------------------------MEEKLKKT--------
KAD1_BOVIN      --------------------------------------------MEEKLKKT--------
KAD1_PIG        --------------------------------------------MEEKLKKS--------
KAD1_RABIT      --------------------------------------------MEEKLKKA--------
KAD1_MOUSE      --------------------------------------------MEEKLKKA--------
KAD1_RAT        --------------------------------------------MEDKLKKA--------
KAD1_CHICK      -------------------------------------------MSTEKLKHH--------
KAD1_CAEEL      --------------------------------------------MAPTVERKNINLAPLK
KCY_YEAST       ------------------------------------------------MTAATTSQPAFS
KCY_SCHPO       ------------------------------------------------------------
KCY_DICDI       ----------------------------------------------------MMEKS---
KCY3_ARATH      --------------------------------------------------MGSVDAANGS
KCY_HUMAN       ------------------------------------------------------------
KCY_MOUSE       ------------------------------------------------------------
KCY_RAT         ------------------------------------------------------------
KCY_BOVIN       ------------------------------------------------------------
KCY_PIG         ------------------------------------------------------------
KCY_CHICK       ------------------------------------------------------------
KCY_XENTR       ------------------------------------------------------------
KCY_DANRE       ------------------------------------------------------------
KCY1_CAEEL      ------------------------------------------------------------
KCY2_CAEEL      ------------------------------------------------------------
                                                                            

KAD_BURP1       ----MRLILLGAPGAGKGTQAN-FIKEKF--GIPQISTGDMLRAAVKA-GTPLGVEAKTY
KAD_BURPS       ----MRLILLGAPGAGKGTQAN-FIKEKF--GIPQISTGDMLRAAVKA-GTPLGVEAKTY
KAD_BORPE       ----MRLILLGPPGAGKGTQAA-FLTQHY--GIPQISTGDMLRAAVKA-GTPLGLEAKKV
KAD_NEIG1       ----MKALLLGAPGAGKGTQAQ-FITAAF--GIPQISTGDMLRAAIKA-GTPLGLEAKKI
KAD_NEIMB       ----MKALLLGAPGAGKGTQAQ-FITAAF--GIPQISTGDMLRAAIKA-GTPLGLEAKKI
KAD_CHLTE       ----MRIILLGAPGAGKGTQAQ-YISEAF--GIPQISTGDMLRAAVKA-ATPLGLAAKKI
KAD_PSEAE       ----MRVILLGAPGAGKGTQAR-FITEKF--GIPQISTGDMLRAAVKA-GSPLGQQVKGV
KAD_COXBU       --MPLRIILLGLPGAGKGTQAD-FIAKHL--DIPKISTGDMLRAAVKA-KTPLGLEVKKI
KAD_ECOLI       ----MRIILLGAPGAGKGTQAQ-FIMEKY--GIPQISTGDMLRAAVKS-GSELGKQAKDI
KAD_SHIDS       ----MRIILLGAPGAGKGTQAQ-FIMEKY--GIPQISTGDMLRAAVKS-GSELGKQAKDI
KAD_SALTY       ----MRIILLGAPGAGKGTQAQ-FIMEKY--GIPQISTGDMLRAAVKS-GSELGKQAKDI
KAD_YERPE       ----MRIILLGAPGAGKGTQAQ-FIMEKY--GIPQISTGDMLRAAVKA-GSELGLKAKEI
KAD_VIBCH       ----MRIILLGAPGAGKGTQAQ-FIMEKF--GIPQISTGDMLRAAIKA-GTELGKQAKAV
KAD_ALIF1       ----MRIILLGAPGAGKGTQAQ-FIMDKY--GIPQISTGDMLRAAIKA-GTELGKQAKSV
KAD_SHEON       ----MRIILLGAPGAGKGTQAQ-FIMEQY--GIPQISTGDMLRAAVKA-GTPLGLEAKKV
KAD_HAEIN       ----MKIILLGAPGAGKGTQAQ-FIMNKF--GIPQISTGDMFRAAIKA-GTELGKQAKAL
KAD_FRATT       ----MRIILLGAPGAGKGTQAK-IIEQKY--NIAHISTGDMIRETIKS-GSALGQELKKV
KAD_BUCAI       ----MRIILLGAPGTGKGTQGK-FITEKY--KIPQISTGDMLRESVVL-KNKIGMIIKNI
KAD2_CANAL      ----VRMVLIGPPGAGKGTQAP-NLKEKF--CACHLATGDMLRAQVAA-KTALGVEAKKI
KAD2_YARLI      ----IRMVLIGPPGAGKGTQAP-NLVEKY--CACHLATGDMLRSQVQQ-QTPLGVEAKKI
KAD2_YEAST      ----IRMVLIGPPGAGKGTQAP-NLQERF--HAAHLATGDMLRSQIAK-GTQLGLEAKKI
KAD2_ASPFU      ----MRIVLMGPPGAGKGTQAP-RLKEKY--CVCHLATGDMLRSQVAK-KTELGKEAKKI
KAD2_EMENI      ----MRIILMGPPGAGKGTQAP-KIKEKY--CVCHLATGDMLRSQVAK-KTDLGREAKKI
KAD2_COCIM      ----MRMVLMGPPGAGKGTQAP-KIKEKY--CICHLATGDMLRSQVQK-QTELGKQAKKI
KAD2_SCLS1      ----IRMILMGPPGAGKGTQAP-KIKEKF--SCCHLATGDMLRSQVAK-KTPLGREAKKI
KAD2_PHANO      ----VRMILMGPPGAGKGTQAP-RIKEKF--CACHLATGDMLRAQVAA-KTPLGREAKKI
KAD2_NEUCR      ----LRMVLMGPPGAGKGTQAP-KIKEKF--NCCHLATGDMLRAQVAK-GTALGKQAKKI
KAD2_SCHPO      ----MRLILVGPPGAGKGTQAP-NIQKKY--GIAHLATGDMLRSQVAR-QTELGKEAKKI
KAD2_COPC7      -----RTILIGPPGAGKGTQAP-RIRDEF--CVCHLATGDMLRDQVEK-KTPLGIAAKKI
KAD2_USTMA      -----RMILIGPPGAGKGTQAP-KILEKFNNCVCHLATGDMLREQVSK-QTELGKMAKKI
KAD2_CRYNJ      SIKPPRMVLIGPPGAGKGTQAP-NISSKY--CICHLATGDMLREQVAR-QTELGKAAKQI
KAD2_HUMAN      ----IRAVLLGPPGAGKGTQAP-RLAENF--CVCHLATGDMLRAMVAS-GSELGKKLKAT
KAD2_PONAB      ----IRAVLLGPPGAGKGTQAP-RLAENF--CVCHLATGDMLRAMVAS-GSELGKKLKAT
KAD2_BOVIN      ----VRAVLLGPPGAGKGTQAP-KLAKNF--CVCHLATGDMLRAMVAS-GSELGKKLKAT
KAD2_MOUSE      ----IRAVLLGPPGAGKGTQAP-KLAENF--CVCHLATGDMLRAMVAS-GSELGKKLKAT
KAD2_RAT        ----IRAVLLGPPGAGKGTQAP-KLAENF--CVCHLATGDMLRAMVAS-GSELGKKLKAT
KAD2_DANRE      ----IRAILLGPPGAGKGTQAP-KLAEKY--CVCHLATGDMLRAMVAS-GSELGQRLKET
KAD2_XENTR      ----IRAILLGPPGAGKGTQAP-KLAEKY--CVCHLATGDMLRAMVAS-GSELGMRLKAT
KAD2_AEDAE      ----INAILLGPPGSGKGTQAP-LLKEKF--CVCHLSTGDMLRAEIAA-GSKLGAQLKKV
KAD2_ANOGA      ----INAILLGPPGSGKGTQAP-LLKEKY--CVCHLSTGDMLRAEIAS-GSKLGAQLKKV
KAD2_DROME      ----INAILLGPPGSGKGTQAP-LLKEKF--CVCHLSTGDMLRAEISS-GSKLGAELKKV
KAD2_DROPS      ----INAILLGPPGSGKGTQAP-LLKEKY--CVCHLSTGDMLRAEISS-GSKLGTELKKV
KAD2_CAEBR      ----IRAIFIGPPGSGKGTQAP-AFASKY--FSCHLATGDLLRAEVAS-GSEFGKQLKAT
KAD2_CAEEL      ----IRAIFIGPPGSGKGTQAP-AFAQKY--FSCHLATGDLLRAEVAS-GSEFGKELKAT
KAD4_ARATH      ----KRLIFIGPPGSGKGTQSP-VVKDEY--CLCHLSTGDMLRAAVAS-KTPLGVKAKEA
KAD3_ARATH      ----KRLVFIGPPGSGKGTQSP-VIKDEF--CLCHLSTGDMLRAAVAA-KTPLGVKAKEA
KAD3_ORYSJ      ----KRVILVGPPGCGKGTQSP-LIKDEF--CLCHLATGDMLRAAVAA-KTPLGIKAKEA
KAD4_ORYSJ      ----KRLILVGPPGSGKGTQSP-IIKDEY--CLCHLATGDMLRAAVAA-KTPLGVKAKEA
KAD2_DICDI      ----LRVVFIGPPGSGKGTQAP-LVKEDY--CLCHLSTGDMLRAAIEQ-GTETGKQAKTI
KAD_AQUAE       ----MILVFLGPPGAGKGTQAK-RLAKEK--GFVHISTGDILREAVQK-GTPLGKKAKEY
KAD_PROMA       --MKNRLLFLGPPGAGKGTQAS-LICKDQ--GFLHLSTGDLLREEVSG-GTDLGKKAELI
KAD_THET8       MDVGQAVIFLGPPGAGKGTQAS-RLAQEL--GFKKLSTGDILRDHVAR-GTPLGERVRPI
KAD_XANCP       ----MRLVLLGPPGSGKGTQAA-RLKDTF--QIPHISTGDLLRAEVAA-GSPLGLKAKEV
KAD_AGRFC       ----MRLIFLGPPGAGKGTQAK-RLTDKY--GIPQLSTGDMLRAAVSA-GTEIGKRAKAV
KAD_CAUVC       ----MNLILFGPPAAGKGTQAK-RLVTER--GMVQLSTGDMLRAAIAS-GSELGQRVKGV
KAD_FUSNN       -MINLNLVLFGAPGAGKGTQAK-FIVDKY--GIPQISTGDILRVAVAN-KTKLGLEAKKF
KAD_GLOVI       -MATRRLMLLGAPGAGKGTQAQ-LLMQEL--GLPQVSTGDILRAAVKE-GTPLGLEAQSY
KAD1_SYNY3      MAMAKGLIFLGAPGSGKGTQAV-GLAETL--GIPHISTGDMLRQAIAD-GTELGNQAKGY
KAD_BACAN       ----MNLILMGLPGAGKGTQAE-QIVAKY--NIPHISTGDMFRAAMKA-ETEMGLQAKSF
KAD_BACCR       ----MNLILMGLPGAGKGTQAE-QIVAKY--NIPHISTGDMFRAAMKA-ETEMGLQAKSF
KAD_GEOSE       ----MNLVLMGLPGAGKGTQAE-KIVAAY--GIPHISTGDMFRAAMKE-GTPLGLQAKQY
KAD_BACSU       ----MNLVLMGLPGAGKGTQGE-RIVEDY--GIPHISTGDMFRAAMKE-ETPLGLEAKSY
KAD_LISMO       ----MKLVLMGLPGAGKGTQAE-QIVEKY--NIPHISTGDMFRAAMKN-NTELGRKAKSF
KAD_SPOGL       ----MNIVLMGLPGAGKGTQAD-RIVEKY--GTPHISTGDMFRAAIQE-GTELGVKAKSF
KAD_ENTFA       ----MNLILMGLPGAGKGTQAE-KIIDTY--GIPHISTGDMFRAAMKN-ETALGLEAKSY
KAD_LACPL       -MSTMNLILMGLPGAGKGTQAQ-KILEDF--DIPHISTGDIFRAAIKN-ETKMGLEAKKY
KAD_LACLA       ----MNLLIMGLPGAGKGTQAE-FIVKNY--GVNHISTGDMFRAAMKN-ETEMGKLAKSF
KAD_STRR6       ----MNLLIMGLPGAGKGTQAA-KIVEQF--HVAHISTGDMFRAAMAN-QTEMGVLAKSY
KAD_CLOAB       ----MKIILLGPPGAGKGTQAK-LISSEF--SIPHISTGDIFRANISG-KTELGMKAKGY
KAD_CLOBH       ----MRIILLGPPGAGKGTQAK-LISEEF--SIPHISTGDIFRANIKE-KTPLGIEAKRY
KAD_MOOTA       ----MRLVLLGPPGAGKGTQAR-EINQRL--AIPHISTGDMFREAIKR-GTPLGRQAEVY
KAD_GEOSL       ----MNLVFLGPPGAGKGTQAN-LLTRTY--EVPQISTGEILRAAVKS-KTPMGVKAKEY
KAD_THEYD       ----MRLVFLGAPGAGKGTQAK-RLVEKY--GIPQISTGDLLRAAVAA-GTPLGKEAKAY
KAD_ARCFU       ----MNLIFLGPPGAGKGTQAK-RVSEKY--GIPQISTGDMLREAVAK-GTELGKKAKEY
KAD_THEMA       --MMAYLVFLGPPGAGKGTYAK-RLQEIT--GIPHISTGDIFRDIVKKENDELGKKIKEI
KAD_METAC       ----MNIILFGPPGAGKGTQAK-KLVDFY--GIPQISTGDILRANVRE-GTELGLAAKAY
KAD_MYCTU       ----MRVLLLGPPGAGKGTQAV-KLAEKL--GIPQISTGELFRRNIEE-GTKLGVEAKRY
KAD_MYCS2       ----MRVVLLGPPGAGKGTQAE-KLSEKL--GIPQISTGDLFRKNIGD-GTPLGLEAKRY
KAD_CORGL       ----MRLVLLGPPGAGKGTQAA-ILSEKL--GIPHISTGDLFRANIGE-GTPLGIEAKQY
KAD_STRCO       ----MRIVLVGPPGAGKGTQAT-RLAETL--HIPHISTGDLFRANISQ-QTELGKLAKSY
KAD_RHOBA       ----MRIVFIGPPGAGKGTQCE-LLSKAL--KVPHIGTGGMLRALEPE-S---GEQIHLR
KAD_BIFLO       ----MRLLIMGPQGVGKGTQAA-LLAEHF--NIPTISTGDIFRYNIKN-KTELGLEAMSY
KAD_SALRD       ----MRLIIFGPPGAGKGTQAG-LLEERH--GITQISTGDILREAMAQ-ETELGQKAKSY
KAD_THEEB       ----MRLILFGGPGSGKGTQAA-ILTTLL--GIPHISTGDILRAERAA-GTLLGQQAQSY
KAD_BACTN       ---MLNIVIFGAPGSGKGTQSE-RIVEKY--GINHISTGDVLRAEIKN-GTELGKTAKGY
KAD_FLAPJ       ---MINIVLFGKPGAGKGTQAE-FLKEKY--NLTHLSTGDIFRFNIKN-ETELGKLAKTF
KAD_LEPIN       ---MKNIIFMGPPGAGKGTQAK-ILCERL--SIPQISTGDILREAVKN-QTAMGIEAKRY
KAD_PYRFU       ----MNILIFGPPGSGKSTQAR-RIVERY--GLTYISSGDLIRKEIAE-GTPLGREMQAY
KAD_THEKO       ----MNILIFGPPGSGKSTHSR-TIMEKY--GLVYISSGDLIRREIER-KSSLGREMEAY
KAD_MYCMS       ----MNIMLLGAPGCGKGTQAE-QLVNKL--NFIQVSTGDLMRKEISL-NTRLGLKCQEY
KAD1_ARATH      KDRNVQWVFLGCPGVGKGTYAS-RLSTLL--GVPHIATGDLVREELAS-SGPLSQKLSEI
KAD1_SOLTU      KAKTVQWVFLGCPGVGKGTYAS-RLSTLL--GVPHIATGDLVRDELKS-SGPLSKQLAEI
KAD_MYCPN       MVMENKFLFLGAPGVGKGTLAK-QVANTT--GLFHLSTGDIFRSVMQE-QGALSQTLAHY
KAD_HALSA       -MSHPNVLLLGAPGAGKGTQSR-RLVDEF--GVEHVTTGDALRANK-T-KDITHLDVEYD
KAD_BORBU       ----MGLVFLGPPGSGKGTISK-IISNEF--KYQHISTGDLFRENILN-STALGQEIKKI
KAD_CHLTR       DRSPLFLIIMGAPGSGKGTQSK-LLASQL--SLLHISSGDLLRDAVSK-DTPLSQEIKSY
KAD3_HUMAN      SARLLRAVIMGAPGSGKGTVSSRITTHFELK---HLSSGDLLRDNMLR-GTEIGVLAKAF
KAD3_PONAB      SARLLRAVIMGAPGSGKGTVSSRITTHFELK---HLSSGDLLRDNMLR-GTEIGVLAKAF
KAD3_MOUSE      SGRLLRAVIMGAPGSGKGTVSSRITKHFELK---HLSSGDLLRQNMLQ-GTEIGVLAKTF
KAD3_RAT        SGRLLRAVIMGAPGSGKGTGSSRITKHFELK---HLSSGDLLRQNMLQ-GTEIAVLAKSF
KAD3_BOVIN      SARLLRAAIMGAPGSGKGTVSSRITKHFELK---HLSSGDLLRDNMLR-GTEIGVLAKTF
KAD4_HUMAN      ASKLLRAVILGPPGSGKGTVCQRIAQNFGLQ---HLSSGHFLRENIKA-STEVGEMAKQY
KAD4_PONAB      ASKLLRAVILGPPGSGKGTVCQRIAQNFGLQ---HLSSGHFLRENIKA-NTEVGEMAKQY
KAD4_BOVIN      ASKLLRAVILGPPGSGKGTVCQRIAQNFGLQ---HLSSGHFLRENIKA-NTEVGDMAKQY
KAD4_MOUSE      ASKLLRAVILGPPGSGKGTVCERIAQNFGLQ---HLSSGHLLRENLKT-GTEVGDVAKQY
KAD4_RAT        ASKLLRAVILGPPGSGKGTVCERIAQNFGLQ---HLSSGHLLRENLKT-NTEVGDVAKQY
KAD3_YEAST      LLKPLRLLLLGAPGSGKGTQTSRLLKQIPQL--SSISSGDILRQEIKS-ESTLGREATTY
KADY_CAEEL      ---MYRVLLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIAR-GTEFGVRAQSF
KADB_DICDI      RMDHLRMTIIGAPGSGKGTQSEKLKKDYNLP---IISTGQILREVSEQ-NTKSGIEIKSK
KADC_MAIZE      LADPLKVMISGAPASGKGTQCE-LIKTKY--QLAHISAGDLLRAEIAA-GSENGKRAKEF
KAD2_ARATH      KSEPLKIMISGAPASGKGTQCE-LITHKY--GLVHISAGDLLRAEIAS-GSENGRRAKEH
KAD_CAMJE       --MKELFLIIGAPGSGKTTDASLIAQADA-TNITHYSTGDLLRAEVAS-GSELGKTIDSF
KAD_HELPY       --MKQLFLIIGAPGSGKTTDAELIAKNNS-ETIAHFSTGDLLRAESAK-KTERGLLIEKF
KAD1_HUMAN      ----KIIFVVGGPGSGKGTQCEKIVQKYG---YTHLSTGDLLRSEVS-SGSARGKKLSEI
KAD1_BOVIN      ----KIIFVVGGPGSGKGTQCEKIVQKYG---YTHLSTGDLLRAEVS-SGSARGKMLSEI
KAD1_PIG        ----KIIFVVGGPGSGKGTQCEKIVQKYG---YTHLSTGDLLRAEVS-SGSARGKMLSEI
KAD1_RABIT      ----KIIFVVGGPGSGKGTQCEKIVHKYG---YTHLSTGDLLRAEVS-SGSARGKKLSEI
KAD1_MOUSE      ----KIIFVVGGPGSGKGTQCEKIVQKYG---YTHLSTGDLLRAEVS-SGSERGKKLSAI
KAD1_RAT        ----KIIFVVGGPGSGKGTQCEKIVQKYG---YTHLSTGDLLRAEVS-SGSSRGKMLSSI
KAD1_CHICK      ----KIIFVVGGPGSGKGTQCEKIVHKYG---YTHLSTGDLLRAEVS-SGSERGKKLQAI
KAD1_CAEEL      AAGVPIFFIVGGPGSGKGTQCDKIVAKYG---LTHLSSGDLLRDEVK-SGSPRGAQLTAI
KCY_YEAST       PDQVSVIFVLGGPGAGKGTQCEKLVKDYS---FVHLSAGDLLRAEQGRAGSQYGELIKNC
KCY_SCHPO       --MYNVIFVLGGPGAGKGTQCDRLAEKFDK--FVHISAGDCLREEQNRPGSKYGNLIKEY
KCY_DICDI       --KPNVVFVLGGPGSGKGTQCANIVRDFG---WVHLSAGDLLRQEQQ-SGSKDGEMIATM
KCY3_ARATH      GKKPTVIFVLGGPGSGKGTQCAYIVEHYG---YTHLSAGDLLRAEIK-SGSENGTMIQNM
KCY_HUMAN       -MKPLVVFVLGGPGAGKGTQCARIVEKYG---YTHLSAGELLRDERKNPDSQYGELIEKY
KCY_MOUSE       -MKPLVVFVLGGPGAGKGTQCARIVEKYG---YTHLSAGELLRDERKNPDSQYGELIEKY
KCY_RAT         -MKPLVVFVLGGPGAGKGTQCARIVEKYG---YTHLSAGELLRDERKNPDSQYGELIEKY
KCY_BOVIN       -MKPQVVFVLGGPGAGKGTQCARIVEKYG---YTHLSAGELLRDERKNPDSQYGELIEKY
KCY_PIG         -MRPKVVFVLGGPGAGKGTQCARIVEKYG---YTHLSAGELLRDERKNPDSQYGELIEKY
KCY_CHICK       -MKPVVVFVLGGPGAGKGTQCARIVEKYG---YTHLSAGDLLRDERKRPGSQYGELIENY
KCY_XENTR       -MKPFVVFVLGGPGAGKGTQCERIVQKYG---YTHLSAGDLLRDERKKPDSQYGELIESY
KCY_DANRE       -MKPQVVFVLGGPGAGKGTQCARIVENYS---YTHLSAGDLLREERSRTDSEFGQLIDSY
KCY1_CAEEL      --MYNVVFVLGPPGSGKGTICTQIHENLG---YVHLSAGDLLRAERERAGSEYGALIEGH
KCY2_CAEEL      --MHNVVFVLGPPGSGKGTICAKIQENLN---YVHLSAGDLLRAERQREGSEFGALIESH
                        . *  . ** *                  :*  .*                 

KAD_BURP1       MDEGKLVPDSLIIGLVKERLKE-ADCA------------NGYLFDGFPRTIAQADAMKEA
KAD_BURPS       MDEGKLVPDSLIIGLVKERLKE-ADCA------------NGYLFDGFPRTIAQADAMKEA
KAD_BORPE       MDAGGLVSDDLIIGLVRDRLTQ-PDCA------------NGYLFDGFPRTIPQADALKSA
KAD_NEIG1       IDEGGLVRDDIIIGMVKERIAQ-DDCK------------NGFLFDGFPRTLAQAEAMVEA
KAD_NEIMB       IDEGGLVRDDIIIGMVKERIAQ-DDCK------------NGFLFDGFPRTLAQAEAMVEA
KAD_CHLTE       MDEGGLVPDDLIISLVKERIAQ-PDCA------------NGCLFDGFPRTLAQAEALRAG
KAD_PSEAE       MDSGGLVSDDIIIALIKERITE-ADCA------------KGFLFDGFPRTIPQAEALKDA
KAD_COXBU       MESGGLVSDEIMIALVKERVKL-PDCH------------KGYLLDGFPRTLAQADALNAA
KAD_ECOLI       MDAGKLVTDELVIALVKERIAQ-EDCR------------NGFLLDGFPRTIPQADAMKEA
KAD_SHIDS       MDAGKLVTDELVIALVKGRIAQ-EDCR------------NGFLLDGFPRTIPQADAMKEA
KAD_SALTY       MDAGKLVTDELVIALVKERIAQ-EDCR------------NGFLLDGFPRTIPQADAMKEA
KAD_YERPE       MDAGKLVTDELVIALVKERITQ-EDCR------------DGFLLDGFPRTIPQADAMKEA
KAD_VIBCH       IDAGQLVSDDIILGLIKERIAQ-ADCE------------KGFLLDGFPRTIPQADGLKEM
KAD_ALIF1       IDAGQLVSDEIILGLVKERIAQ-EDCA------------KGFLLDGFPRTIPQADGLKEN
KAD_SHEON       MDAGQLVSDDLIIGLVKERIAQ-DDCA------------KGFLLDGFPRTIPQADAMAAN
KAD_HAEIN       MDEGKLVPDELTVALVKDRIAQ-ADCT------------NGFLLDGFPRTIPQADALKDS
KAD_FRATT       LDAGELVSDEFIIKIVKDRISK-NDCN------------NGFLLDGVPRTIPQAQELDKL
KAD_BUCAI       IEEGKLVSDEIVCHLIKNRIKK-HDCI------------NGFILDGFPRTIQQALYLSKK
KAD2_CANAL      MDQGGLVSDEIMVNMIKSELENNQECS------------KGFILDGFPRTIPQAEKLDSM
KAD2_YARLI      MDAGGLVSDDIMVNMIRSELENNSKCK------------NGFILDGFPRTIPQAEKLDEM
KAD2_YEAST      MDQGGLVSDDIMVNMIKDELTNNPACK------------NGFILDGFPRTIPQAEKLDQM
KAD2_ASPFU      MDQGGLVSDEIMVNMIKNELDTNSECK------------NGFILDGFPRTVAQAERLDDM
KAD2_EMENI      MDQGGLVSDEIMVNMIKSELENNAECK------------NGFILDGFPRTVAQAERLDEM
KAD2_COCIM      MDQGGLVSDDIMVNMIKHELETNQECR------------NGFILDGFPRTVKQAEKLDEM
KAD2_SCLS1      MDQGGLVSDEIVIGMIKAELETNQECK------------GGFILDGFPRTVVQAERLDAM
KAD2_PHANO      MDAGGLVSDEIMVNMIKTELENNQECA------------KGFILDGFPRTVTQAEKLDGM
KAD2_NEUCR      MNEGGLVSDDIVIGMIKDELENNKECQ------------GGFILDGFPRTVPQAEGLDAM
KAD2_SCHPO      MDQGGLVSDDIVTGMIKDEILNNPECK------------NGFILDGFPRTVVQAEKLTAL
KAD2_COPC7      MDAGGLVSDDIMVNMIKDQLENNEACK------------NGFVLDGFPRTVPQAQKLDGM
KAD2_USTMA      MDQGGLVSDEIMVSMIKDQLETNPSCK------------GGFILDGFPRTTPQAEKLDGM
KAD2_CRYNJ      MDQGGLVSDEIMVGMIKQELEKNAECK------------NGFILDGFPRTVPQASKLDAM
KAD2_HUMAN      MDAGKLVSDEMVVELIEKNLET-PLCK------------NGFLLDGFPRTVRQAEMLDDL
KAD2_PONAB      MDAGKLVSDEMVVELIEKNLET-PLCK------------NGFLLDGFPRTVRQAEMLDDL
KAD2_BOVIN      MDAGKLVSDEMVLELIEKNLET-PPCK------------NGFLLDGFPRTVRQAEMLDDL
KAD2_MOUSE      MDAGKLVSDEMVVELIEKNLET-PSCK------------NGFLLDGFPRTVRQAEMLDDL
KAD2_RAT        MDAGKLVSDEMVVELIEKNLET-PSCK------------NGFLLDGFPRTVKQAEMLDDL
KAD2_DANRE      MDAGKLVSDEMVVELIDNNLDT-PACK------------NGFLLDGFPRTVKQAEMLDDL
KAD2_XENTR      MDAGKLVSDEMVVELIEKNLDT-PPCK------------KGFLLDGFPRTVKQAEMLDEL
KAD2_AEDAE      MDEGKLVSDDLVVDMIDSNLDK-PECK------------NGFLLDGFPRTVVQAEKLDDL
KAD2_ANOGA      MDEGKLVSDELVVDMIDSNLDK-PECR------------NGFLLDGFPRTVVQAEKLDNL
KAD2_DROME      MDAGKLVSDDLVVDMIDSNLDK-PECK------------NGFLLDGFPRTVVQAEKLDTL
KAD2_DROPS      MDAGKLVSDELVVDMIDSNLDK-PECK------------NGFLLDGFPRTVVQAEKLDSL
KAD2_CAEBR      MDAGKLVSDDVVCKLIEQKLEK-PECK------------YGFILDGFPRTSGQAEKLDEI
KAD2_CAEEL      MDAGKLVSDEVVCKLIEQKLEK-PECK------------YGFILDGFPRTSGQAEKLDEI
KAD4_ARATH      MEKGELVSDDLVVGIIDEAMNK-PKCQ------------KGFILDGFPRTVTQAEKLDEM
KAD3_ARATH      MDKGELVSDDLVVGIMDEAMNR-PKCQ------------KGFILDGFPRTVTQAEKLDEM
KAD3_ORYSJ      MDKGELVSDDLVVGIIDEAMKK-TSCQ------------KGFILDGFPRTVVQAQKLDEM
KAD4_ORYSJ      MDKGELVSDDLVVGIIDEAMKK-PSCQ------------KGFILDGFPRTVVQAQKLDEM
KAD2_DICDI      MDQGGLVPDEVMVNMIKENIQT-PECK------------KGFILDGFPRTVPQAEKLDKM
KAD_AQUAE       MERGELVPDDLIIALIEEVFPKHGN----------------VIFDGFPRTVKQAEALDEM
KAD_PROMA       MNKGELVSDEIVISIVEKRLIKYSEG---------------WLLDGFPRNLAQASLLQNL
KAD_THET8       MERGDLVPDDLILELI-----REELA-------------ERVIFDGFPRTLAQAEALDRL
KAD_XANCP       MARGDLVSDEILLGMLEARLGQADVA-------------NGFILDGYPRNVAQANALDSL
KAD_AGRFC       MDAGGLVSDDIVNQIVSERIEAPDCA-------------KGFILDGYPRTVPQAKALADN
KAD_CAUVC       LDRGELVTDEIVIALIEDRLPEAEAA-------------GGAIFDGFPRTVAQAEALDKM
KAD_FUSNN       MDAGQLVPDEIVNGLVAERLAEKDCE-------------KGFIMDGFPRNVAQAKVLDEI
KAD_GLOVI       MNRGALVPDAVVVGLIEDRLARPDAG-------------GGWILDGFPRTPAQAEALDGL
KAD1_SYNY3      MDKGELVPDQLILGLIEERLGHKDAK-------------AGWILDGFPRNVNQAIFLDEL
KAD_BACAN       IDKGALVPDEVTIGIVRERLSQEDCV-------------RGFLLDGFPRTVAQASALEEI
KAD_BACCR       IDKGALVPDEVTIGIVRERLSQDDCV-------------RGFLLDGFPRTVAQASALEEI
KAD_GEOSE       MDRGDLVPDEVTIGIVRERLSKDDCQ-------------NGFLLDGFPRTVAQAEALETM
KAD_BACSU       IDKGELVPDEVTIGIVKERLGKDDCE-------------RGFLLDGFPRTVAQAEALEEI
KAD_LISMO       MDNGDLVPDEVTNGIVRERLSEDDAK-------------DGFLLDGFPRTVEQAQELENI
KAD_SPOGL       MDQGALVPDEVTIGIVRERLSKSDCD-------------NGFLLDGFPRTVPQAEALDQL
KAD_ENTFA       IDKGELVPDEVTNGIVKERLAEPDTD-------------KGFLLDGFPRTLDQAKALDTM
KAD_LACPL       IDAGNLVPDEVTNGIVRDRLAEADTK-------------NGFLLDGYPRNIDQAHALKQI
KAD_LACLA       IDKGELVPDEVTNGIVKERLAQDDIKA------------SGFLLDGYPRTIDQAHALDTM
KAD_STRR6       IDKGELVPDEVTNGIVKERLSQDDIKE------------TGFLLDGYPRTIEQAHALDKT
KAD_CLOAB       MDKGLLVPDELTIDIVKDRISKDDCK-------------SGFLLDGFPRTVNQAEALDKF
KAD_CLOBH       IDNGQLVPDEVTIGIVKDRLTKDDCD-------------NGFLLDGFPRTVAQAEALDEF
KAD_MOOTA       IKGGRLVPDEVTIGLVQERLVQPDCR-------------NGFLLDGFPRTVAQAEALDSW
KAD_GEOSL       MDQGALVPDSVVVGIVEERLASPDCA-------------SGFILDGFPRTVAQADALKQV
KAD_THEYD       MDRGELVPDKVVLGMVKERLSQNDCK-------------KGFILDGFPRNVAQAEALDKM
KAD_ARCFU       MDKGELVPDEVVIGIVKERLQQPDCE-------------KGFILDGFPRTLAQAEALDEM
KAD_THEMA       MERGELVPDELVNEVVKRRLSEKDCE-------------RGFILDGYPRTVAQAEFLDGF
KAD_METAC       MDKGELVPDQVLIGIIKNRLNEADCE-------------KGFILDGYPRTVPQADALEAI
KAD_MYCTU       LDAGDLVPSDLTNELVDDRLNNPDAA-------------NGFILDGYPRSVEQAKALHEM
KAD_MYCS2       LDAGDLVPAELTNRLVEDRIDQPDAA-------------EGFILDGYPRSVEQAGALKDM
KAD_CORGL       IDAGKLVPTDVTARMVASRLAESDAA-------------EGFLLDGFPRTVEQADILANL
KAD_STRCO       MNAGNLVPDEVTIAMAKDRMEQPDAE-------------GGFLLDGFPRNVSQAEALDEL
KAD_RHOBA       IDRGHFAPDDFVLQMVAERLSQPDSR-------------TGYLLDGFPRTQVQASAFDKQ
KAD_BIFLO       TDKGELVPDSLTNKIVKDRLAKEDCK-------------NGWILDGYPRNAAQVTALDEM
KAD_SALRD       IDAGELVPDALVRDLAEQAIADEG-H-------------DDFMLDGYPRTDQQAEWLTEF
KAD_THEEB       MDRGELVPDQVIVDMVANRLQQPDTA-------------AGWLLDGFPRNGAQAAVFEEM
KAD_BACTN       IDQGQLIPDELMIDILASVFDSFKDS-------------KGVIFDGFPRTIAQAEALKKM
KAD_FLAPJ       MDKGDLVPDAVTIKMLESEVDKNQHS-------------KGFLFDGFPRTLAQAAALDTF
KAD_LEPIN       MDAGDLVPDSVVIGIIKDRIREADCK-------------NGFLLDGFPRTVEQAEALDTL
KAD_PYRFU       LARGDLIPDTIVNTLIISKLRRVRKD---------------FIMDGYPRTPEQVIALENY
KAD_THEKO       LSRGDLIPDTIVNTLIISKLRRQREN---------------FILDGYPRTPEQVISLENY
KAD_MYCMS       MNAGKYVPDQIVNQIVSQFLKNTNDK---------------LIFDGYPRTLEQAKSLEQM
KAD1_ARATH      VNQGKLVSDEIIVDLLSKRLEAGEARGE-----------SGFILDGFPRTMRQAEILGDV
KAD1_SOLTU      VNQGKLVSDEIILNLLSKRLESGEAKGE-----------AGFILDGFPRTVRQAEILTEV
KAD_MYCPN       MNQGLYVPDELTNQTFWHFVTTHQNELH-----------KGFILDGYPRTLNQLEFLQSK
KAD_HALSA       TPGAYMDAGELVPDAVVNEIVKTALDDA-----------DGYVLDGYPRNESQTEYLDSI
KAD_BORBU       VERGELVPDLITIKIVEDKIKAIKKN-------------KDFILDGFPRNICQAEALDKF
KAD_CHLTR       LDQGKLLPDTLVWKLVHEKLDEFQQDTLLRRLSFLSRSENSAILDGFPRTVTQAKLLHEF
KAD3_HUMAN      IDQGKLIPDDVMTRLALHELK--------------NLTQYSWLLDGFPRTLPQAEALDR-
KAD3_PONAB      IDQGKLIPDDVMTRLALHELK--------------NLTQYSWLLDGFPRTLPQAEALDR-
KAD3_MOUSE      IDQGKLIPDDVMTRLALHELK--------------TLTQCSWLLDGFPRTLPQAEALDK-
KAD3_RAT        IDQGKLIPDDDMTRLALHELK--------------NLTQCSWLLDGFPRTLPQAEALDR-
KAD3_BOVIN      IDQGKLIPDDVMTRLVLHELK--------------NLTQYNWLLDGFPRTLPQAEALDR-
KAD4_HUMAN      IEKSLLVPDHVITRLMMSELE--------------NRRGQHWLLDGFPRTLGQAEALDK-
KAD4_PONAB      IEKSLLVPDHVITRLMMSELE--------------NRRGQHWLLDGFPRTLGQAEALDK-
KAD4_BOVIN      IEKGLLVPDHVITRLMLLELE--------------NRRGEHWLLDGFPRTLVQAEALDR-
KAD4_MOUSE      LEKGLLVPDHVITRLMMSELE--------------TRSAQHWLLDGFPRTLVQAEALDG-
KAD4_RAT        LEKGLLVPDHVITRLMMSELE--------------TRSAQHWLLDGFPRTLVQAEALDR-
KAD3_YEAST      IAQGKLLPDDLITRLITFRLSA----------LGWLKPSAMWLLDGFPRTTAQASALDEL
KADY_CAEEL      LNKGEHVPDSILNGAILAEM---------------LKAGPRVVLDGYPRNMSQLKMVEE-
KADB_DICDI      LAAGELISDAIMSDIITEHLT---------------KTGNSWLLDGYPRNTEQAKGLDKY
KADC_MAIZE      MEKGQLVPDEIVVNMVKERLRQPDAQE------------NGWLLDGYPRSYSQAMALETL
KAD2_ARATH      MEKGQLVPDEIVVMMVKDRLSQTDSEQ------------KGWLLDGYPRSASQATALKGF
KAD_CAMJE       ISKGNLVPLDVVINTIVYALKAAPTK--------------TIIIDGYPRSVEQMMEFDKV
KAD_HELPY       TSQGELVPLEIVVETILSAIKSSGKG--------------IILIDGYPRSVEQMQALDKE
KAD1_HUMAN      MEKGQLVPLETVLDMLRDAMVAKVNT------------SKGFLIDGYPREVQQGEEFERR
KAD1_BOVIN      MEKGQLVPLETVLDMLRDAMVAKVDT------------SKGFLIDGYPREVQQGEEFERR
KAD1_PIG        MEKGQLVPLETVLDMLRDAMVAKVDT------------SKGFLIDGYPREVKQGEEFERK
KAD1_RABIT      MEKGQLVPLETVLDMLRDAMVAKADT------------SKGFLIDGYPRQVQQGEEFERR
KAD1_MOUSE      MEKGELVPLDTVLDMLRDAMLAKVDS------------SNGFLIDGYPREVKQGEEFEQK
KAD1_RAT        MEKGELVPLETVLDMLRDAMLAKVDS------------SNGFLIDGYPREVKQGEEFERK
KAD1_CHICK      MEKGELVPLDTVLDMLRDAMLAKADT------------SKGFLIDGYPREVKQGEEFEKK
KAD1_CAEEL      MESGALVPLEVVLDLVKEAMLKAIEKG-----------SKGFLIDGYPREVAQGQQFESE
KCY_YEAST       IKEGQIVPQEITLALLRNAISDNVKANKH---------K--FLIDGFPRKMDQAISFERD
KCY_SCHPO       IKDGKIVPMEITISLLETKMKECHDKGID---------K--FLIDGFPREMDQCEGFEKS
KCY_DICDI       IKNGEIVPSIVTVKLLKNAIDANQGKN--------------FLVDGFPRNEENNNSWEEN
KCY3_ARATH      IKEGKIVPSEVTIKLLQKAIQENGNDK--------------FLIDGFPRNEENRAAFEKV
KCY_HUMAN       IKEGKIVPVEITISLLKREMDQTMAANAQ---------KNKFLIDGFPRNQDNLQGWNKT
KCY_MOUSE       IKEGKIVPVEITISLLKREMDQTMAANAQ---------KNKFLIDGFPRNQDNLQGWNKT
KCY_RAT         IKEGKIVPVEITISLLKREMDQTMAANAQ---------KNKFLIDGFPRNQDNLQGWNKT
KCY_BOVIN       IKDGKIVPVEITISLLRREMDQTMAANAQ---------KNKFLIDGFPRNQDNLQGWNKT
KCY_PIG         IKDGKIVPVEITISLLRREMDQTMAANAQ---------KNKFLIDGFPRNQDNLQGWNKT
KCY_CHICK       IKEGEIVPVEITISLLKRAMDQTMAANSQ---------KNKFLIDGFPRNEDNLQGWNKT
KCY_XENTR       IRDGRIVPVEITISLLQRAMEQTMALDGN---------KHKFLIDGFPRNEDNLQGWERT
KCY_DANRE       IKEGKIVPVQITINLLRKAMEETMKADEK---------KFRFLIDGFPRNQDNLQGWNTE
KCY1_CAEEL      IKNGSIVPVEITCALLENAMIASKDANG-------------FLIDGFPRNEDNWSGWNKQ
KCY2_CAEEL      IKNGSIVPVEITCSLLENAMKACGDAKG-------------FLVDGFPRNEDNLQGWNKQ
                   .                                      :.** **   :       

KAD_BURP1       G-----VAIDYVLEIDVPF-SEIIERMSGRRTHPASGRTYHVKFNPPKVEGKDDVT----
KAD_BURPS       G-----VAIDYVLEIDVPF-SEIIERMSGRRTHPASGRTYHVKFNPPKVEGKDDVT----
KAD_BORPE       G-----IALDYVVEIEVPE-SDIIERMSERRVHPASGRSYHVRFNPPKAEGVDDVT----
KAD_NEIG1       G-----VGLDAVVEIDVSD-SVIVDRMSGRRVHLASGRTYHVTYNPPKTEGKDDVT----
KAD_NEIMB       G-----VDLDAVVEIDVPD-SVIVDRMSGRRVHLASGRTYHVTYNPPKVEGKDDVT----
KAD_CHLTE       G-----IRIDHIIEMNVPD-EEIIKRMSGRRVHLASGRTYHVTFNPPAVPDKDDLT----
KAD_PSEAE       G-----VTIDHVVEIAVDD-EEIVSRIAGRRVHPASGRVYHTEHNPPKVAGKDDVT----
KAD_COXBU       A-----IKIDLVIEIDVPE-EEIIERMTGRLIHPASGRTYHRRYNPPKVADKDDVT----
KAD_ECOLI       G-----INVDYVLEFDVPD-ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVT----
KAD_SHIDS       G-----INVDYVLEFDVPD-ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVT----
KAD_SALTY       G-----IVVDYVLEFDVPD-ELIVDRIVGRRVHAASGRVYHVKFNPPKVEGKDDVT----
KAD_YERPE       G-----IKVDYVLEFDVPD-ELIVERIVGRRVHAASGRVYHVKFNPPKVEDKDDVT----
KAD_VIBCH       G-----INVDYVIEFDVAD-DVIVERMAGRRAHLPSGRTYHVVYNPPKVEGKDDVT----
KAD_ALIF1       G-----VSIDYVLEFDVAD-EVIVERMSGRRAHLPSGRTYHVVYNPPKEEGKDDET----
KAD_SHEON       G-----ISIDHVIEIDVPD-EEIVKRMSGRRVHPGSGRVYHVVFNPPKVEGKDDVT----
KAD_HAEIN       G-----VKIDFVLEFDVPD-EVIVERMSGRRVHQASGRSYHIVYNPPKVEGKDDVT----
KAD_FRATT       G-----VNIDYIVEVDVAD-NLLIERITGRRIHPASGRTYHTKFNPPKVADKDDVT----
KAD_BUCAI       N-----IKIDYVLEFIIPH-EYILERISGRRIHIQSGRIYHVKFKPPKIKDKDDLT----
KAD2_CANAL      LESR-KTPLEKAVELKIDD-ELLVARITGRLVHPASGRSYHKLFNPPKKDMTDDVT----
KAD2_YARLI      LAEK-KQPLEKAVELKIPD-DLLVARITGRLVHPASGRSYHKVFNPPKKEMIDDIT----
KAD2_YEAST      LKEQ-GTPLEKAIELKVDD-ELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVT----
KAD2_ASPFU      LEAR-NQKLQHAIELQIDD-ALLVARITGRLVHPASGRSYHKIFNPPKNDMKDDVT----
KAD2_EMENI      LVAR-NQKLQHAIELKIDD-ALLVARITGRLVHPASGRSYHKIFNPPKEAMKDDIT----
KAD2_COCIM      LNAR-HQKLQHAVELRIDD-ELLVSRITGRLIHPASGRSYHKIFNPPKVPMTDDIT----
KAD2_SCLS1      LSAR-NQKLQHAVELQIDD-SLLVSRITGRLVHPASGRSYHRVFNPPKAEMKDDIT----
KAD2_PHANO      LEAT-QKPLQHAVELQIDD-QLLVSRITGRLVHPASGRSYHKIFNPPKAPMTDDAT----
KAD2_NEUCR      LRER-NLPLQHAVELKIDD-SLLVARITGRLVHPASGRSYHRIFNPPKDDMKDDIT----
KAD2_SCHPO      LDEL-KLDLNTVLELQVDD-ELLVRRITGRLVHPGSGRSYHLEFNPPKVPMKDDVT----
KAD2_COPC7      LAER-KEKLDSVVQLLIDD-QLLISRITGRLIHPASGRSYHKIFNPPKKAGIDDLT----
KAD2_USTMA      LKQK-NQKLDHAVELKIND-NLLISRITGRLVHPASGRSYHKEFSPPKKPMTDDVT----
KAD2_CRYNJ      LAER-KQAIDHAIELKIPD-VLLISRITGRLVHPASGRSYHKEFNPPKKPMTDDIT----
KAD2_HUMAN      MEKR-KEKLDSVIEFSIPD-SLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDIT----
KAD2_PONAB      MEKR-KEKLDSVIEFSIPD-SLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDIT----
KAD2_BOVIN      MEKR-KEKLDSVIEFSIPD-SLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDIT----
KAD2_MOUSE      MEKR-KEKLDSVIEFSIQD-SLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDIT----
KAD2_RAT        MDKR-KEKLDSVIEFSIQD-SLLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDIT----
KAD2_DANRE      MEKR-SEKLDSVIEFSVDD-SLLVRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVT----
KAD2_XENTR      LEKR-QEKLDSVIEFKVDD-SLLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDVT----
KAD2_AEDAE      LEKR-KTGLDAVVEFGIDD-SLLVRRITGRLIHQASGRSYHEEFAPPKVAMTDDVT----
KAD2_ANOGA      LEKR-NTGLDAVIEFGIDD-SLLVRRITGRLIHQASGRSYHEEFAPPKVPMRDDET----
KAD2_DROME      LDKR-KTNLDAVIEFAIDD-SLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVT----
KAD2_DROPS      LDKR-KANLDAVIEFAIDD-SLLVRRITGRLIHQASGRSYHEEFAPPKVTMKDDIT----
KAD2_CAEBR      LERR-KTPLDTVVEFNIAD-DLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLT----
KAD2_CAEEL      LERR-KTPLDTVVEFNIAD-DLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLT----
KAD4_ARATH      LKRR-GTEIDKVLNFAIDD-AILEERITGRWIHPSSGRSYHTKFAPPKTPGVDDIT----
KAD3_ARATH      LNRR-GAQIDKVLNFAIDD-SVLEERITGRWIHPSSGRSYHTKFAPPKVPGVDDLT----
KAD3_ORYSJ      LAKQ-GTKIDKVLNFAIDD-AILEERITGRWIHPSSGRSYHTKFAPPKTPGLDDVT----
KAD4_ORYSJ      LEKK-GTKVDKVLNFAIDD-SILEERITGRWIHPSSGRSYHTKFAPPKVPGVDDVT----
KAD2_DICDI      LAED-NKKIDHVLDFAIDD-SLLVKRITGRLVHPSSGRSYHREFFPPKVDMIDDIT----
KAD_AQUAE       LEKK-GLKVDHVLLFEVPD-EVVIERLSGRRINPETGEVYHVKYNPPPP-----------
KAD_PROMA       LGRI-SQPIEIVLLIEIDD-EILTERMLGR------------------------------
KAD_THET8       LSET-GTRLLGVVLVEVPE-EELVRRILRRAELE--------------------------
KAD_XANCP       LSKI-GQPLDAVVQLDVAS-ELLVERIAGRAKAE--------------------------
KAD_AGRFC       MRKK-NQVLDAVIELKVDE-EALIRRIENRVAETIA------------------------
KAD_CAUVC       LAAR-GQKIDVVLRLKVDE-PALIERIKKRFEEQ--------------------------
KAD_FUSNN       LTKL-GKQIEKVIALNVPD-KDIIERITGRRTSKVTGKIYHIKFNPPVDEKP--------
KAD_GLOVI       LAHL-AQSLEAVVLIDVPE-AQLIERLTGRRTCPLCKRIFHVRFNPPPAAPPFCTDHT--
KAD1_SYNY3      LVNI-GHRTHWVINLKVPD-EVIVERLLARG-----------------------------
KAD_BACAN       MKDL-GKKIDYVLNINVDS-GLLLKRLTGRRICKECGATYHLEFNAPAKADVCDKC----
KAD_BACCR       MKDL-GKKIDYVLNINVDS-GLLLKRLTGRRICKECGATYHLEFNPPAKADVCDKC----
KAD_GEOSE       LADI-GRKLDYVIHIDVRQ-DVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKC----
KAD_BACSU       LEEY-GKPIDYVINIEVDK-DVLMERLTGRRICSVCGTTYHLVFNPPKTPGICDKD----
KAD_LISMO       LSDL-GTELDAVINIDVEK-DVLMKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLD----
KAD_SPOGL       LADM-GRKIEHVLNIQVEK-EELIARLTGRRICKVCGTSYHLLFNPPQVEGKCDKD----
KAD_ENTFA       LKEL-NKKIDAVIDIHVEE-DVLIERLAGRFICRTCGATYHKLFNPPKVEGTCDRCG---
KAD_LACPL       GEEL-NKPLDGVINIHVEP-AVLVERLSGRFICRTCGATYHKLYNKPKVEGTCDVCG---
KAD_LACLA       LEEL-GIKLDAVVNIVVNP-DILVDRLSGRYICRNCGATYHKIFNPTKVEGVCDVCG---
KAD_STRR6       LAEL-GIELEGIINIEVNP-DSLLERLSGRIIHRVTGETFHKVFNPPVDYK---------
KAD_CLOAB       LVGR-KEKIDCALLIDVPR-EKIFNRMTGRRVCSKCGASYHIEYNPTKVEGICDLC----
KAD_CLOBH       LKGI-NKELDVALLIKVPE-EFILERMTGRRVCTSCGASYHIRFNPPKIEGKCDIC----
KAD_MOOTA       LSSR-GERLDAVIDIEVPR-DALLERLTGRRVCRQCGATYHVRYNPPAVPGKCDAC----
KAD_GEOSL       LGAL-GKQIEHVVSFEVDK-GVLLERIVGRRVCRACGRAFHVKFDPPLVDGVCDAC----
KAD_THEYD       LSEM-NMPLDLALNLDVPF-DDLMKRLTGRRTCKSCGQMYNVYYSPSKVEGKCDKC----
KAD_ARCFU       LKEL-NKKIDAVINVVVPE-EEVVKRITYRRTCRNCGAVYHLIYAPPKEDNKCDKC----
KAD_THEMA       LKTQ-NKELTAAVLFEVPE-EVVVQRLTARRICPKCGRIYNLISLPPKEDELCDDC----
KAD_METAC       LDEI-EKPIDVVLNLEVPD-EVLVGRISGRLMC-KCGASYHIISNPPKKDNVCDIC----
KAD_MYCTU       LERR-GTDIDAVLEFRVSE-EVLLERLKGRG-----------------------------
KAD_MYCS2       LAAR-NTKLDAVLEFQVSE-DELLTRLKGRG-----------------------------
KAD_CORGL       LSEA-GQTLDGVVNYQVSE-DVVVERMLSRG-----------------------------
KAD_STRCO       LETE-GMKLDAVLDLEAPE-DEVVKRIAGRRVCRNEPKHVFHVTYTPPKKEGVCDVC---
KAD_RHOBA       LVAA-SLKLDHVLHLQVSA-DVLIERLRKRG-----------------------------
KAD_BIFLO       LADL-DTPLDHVVALEAAR-DVLLERMKKRAAEQ--------------------------
KAD_SALRD       LASN-ETPLDGVLSMKVPD-DVLVRRLSRRRVHEETGETYHLDHDPPPE-----DVD---
KAD_THEEB       LKSI-HQDYDYLLFLDVPA-AILQERALNRAKQAVNGQ----------------------
KAD_BACTN       LAER-GQDVSVMLDLEVPE-DELMVRLIKRGKDS--------------------------
KAD_FLAPJ       LASK-DQEVTATIALEADD-EILVQRLLERGKTS--------------------------
KAD_LEPIN       LKNE-GKSIDKAINLQVPD-AELLKRLLGRAEIE--------------------------
KAD_PYRFU       LYDH-GIKIDVAIDIYVSL-EESIRRVSGRRICPKCGAVYHVEFNPPKIPGRCDVC----
KAD_THEKO       LFDH-GIKLDLALEIFIDE-DTSVERISGRRICPNCGAVYHVKYNPPKVPGICDVC----
KAD_MYCMS       LDLY-NKKIDYVFYIDVND-QILIKRITNRLVCPLCKASFNLETRKPKQEGLCDFD----
KAD1_ARATH      T------DIDLVVNLKLPE-EVLVDKCLGRRTCSQCGKGFNVAHINLKGENGRPGISMDP
KAD1_SOLTU      T------DIDLVVNLKLPE-RVLVEKCLGRRICSECGKNFNVASIDVAGENGAPRISMAR
KAD_MYCPN       L------QLDQVFHLKLSDPQVLVARILNRLVCPSCGSVYNKQSKPPLKANQCDRC----
KAD_HALSA       T------DLDVVLYLDVDE-DELVGRLTGRRVCEDCGATFHVSFNQPETEGVCDAC----
KAD_BORBU       L-------PNVKIINFLIDEELVIKRLSGRRICKSCNNIFNIYTLTTKKNGICDVC----
KAD_CHLTR       LSSY-FPNYKVILLDISDE--EVLNRLTSRYICPACQGIYNEQQGFSSCPKC--------
KAD3_HUMAN      -----AYQIDTVINLNVPF-EVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLT----
KAD3_PONAB      -----AYQIDTVINLNVPF-EVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLT----
KAD3_MOUSE      -----VYQIDTVINLNVPF-EVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLT----
KAD3_RAT        -----VYQIDTVINLNVPF-EVIKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLT----
KAD3_BOVIN      -----AYQIDTVINLNVPF-EVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLT----
KAD4_HUMAN      -----ICEVDLVISLNIPF-ETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVT----
KAD4_PONAB      -----ICEVDLVISLNIPF-ETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVT----
KAD4_BOVIN      -----LCDLDLVITLNIPF-ETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGMDDVT----
KAD4_MOUSE      -----ICDVDLVISLNIPF-ETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDIT----
KAD4_RAT        -----ICDVDLVISLNIPF-ETLKDRLSRRWIHPSSGRVYNLDFNPPQVLGVDDIT----
KAD3_YEAST      LKQH-DASLNLVVELDVPE-STILERIENRYVHVPSGRVYNLQYNPPKVPGLDDIT----
KADY_CAEEL      -----QAPLNLIVELKVPR-KVLIDRLSKQLVHPASGRAYNLEVNPPKEEGKDDIT----
KADB_DICDI      LNV--KMALNVVLHLDVPE-KVLAERVQDRWVHPGSGRVYNSVFSPPKVKGIDDVT----
KADC_MAIZE      E-----IRPDTFILLDVPD-ELLVERVVGRRLDPVTGKIYHLKYSPPENEE---------
KAD2_ARATH      G-----FQPDLFIVLEVPE-EILIERVVGRRLDPVTGKIYHLKYSPPETEE---------
KAD_CAMJE       LSEQNEICLKGVIEVRVSE-EVAKERVLGR------------------------------
KAD_HELPY       LNAQNEVILKSVIEVEVSE-NTAKERVLGR------------------------------
KAD1_HUMAN      IG-----QPTLLLYVDAGP-ETMTQRLLKRGETS--------------------------
KAD1_BOVIN      IA-----QPTLLLYVDAGP-ETMTKRLLKRGETS--------------------------
KAD1_PIG        IG-----QPTLLLYVDAGP-ETMTKRLLKRGETS--------------------------
KAD1_RABIT      IA-----QPTLLLYVDAGP-ETMQKRLLKRGETS--------------------------
KAD1_MOUSE      IG-----QPTLLLYVDAGA-ETMTQRLLKRGETS--------------------------
KAD1_RAT        IA-----QPTLLLYVDAGP-ETMTQRLLKRGETS--------------------------
KAD1_CHICK      IA-----PPTLLLYVDAGK-ETMVKRLLKRGETS--------------------------
KAD1_CAEEL      IQ-----EAKLVLFFDVAE-ETLVKRLLHRAQTS--------------------------
KCY_YEAST       IV-----ESKFILFFDCPE-DIMLERLLERGKTS--------------------------
KCY_SCHPO       VC-----PAKFALYFRCGQ-ETMLKRLIHRGKTS--------------------------
KCY_DICDI       MKDF--VDTKFVLFFDCPE-EVMTQRLLKRGESS--------------------------
KCY3_ARATH      TE----IEPKFVLFFDCPE-EEMEKRLLGRNQ----------------------------
KCY_HUMAN       MDGK--ADVSFVLFFDCNN-EICIERCLERGKSS--------------------------
KCY_MOUSE       MDGK--ADVSFVLFFDCNN-EICIERCLERGKSS--------------------------
KCY_RAT         MDGK--ADVSFVLFFDCNN-EICIDRCLERGKSS--------------------------
KCY_BOVIN       MDGK--ADVSFVLFFDCNN-EICIERCLERGKSS--------------------------
KCY_PIG         MDGK--ADVSFVLFFDCNN-EICIERCLERGKSS--------------------------
KCY_CHICK       MDGK--ADVSFVLFFDCDN-EICIGRCLERGKSS--------------------------
KCY_XENTR       MNGK--ADVSFVLFFDCDN-ETCIERCLERGKSS--------------------------
KCY_DANRE       MDGK--ADVKFVLFFDCSN-EVCIDRCLERGKSS--------------------------
KCY1_CAEEL      MGGK--VNEQFVLFLSCPV-DVCIDRCLHRGQ----------------------------
KCY2_CAEEL      MDGK--ALVQFVLFLSCPV-SICIERCLNRGQ----------------------------
                            .            :   :                              

KAD_BURP1       -------GEPLVQRDDD-KEETVKKRLDVYEAQTKPLITYYGDWARRGAENGLKAPAYRK
KAD_BURPS       -------GEPLVQRDDD-KEETVKKRLDVYEAQTKPLITYYGDWARRGAENGLKAPAYRK
KAD_BORPE       -------GEPLVQRDDD-REETVRHRLNVYQNQTRPLVDYYSSWAQSDAA---AAPKYRK
KAD_NEIG1       -------GEDLIQRDDD-KEETVKKRLAVYHEQTEVLVDFYSKLE------GEHAPKYIK
KAD_NEIMB       -------GEDLIQRDDD-KEETVKKRLAVYHEQTEVLVDFYSKLE------GEHAPKYIK
KAD_CHLTE       -------GEPLVQRNDD-CEETVRKRLKAYHELTEPLVGYYRNLSM---NGSADAPKYSR
KAD_PSEAE       -------GEELIQREDD-KEETVRHRLSVYHSQTKPLVDFYQKLS-----AAEGTPKYHS
KAD_COXBU       -------GEPLIQRADD-REETVRHRLAVYRKQTSPLSDYYAQWEK---SGDPQAPKYFR
KAD_ECOLI       -------GEELTTRKDD-QEETVRKRLVEYHQMTAPLIGYYSKEAE------AGNTKYAK
KAD_SHIDS       -------GEELTTRKDD-QEETVRKRLVEYHQMTAPLIGYYSKEAE------AGNTKYAK
KAD_SALTY       -------GEDLTTRKDD-QEETVRKRLVEYHQMTAPLIGYYQKEAE------AGNTKYAK
KAD_YERPE       -------GEELTIRKDD-QEATVRKRLIEYHQQTAPLVSYYHKEAD------AGNTQYFK
KAD_VIBCH       -------GEDLVIREDD-KEETVRARLNVYHTQTAPLIEYYGKEAA------AGKTQYLK
KAD_ALIF1       -------GEPLVIREDD-KPETVLARLGIYHEQTAPLIAYYNKEAE------AGNTKYLK
KAD_SHEON       -------GEDLAIRPDD-EEATVRKRLGIYHEQTKPLVEYYGKVAA------AGNTQYHK
KAD_HAEIN       -------GEDLIIRADD-KPETVLDRLAVYHKQTSPLIDYYQAEAK------AGNTQYFR
KAD_FRATT       -------GEPLITRTDD-NEDTVKQRLSVYHAQTAKLIDFYRNFSS----TNTKIPKYIK
KAD_BUCAI       -------GQTLITRKDD-TKEGIKKRLEEYKKVHDPLVQYYIHEKK------RGNIKFFQ
KAD2_CANAL      -------GEPLVQRSDD-NEDALKKRLVTYHKQTEPIVAYYQKTGI-----------WSG
KAD2_YARLI      -------GEALVQRSDD-NADALKKRLVSFHKQTEPIVGYYQKTGI-----------WKG
KAD2_YEAST      -------GEALVQRSDD-NADALKKRLAAYHAQTEPIVDFYKKTGI-----------WAG
KAD2_ASPFU      -------GEPLIQRSDD-NAETLKKRLSTYHAQTAPVVEYYKKTGI-----------WRG
KAD2_EMENI      -------GEPLVQRSDD-NAEALKKRLVTYHAQTAPVCDYYKKTGI-----------WRG
KAD2_COCIM      -------GEPLIQRSDD-NVEALKKRLVTYHSQTAPVVGYYKSTGI-----------WKG
KAD2_SCLS1      -------GEPLVSRSDD-NAEALKKRLVTYHDQTAPVVGYYQKTGI-----------WSG
KAD2_PHANO      -------GEPLIQRSDD-NEETLKKRLSTYHAQTSPVVAYYQKTGI-----------WKP
KAD2_NEUCR      -------GEPLVQRSDD-NAEALRKRLETYHKQTAPVVGYYQNTGI-----------WKA
KAD2_SCHPO      -------GEPLIQRSDD-NADALRKRLVTYHEQTTPVVEFYKKKGK-----------WAA
KAD2_COPC7      -------GEPLIQRSDD-NAETLTRRLKTYHTQTGPVVDYYKAKGL-----------WHG
KAD2_USTMA      -------GEPLIQRSDD-NAETLKKRLATYHAQTAAVTDYYRKQGI-----------WAP
KAD2_CRYNJ      -------GEPLIQRSDD-NVGTLRKRLDTYHAQTGPVVDYYKGTGV-----------WTP
KAD2_HUMAN      -------GEPLIRRSDD-NEKALKIRLQAYHTQTTPLIEYYRKRGI-----------HSA
KAD2_PONAB      -------GEPLIRRSDD-NEKALKIRLQAYHTQTTPLIEYYRKRGI-----------HSA
KAD2_BOVIN      -------GEPLIRRSDD-NKKALKIRLEAYHTQTTPLVEYYSKRGI-----------HSA
KAD2_MOUSE      -------GEPLIRRSDD-NEKALKTRLEAYHTQTTPLVEYYRKRGI-----------HCA
KAD2_RAT        -------GEPLIRRSDD-NEKALKTRLEAYHTQTTPLVEYYRKRGI-----------HCA
KAD2_DANRE      -------GEPLIRRSDD-NETTLRSRLESYHRQTSPLVQYYSARGL-----------HTA
KAD2_XENTR      -------GEPLMRRSDD-NETTLKSRLEAYHTMTSPLVEYYQRHGI-----------HTA
KAD2_AEDAE      -------GEPLMRRSDD-NAAALVKRLEAYHKQTKPLADYYALRGL-----------HFR
KAD2_ANOGA      -------GEPLMRRSDD-NAQALVKRLESYHRQTKPLADYYALRGL-----------HFR
KAD2_DROME      -------GEPLIRRSDD-NAEALKKRLEAYHKQTKPLVDYYGLRGL-----------HFK
KAD2_DROPS      -------GEPLMRRSDD-NAEALKKRLESYHKQTRPLVDYYGLRGL-----------HYK
KAD2_CAEBR      -------GEPLIRRSDD-NEETLRKRLVQYHQMTVPLVDYYQKHGV-----------HVK
KAD2_CAEEL      -------GEPLIRRSDD-NEETLRKRLVQYHQMTVPLVDYYKKHGV-----------HVA
KAD4_ARATH      -------GEPLIQRKDD-NADVLKSRLAAFHSQTQPVIDYYAKKAV-----------LTN
KAD3_ARATH      -------GEPLIQRKDD-NADVLRSRLDAFHKQTQPVIDYYAKKEN-----------LVN
KAD3_ORYSJ      -------GEPLIQRKDD-TAAVLKSRLEAFHVQTKPVIDYYTKKGI-----------VAN
KAD4_ORYSJ      -------GEPLIQRKDD-TAEVLKSRLEAFHKQTEPVIDYYSKKAL-----------VAN
KAD2_DICDI      -------GEPLIQRSDD-NEEVLKKRLESFHKNTTPVLGYYQNKGI-----------LST
KAD_AQUAE       -------GVKVIQREDD-KPEVIKKRLEVYREQTAPLIEYYKKKGI-----------LRI
KAD_PROMA       ------------GRKDD-NKAVIKNRLKIYKDQTSPLVDHYKKQGI-----------LKS
KAD_THET8       ------------GRSDD-NEETVRRRLEVYREKTEPLVGYYEARGV-----------LKR
KAD_XANCP       ------------GREDD-NPESVRKRLQVYTDSTAPVIGFYEQRGK-----------LAR
KAD_AGRFC       --------AGGTVRSDD-NPEAFRKRLTEYREKTAPLSAYYSEQGE-----------LVT
KAD_CAUVC       ------------GRPDD-NPEVFVTRLAAYNAQTAPLLPYYEGQGK-----------LTE
KAD_FUSNN       --------EDLVQRADD-TEEVVVKRLETYHNQTAPVLDYYKVQNK-----------VTE
KAD_GLOVI       -----DCPSELVQRPDD-TLEVVSKRLNVYRESTEPLIRYYQEQQK-----------LTS
KAD1_SYNY3      -------------RADD-NETTIRNRLLVYTEQTAPLMAYYQEQGK-----------LYS
KAD_BACAN       -------GGELYQRSDD-NEETVANRLDVNIKQTKPLLDFYEELGY-----------LQS
KAD_BACCR       -------GGELYQRSDD-NEETVANRLDVNIKQTKPLLDFYEELGY-----------LQS
KAD_GEOSE       -------GGELYQRADD-NEATVANRLEVNMKQMKPLVDFYEQKGY-----------LRN
KAD_BACSU       -------GGELYQRADD-NEETVSKRLEVNMKQTQPLLDFYSEKGY-----------LAN
KAD_LISMO       -------GGELYQRDDD-KKETVEKRLNVNMKQTKPLLDFYSEKGK-----------LHN
KAD_SPOGL       -------GGELYQRADD-NPDTVTNRLEVNMNQTAPLLAFYDSKEV-----------LVN
KAD_ENTFA       -------GHEFYQREDD-KPETVKNRLAVNIESSAPILAFYKEQGL-----------MHT
KAD_LACPL       -------GHDFYQRDDD-KPATVKNRLDVNIKLNTPLIDYYGQEKL-----------LYN
KAD_LACLA       -------SHDLYQRADD-VPETVKNRLDVNIKESAPIIEHYTELGL-----------VKN
KAD_STRR6       -------EEDYYQREDD-KPETVKRRLDVNIAQGEPIIAHYRAKGL-----------VHD
KAD_CLOAB       -------GSPVVQRKDD-SEDTVKERLDVYDRQTEPLVVYYRNEAV-----------LKS
KAD_CLOBH       -------DNELIQRKDD-TEATVKERLEVYSKQTYPLINYYKDNGI-----------ISE
KAD_MOOTA       -------GQDLVQRADD-TEATVNKRLDVYNEQTAPLVNYYRQRGL-----------LKE
KAD_GEOSL       -------GGELYQRDDD-REDTMRRRLEVYDEQTAPLKSYYEGERL-----------LRK
KAD_THEYD       -------GGELFQRDDD-KEETIRKRLEVYRAQTEPLIDYYSKKGI-----------LKS
KAD_ARCFU       -------GGELYQRDDD-KEETVRERYRVYKQNTEPLIDYYRKKGI-----------LYD
KAD_THEMA       -------KVKLVQREDD-KEETVRHRYKVYLEKTQPVIDYYDKKGI-----------LKR
KAD_METAC       -------GGEVFQRADD-TAEAVQNRLDVYKKQTQPLINYYKEKGI-----------LVT
KAD_MYCTU       -------------RADD-TDDVILNRMKVYRDETAPLLEYYRDQ-------------LKT
KAD_MYCS2       -------------RADD-TDEVIRNRMKVYREETEPLLEYYRDD-------------LKT
KAD_CORGL       -------------RADD-NEETIRTRLGVYRDETAPLIDHYGDK-------------IIN
KAD_STRCO       -------GGELYQRDDD-SEETVRKRLEVYHTQTEPIIDYYKSQGL-----------VAT
KAD_RHOBA       ---------ETENRADD-SEEFIRERFRIYEDRTAPLLDHYRCQGL-----------VRD
KAD_BIFLO       ------------GRADD-TPEAIAKRLETYEKETAPLLDIYEARGL-----------LVV
KAD_SALRD       -------PDLIVQRSDD-EPETIQNRLDVYREETAPLATYYEERDL-----------LVP
KAD_THEEB       ------------QRSDD-TPETILKRLQVYERETLPMIQQYMSHPK-----------FVP
KAD_BACTN       ------------GRADD-NEETIKKRLHVYHSQTSPLIDWYKNEKK-----------YQH
KAD_FLAPJ       ------------GRVDDQDEEKIRNRYQEYNEKTAPLMSYYKNNKK-----------FHA
KAD_LEPIN       ------------GRADD-NEVTIKNRLDNYNKKTLPLLDFYATRKK-----------LSQ
KAD_PYRFU       -------GAELVQREDD-RPEVVEKRYRIYMKNMEPIIKFYQKQRI-----------YVK
KAD_THEKO       -------GSELIQRADD-REEVVRKRYRIYSKNMEPIIKFYRAKGI-----------YVR
KAD_MYCMS       -------NTKLVKRSDD-SLDKVQIRLQTYKEQTLPLIDYFKTNSK-----------FIE
KAD1_ARATH      LLPPHQCMSKLVTRADD-TEEVVKARLRIYNETSQPLEEYYRTKGK-----------LME
KAD1_SOLTU      LNPPFTVCFKLITRADD-TEAIVKERLSIYWDKSQPVEDFYRSQGK-----------LLE
KAD_MYCPN       -------HATLQARNDD-TEAVILKRLTLYEDTVKPLIEAFTKQGI-----------LTV
KAD_HALSA       -------GGSLYQREDD-TEETARERITVYEENTAPVVEYFREQGV-----------LAE
KAD_BORBU       -------GGDLYQREDD-KEECLKTRLKEYKLQTKPLIEFYSKCSR-----------LNN
KAD_CHLTR       -------SVELIRRSDD-TLEVILDRIQTYKQETQPVLDYYTEKQK-----------LIT
KAD3_HUMAN      -------GEPLIQREDDK-PETVIKRLKAYEDQTKPVLEYYQKKGV-----------LET
KAD3_PONAB      -------GEPLIQREDDK-PETVIKRLKAYEDQTKPVLEYYQKKGV-----------LET
KAD3_MOUSE      -------GEPLIQREDDK-PETVIKRLKAYEAQTEPVLQYYQKKGV-----------LET
KAD3_RAT        -------GEPLIQREDDK-PETVIKRLKAYEAQTEPVLQYYQKKGV-----------LET
KAD3_BOVIN      -------GEPLVQREDDR-PETVVKRLKAYEAQTEPVLEYYRKKGV-----------LET
KAD4_HUMAN      -------GEPLVQQEDDK-PEAVAARLRQYKDVAKPVIELYKSRGV-----------LHQ
KAD4_PONAB      -------GEPLVQQEDDK-PEAVAARLRQYKDVAKPVIELYKSRGV-----------LHQ
KAD4_BOVIN      -------GEPLVQQEDDK-PEAVAARLRQYKDVAKPVIELYKSRGV-----------LHQ
KAD4_MOUSE      -------GEPLVQQEDDK-PEAVAARLRRYKDAAKPVIELYKSRGV-----------LHQ
KAD4_RAT        -------GEPLVQQEDDK-PEALAARLRRYKDAAKPVIELYKSRGV-----------LHQ
KAD3_YEAST      -------GEPLTKRLDDT-AEVFKKRLEEYKKTNEPLKDYYKKSGI-----------FGT
KADY_CAEEL      -------GEPLFKRSTDQ-LEVARRRLEVYDKTENKVLDYYKKQNK-----------CIT
KADB_DICDI      -------GEPLVRRSDDKDEEVFRNRIQTFKNNTLPLLKYYEDRGV-----------LYT
KADC_MAIZE      ------IASRLTQRFDD-TEEKVKLRLETYYQNIESLLSTYENIIV-------------K
KAD2_ARATH      ------IAVRLTQRFDD-TEEKAKLRLKTHNQNVSDVLSMYDDITI-------------K
KAD_CAMJE       ------------NRGADDNEEVFYNRMKVYTEPLNEILDFYQKKKL-----------HFI
KAD_HELPY       ------------SRGADDNEKVFHNRMRVFLDPLGEIQNFYKNKKV-----------YKA
KAD1_HUMAN      ------------GRVDD-NEETIKKRLETYYKATEPVIAFYEKRGI-----------VRK
KAD1_BOVIN      ------------GRVDD-NEETIKKRLETYYKATEPVIAFYEKRGI-----------VRK
KAD1_PIG        ------------GRVDD-NEETIKKRLETYYKATEPVIAFYEKRGI-----------VRK
KAD1_RABIT      ------------GRVDD-NEETIKKRLETYYKATEPVIAFYEKRGI-----------VRK
KAD1_MOUSE      ------------GRVDD-NEETIKKRLETYYNATEPVISFYDKRGI-----------VRK
KAD1_RAT        ------------GRVDD-NEETIKKRLETYYKATEPVISFYDKRGI-----------VRK
KAD1_CHICK      ------------GRVDD-NEETIKKRLETYYKATEPVIAFYKGRGI-----------VRQ
KAD1_CAEEL      ------------GRADD-NADTIKKRLHTFVTSTAPVVDYYESKGK-----------LVR
KCY_YEAST       ------------GRSDD-NIESIKKRFNTFKETSMPVIEYFETKSK-----------VVR
KCY_SCHPO       ------------GRSDD-NIESIKKRFVTYTKASMPVVEYLKSQNR-----------LIT
KCY_DICDI       ------------GRSDD-NIESIKKRFNTFNVQTKLVIDHYNKFDK-----------VKI
KCY3_ARATH      ------------GREDD-NIETIRKRFKVFLESSLPVIHYYEAKGK-----------VRK
KCY_HUMAN       ------------GRSDD-NRESLEKRIQTYLQSTKPIIDLYEEMGK-----------VKK
KCY_MOUSE       ------------GRSDD-NRESLEKRIQTYLESTKPIIDLYEEMGK-----------VKK
KCY_RAT         ------------GRSDD-NRESLEKRIQTYLESTKPIIDLYEEMGK-----------VKK
KCY_BOVIN       ------------GRSDD-NRESLEKRIQTYLQSTKPIIDLYEEMGK-----------VRK
KCY_PIG         ------------GRSDD-NRESLEKRIQTYLQSTKPIIDLYEEMGK-----------VKK
KCY_CHICK       ------------GRSDD-NRESLEKRIHTYLQSTRPIIDLYERMGK-----------VRR
KCY_XENTR       ------------GRSDD-NRESLEKRIQTYLQSTRPIIDLYEKTGK-----------VKK
KCY_DANRE       ------------GRTDD-NRESLEKRIQTYLQSTRPIIELYEKQGK-----------VQR
KCY1_CAEEL      ------------GRTDD-NVESLKKRVETYNQSTFPIIEHFEKVGM-----------VRE
KCY2_CAEEL      ------------GRTDD-NEESLKKRVETYNQQTFPIIEHFEKSGL-----------VRE
                             :  *        *          :                       

KAD_BURP1       ISGLG-AVEEIRARVFDALK-----------------------------------
KAD_BURPS       ISGLG-AVEEIRARVFDALK-----------------------------------
KAD_BORPE       ISGVG-SVDEIKSRLSQALQS----------------------------------
KAD_NEIG1       VDGTQ-AVEAVKAEVLGALGK----------------------------------
KAD_NEIMB       VDGTQ-AVEAVKAEVLGALGK----------------------------------
KAD_CHLTE       IAGIG-TVEQIKDEIIATLNG----------------------------------
KAD_PSEAE       IAGVG-SVEQITAKVLSALS-----------------------------------
KAD_COXBU       ISGLG-SMEEVRERILQVFEAYDPRDSGNLEH-----------------------
KAD_ECOLI       VDGTK-PVAEVRADLEKILG-----------------------------------
KAD_SHIDS       VDGTK-PVAEVRADLEKILG-----------------------------------
KAD_SALTY       VDGTQ-AVADVRAALEKILG-----------------------------------
KAD_YERPE       LDGTR-NVAEVSAELATILG-----------------------------------
KAD_VIBCH       FDGTK-QVSEVSADIAKALA-----------------------------------
KAD_ALIF1       FDGTK-LVAEVSAEIEKALA-----------------------------------
KAD_SHEON       FDGTQ-SVAAVSEQLASVLK-----------------------------------
KAD_HAEIN       LDGTQ-KVEEVSQELDKILG-----------------------------------
KAD_FRATT       INGDQ-AVEKVSQDIFDQLNKR---------------------------------
KAD_BUCAI       IDAML-SFSSIRKKLETILKK----------------------------------
KAD2_CANAL      VDASQ-KPTKVWSDILKCLG-QN--------------------------------
KAD2_YARLI      VDAAQ-DPKKVWGDILKCLG-Q---------------------------------
KAD2_YEAST      VDASQ-PPATVWADILNKLG-KD--------------------------------
KAD2_ASPFU      IDASQ-EPGQVWKSLLGVFQ-K---------------------------------
KAD2_EMENI      IDASQ-EPGQVWKSLLGVFN-NKN-------------------------------
KAD2_COCIM      IDASQ-EPGQVWKSLLQVFE-KK--------------------------------
KAD2_SCLS1      IDASQ-EPGAVWKSLLGVFD-KQKAPSG---SLLSKITGRS--------------
KAD2_PHANO      VDASQ-DPGQVWKSLLKIFD-DKAYVAGRSGSLLNKIGLKN--------------
KAD2_NEUCR      IDASQ-EPAQVWKSLLAIFEGDKAKASSAGSGIMSKIASAAKSS-----------
KAD2_SCHPO      VDAAQ-KPEQVWEQIVAILEKAE--------------------------------
KAD2_COPC7      VDAAQ-SPSVVWDSMRGIFAGRK--------------------------------
KAD2_USTMA      VDASQ-SPKVVWQSIQAIFDNKQPQPSN---------------------------
KAD2_CRYNJ      VDAAQ-SPKLVWASISSILESKKN-------------------------------
KAD2_HUMAN      IDASQ-TPDVVFASILAAFSKATCKDLVMFI------------------------
KAD2_PONAB      IDASQ-TPDVVFASILAAFSKATCKDLVMFI------------------------
KAD2_BOVIN      IDASQ-TPDVVFASILAAFSKATCKDLVMFI------------------------
KAD2_MOUSE      IDASQ-TPDIVFASILAAFSKATCKDLVMFI------------------------
KAD2_RAT        IDASQ-TPDVVFASILAAFSKATCKDLVMFV------------------------
KAD2_DANRE      IDASQ-STDLVFASILAAFSAATCKDLVYFV------------------------
KAD2_XENTR      VDAAQ-SPDVVFASILAAFSKARCKDLVLFV------------------------
KAD2_AEDAE      VDAAQ-SASRVFENIDSIFTSQRKARMGL--------------------------
KAD2_ANOGA      VDAAK-SASDVFANIDSIFTKQRAHRLGF--------------------------
KAD2_DROME      VDAAK-KSSDVFSTIDSIFQRKRPAQIQL--------------------------
KAD2_DROPS      VDAAR-KSSDVFSTIESIFQRQRTAQPQS--------------------------
KAD2_CAEBR      VDAAK-PMADVKAHIDSVFAKFTQKKV----------------------------
KAD2_CAEEL      VDAAK-PMTDVKAHIDQVFAKFTQKKERVSFV-----------------------
KAD4_ARATH      IQAEK-APQEVTSEVKKALS-----------------------------------
KAD3_ARATH      IPAEK-APEEVTKVVKKVVST----------------------------------
KAD3_ORYSJ      LHAEK-PPKEVTVEVQKALS-----------------------------------
KAD4_ORYSJ      LHAEK-PPKEVTAEVQKVLS-----------------------------------
KAD2_DICDI      IDASK-SAPFVSHTIKSIFLSTLHFPHNASIFKTFHQKMKMQVHSTETPLAAEIL
KAD_AQUAE       IDASK-PVEEVYRQVLEVIGDGN--------------------------------
KAD_PROMA       INGCG-SVEDVNSRIKEALS-----------------------------------
KAD_THET8       VDGLG-TPDEVYARIRAALGI----------------------------------
KAD_XANCP       VDGVG-SLDEVLERIGQALGR----------------------------------
KAD_AGRFC       LDGMA-DVDAVTEAIERVLEKASA-------------------------------
KAD_CAUVC       LDGMG-TVEAVAASIDSALEPVAAG------------------------------
KAD_FUSNN       IDGTK-KLEDITQDIFKILG-----------------------------------
KAD_GLOVI       VDGDR-SPEVVYSELRELLG-----------------------------------
KAD1_SYNY3      LDGNQ-PVEAIATNLEKLVKP----------------------------------
KAD_BACAN       INGEQ-DINKVFADIDVLIGGLA--------------------------------
KAD_BACCR       INGEQ-DINKVFADIDVLIGGLA--------------------------------
KAD_GEOSE       INGEQ-DMEKVFADIRELLGGLAR-------------------------------
KAD_BACSU       VNGQQ-DIQDVYADVKDLLGGLKK-------------------------------
KAD_LISMO       INGEQ-EIKDVFVDVEKILASF---------------------------------
KAD_SPOGL       INGQK-DIKDVFKDLDVILQGNGQ-------------------------------
KAD_ENTFA       IDGNR-EIDTVFSDVKKIIDEN---------------------------------
KAD_LACPL       VDGDR-DIDDVYKDIKKILDNL---------------------------------
KAD_LACLA       IEGEQ-EISQVTEDIKKVLG-----------------------------------
KAD_STRR6       IEGNQ-DINDVFSDIEKVLTNLK--------------------------------
KAD_CLOAB       VDGTQ-DIDKVFEDIRNVLGEI---------------------------------
KAD_CLOBH       VNGTE-SINEVFGNISNILGRDK--------------------------------
KAD_MOOTA       IDGSQ-AIPAVILAIGRALGRDWQ-------------------------------
KAD_GEOSL       VNALE-PIEDVQRQIVKLVESCNG-------------------------------
KAD_THEYD       VSGTG-SIDEIFNSICAILEKK---------------------------------
KAD_ARCFU       VDGTK-DIEGVWKEIEAILEKIKS-------------------------------
KAD_THEMA       VDGTI-GIDNVIAEVLKIIGWSDK-------------------------------
KAD_METAC       LDGTK-EIDVVFEDLKAILAKFA--------------------------------
KAD_MYCTU       VDAVG-TMDEVFARALRALGK----------------------------------
KAD_MYCS2       VNAVG-ALDEVFARALSALGQ----------------------------------
KAD_CORGL       IEAEG-EVEEINARTLKALGK----------------------------------
KAD_STRCO       IAATG-PVDEVTRRALEALKRDQ--------------------------------
KAD_RHOBA       IDASD-SESLVHASICECLNFTLASPAES--------------------------
KAD_BIFLO       VNGVG-DIDEISGRIISHLE-----------------------------------
KAD_SALRD       VDGTG-GIEEVFGRIEEALDALER-------------------------------
KAD_THEEB       IDGTR-TIEEVTAAIQARIGEVNRV------------------------------
KAD_BACTN       INGLG-TMDGIFADICEAVDKL---------------------------------
KAD_FLAPJ       VNGIG-TIQEITKRLSEVINNL---------------------------------
KAD_LEPIN       VNGVG-SLEEVTSLIQKELA-----------------------------------
KAD_PYRFU       INGHG-NIDEVWERIRPLLDYIRNREAMI--------------------------
KAD_THEKO       VDGDG-PISEVWKRIQPLLDYIHSREEKRKEHE----------------------
KAD_MYCMS       IKADDLSAEQVFNQIKGELKI----------------------------------
KAD1_ARATH      FDLPG-GIPESWPRLLEALRLDDYEEKQSVAA-----------------------
KAD1_SOLTU      FDLPG-GIPESWPKLLEVLNLDEQEYKLSPAA-----------------------
KAD_MYCPN       IEAQL-PLEQQVNLVQQLVH-----------------------------------
KAD_HALSA       VDGER-TPDEVWTDVAAAVDERTA-------------------------------
KAD_BORBU       VDASV-KIDEIKKKIIKIMLKKN--------------------------------
KAD_CHLTR       IDANA-PTQQVFQSILDSLSASLVYQERDCCNCDCDDED----------------
KAD3_HUMAN      FSGTE--TNKIWPYVYAFLQTKVPQRSQKASVTP---------------------
KAD3_PONAB      FSGTE--TNKVWPYVYAFLQTKVPQTSQKASVTP---------------------
KAD3_MOUSE      FSGTE--TNKIWPHVYSFLQTKVPETTQKASVTP---------------------
KAD3_RAT        FSGTE--TNKIRPHVYSFLQMKVPETIQKASVTP---------------------
KAD3_BOVIN      FSGTE--TNKIWPHVYAFLQTKLPQRSQETSVTP---------------------
KAD4_HUMAN      FSGTE--TNKIWPYVYTLFSNKITPIQSKEAY-----------------------
KAD4_PONAB      FSGTE--TNKIWPYVYTLFSNKITPIQSKEAY-----------------------
KAD4_BOVIN      FSGTE--TNKIWPYVYTLFSNKITPVQSKEAY-----------------------
KAD4_MOUSE      FSGTE--TNRIWPYVYTLFSNKITPIQSKEAY-----------------------
KAD4_RAT        FSGTE--TNRIWPYVYTLFSNKITPIQSKEAY-----------------------
KAD3_YEAST      VSGET--SDIIFRNY----------------------------------------
KADY_CAEEL      MSGES--SKAVFESVAEVMRRDLLTTTPRTAYA----------------------
KADB_DICDI      IDSPN--SDEGYVKIKQILDSILTK------------------------------
KADC_MAIZE      VQGDA-TVDAVFAKIDELLGSILEKKNEMVSST----------------------
KAD2_ARATH      IEGNR-SKEEVFAQIDSSLSELLQERNTAPSSLLS--------------------
KAD_CAMJE       IDGER-TIEPIVADMKELIKKIQSI------------------------------
KAD_HELPY       IDGER-SIEEIVGEMQEYILSFGN-------------------------------
KAD1_HUMAN      VNAEG-SVDSVFSQVCTHLDALK--------------------------------
KAD1_BOVIN      VNAEG-SVDNVFSQVCTHLDALK--------------------------------
KAD1_PIG        VNAEG-SVDDVFSQVCTHLDTLK--------------------------------
KAD1_RABIT      VNAEG-SVDNVFSQVCTHLDALK--------------------------------
KAD1_MOUSE      VNAEG-TVDTVFSEVCTYLDSLK--------------------------------
KAD1_RAT        VNAEG-SVDTVFSQVCTYLDSLK--------------------------------
KAD1_CHICK      LNAEG-TVDEVFQQVCSYLDKL---------------------------------
KAD1_CAEEL      INAEG-SVDDIFAVVVANLDKATSKL-----------------------------
KCY_YEAST       VRCDR-SVEDVYKDVQDAIRDSL--------------------------------
KCY_SCHPO       IDAEQ-DPDAVFEDTVKALQPYL--------------------------------
KCY_DICDI       IPANR-DVNEVYNDVENLFKSMGF-------------------------------
KCY3_ARATH      INAAK-PIEAVFEEVKAIFSPEAEKVEA---------------------------
KCY_HUMAN       IDASK-SVDEVFDEVVQIFDKEG--------------------------------
KCY_MOUSE       IDASK-SVDEVFGEVVKIFDKEG--------------------------------
KCY_RAT         IDASK-SVDEVFGDVMKIFDKEG--------------------------------
KCY_BOVIN       IDASK-SVDEVFDEVVKIFDKEG--------------------------------
KCY_PIG         IDASK-SVDEVFDEVVKIFDKEG--------------------------------
KCY_CHICK       VDASK-SVDEVFEKVVQIFDKEG--------------------------------
KCY_XENTR       VDASK-SVDEVFTKVQDIFDREG--------------------------------
KCY_DANRE       IDASR-SVDEVFADVKNILEKDD--------------------------------
KCY1_CAEEL      VNSER-PVTEVYEDVVKVFAAANQK------------------------------
KCY2_CAEEL      VKSER-PVDVVYADVEKVFDAANKK------------------------------
                .