CLUSTAL format seed alignment for MF_00236

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TATA_LEGPL       -----MGLSGISPLSLLLILAIIVALFG-TSKLKTIGSDLGEAIKNFRKAMNSE------
TATA_LEGPA       -----MGLSGISPLSLLLILAIIVALFG-TSKLKTIGSDLGEAIKNFRKAMNSE------
TATA_LEGPC       -----MGLSGISPLSLLLILAIIVALFG-TSKLKTIGSDLGEAIKNFRKAMNSE------
TATA_PSEHT       -----MGFGGISLWQLLIVLAIIVLLFG-TKKLRGIGGDLGGAVKGFKKAMSDE------
TATA_HAHCH       --------MGISMWQLLIVLLIIVLLFG-TKKLKNIGGDLGGAVKGFKKAMSDG------
TATA_ACTPJ       -------MGGISIWQLLIIVAIIVLLFG-TKKLRTLGTDLGESVKGFKKAMADD------
TATA_ACTP2       -------MGGISIWQLLIIVAIIVLLFG-TKKLRTLGTDLGESVKGFKKAMADD------
TATA_ACTP7       -------MGGISIWQLLIIVAIIVLLFG-TKKLRTLGTDLGESVKGFKKAMADD------
TATA_HAEDU       -------MGGISIWQLLIIVAIIVLLFG-TKKLRTLGTDLGESVKGFKKAMAED------
TATA_HAEPS       -------MGGISIWNLVIIVLLVVLLFG-TKKLRGLGSDLGESIKGFKKAMNDD------
TATA_MANSM       -------MGGISIWQLLIIVAIIVLLFG-TKKLRTLGTDLGESVKGFKKAMNED------
TATA_PASMU       -------MGGISITQLLIIVAIVVLLFG-TKKLRTLGSDLGESVKGFKKAMADDN-----
TATA_ACTSZ       -------MGGISIWQLLIIVAIVVLLFG-TKKLRTLGSDLGESVKGFKKAMAEE------
TATA_ECOLI       -------MGGISIWQLLIIAVIVVLLFG-TKKLGSIGSDLGASIKGFKKAMSDDE----P
TATA_ECO57       -------MGGISIWQLLIIAVIVVLLFG-TKKLGSIGSDLGASIKGFKKAMSDDE----P
TATA_ECOL6       -------MGGISIWQLLIIAVIVVLLFG-TKKLGSIGSDLGASIKGFKKAMSDDE----P
TATA_SHIFL       -------MGGISIWQLLIIAVIVVLLFG-TKKLGSIGSDLGASIKGFKKAMSDDE----P
TATA_SALTI       -------MGGISIWQLLIVAVIVVLLFG-TKKLGSIGSDLGASIKGFKKAMSDDD----A
TATA_SALTY       -------MGGISIWQLLIVAVIVVLLFG-TKKLGSIGSDLGASIKGFKKAMSDDD----A
TATA_SODGM       -------MGGISITQLLIIASIVVVLFG-TKKLRGLGSDLGASIKGFKKSMSEDDNTTST
TATA_PHOLL       -------MGGISIWQLLIIAVIVVLLFG-TNKLRTLGSDLGASIKGFKKAIGDDNQ--PQ
TATA_PROMH       -------MGGISIWQLLIIAVIVVLLFG-TNKLRTLGSDLGASVKGFKKAMGDENQKETN
TATA_YERPE       -------MGSIGWAQLLIIAVIVVLLFG-TNKLRTLGSDLGASIKGFKKAMGDDSQTPPT
TATA_ALIF1       -------MGGISIWQLLIIAVIIVLLFG-TKKLRGVGSDLGSAVKGFKKAISED------
TATA_ALIFM       -------MGGISIWQLLIIAVIIVLLFG-TKKLRGVGSDLGSAVKGFKKAISED------
TATA_ALISL       -------MGGISIWQLLIIAVIIVLLFG-TKKLRGVGSDLGSAVKGFKKAISED------
TATA_VIBVU       -------MGGISIWQLLIIAVIVVLLFG-TKKLRGIGSDLGGAIKGFKKAMNEE------
TATA_VIBVY       -------MGGISIWQLLIIAVIVVLLFG-TKKLRGIGSDLGGAIKGFKKAMNEE------
TATA_VIBCH       -------MGGISIWQLLIIAVIVVLLFG-TKKLRGIGSDLGSAVKGFKKAMSEE------
TATA_VIBCB       -------MGGISVWQLLIIAVIVVLLFG-TKKLRGIGGDLGGAVKGFKKAMSED------
TATA_VIBPA       -------MGGISVWQLLIIAVIVVLLFG-TKKLRGIGGDLGSAVKGFKKAMSDE------
TATA_VIBTL       -------MGGISIWQLLIIAVIVILLFG-TKKLRGMGGDLGSAVKGFKKAMSDE------
TATA_PHOPR       -------MGGISIWQLLIIALIIVLLFG-TKKLRSLGGDLGSAVKGFKKAIGDE------
TATA_SHEB5       -------MGGISIWQLLIVALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHEB8       -------MGGISIWQLLIVALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHEB9       -------MGGISIWQLLIVALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHEB2       -------MGGISIWQLLIVALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHEPC       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHESW       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHESM       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHESR       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHESA       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSD------
TATA_SHEON       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHEAM       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAIKGFKNAMS-D------
TATA_SHEFN       -------MGGISIWQLLIVALIVILLFG-TKKLRSLGGDLGGAVKGFKNAMTPE------
TATA_SHEHH       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMTSE------
TATA_SHEPA       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHEPW       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHELP       -------MGGISIWQLLIIALIVVLLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_SHESH       -------MGGISIWQLLIVALIVVLLFG-TKKLRSLGGDLGGAVKGFKSAMSSE------
TATA_SHEDO       -------MGGISIWQLLIIALIVILLFG-TKKLRSLGGDLGGAVKGFKNAMTSETSE---
TATA_SHEWM       -------MGNMGIWQLLIIAVIVILLFG-TKKLRSLGGDLGGAVKGFKNAMSSE------
TATA_ALTMD       -------MGGISIWQLLIILVIVVLLFG-TKRLKGIGTDLGGAIKGFKKAVSEE------
TATA_HYDCU       --------MGISIWQLLIILAIVLVLFG-AKRLKNVGSDLGGAIKGFKKAVSDE------
TATA_PSEMY       -----MGFGGISIWQLLIILLIVVMLFG-TKRLKSLGSDLGDAIKGFRKSMDNG------
TATA_PSEST       --------MGISVWQLLIILLIVVMLFG-TKRLRGLGSDLGSAINGFRKSVSDG------
TATA_SACD2       -----MGLGGISIWQLLIVLVIVLLLFG-TKRLKGLGGDLGGAIKGFKKAMSDD------
TATA_CHRSD       ------MLGGISIWQLLIVLGIVILIFG-TKKLRNLGSDLGGAVKGFKSAVGEE------
TATA_MARMS       ------MLGGISIWQLLIVLAILVLIFG-TKKLKNLGSDLGGAVKGFKEAV-DK------
TATA_ALCBS       ------MFSGISIWQLLILLAIVVLLFG-TKKLRNIGGDLGGAVKGFKSAMKDG------
TATA_MARHV       --------MGISIWQLLIVLGIVILLFG-TKKLRNIGSDLGGAIRGFKKSMSDEEE----
TATA_NITOC       -----MGVGGISIWQLLIVLVIILLLFG-TKKLRSIGTDLGSAIKGFRNSLRDEER----
TATA_HALHL       --------MGFNIWSLLIILLIVALLFG-TKKLRNIGGDLGGAIRGFKESMREGEE----
TATA_ALKEH       --------MGISPWTLLIVLLIVLLVFG-TKKLRNMGTDMGGAIKGFKDAMKEGEEG---
TATA_DICNV       --------MGASPVQLLIVLFIAVLVFG-GKRLRTLGSDVGAAIKGFKEAMKE-------
TATA_METCA       --------MGIGVWELLLLFLIVLVVFG-TKRLRNIGGDLGGAIKSFRQAM-S-------
TATA_PSYIN       -------MGGIGIWQLAIITVIVILLFG-TKKLRGIGGDLGGAIKGFKKAI-K-------
TATA_RUTMC       --------MMPGPFELIVILVIVLLLFG-GKRLKNVGSDLGNAIKGFKKSMQK-------
TATA_VESOH       --------MMPGPFELIIILVIVLLLFG-GKRLKDIGGDLGNAIKGFKKAM-K-------
TATA_HAEIN       -------MFGLSPAQLIILLVVILLIFG-TKKLRNAGSDLGAAVKGFKKAMKEDEK----
TATA_HAEIE       -------MFGLSPAQLIILLVVILLIFG-TKKLRNAGSDLGAAVKGFKKAMKEDEK----
TATA_HAES1       --------MGLSWQQLLILLLVVVVIFG-TKKLRNIGSDLGGAVKDFKKAMNDDQ-----
TATA_HISS2       --------MGLSWQQLLILLLVVVVIFG-TKKLRNIGSDLGGAVKDFKKAMNDDQ-----
TATA_LEPCP       --------MGLSTTHLIIFLVIIVLIFG-TKKLKNIGSDLGGAVKGFKDGMKTGEKT---
TATA_RHOFT       --------MGFSTTHLLIFLVIIIVIFG-TKKLRNIGSDLGGAVKGFKDGMKEGSDK---
TATA_DELAS       -------MGSFSIWHWLIVLAIVVLVFG-TKKLKNIGSDLGGAVKGFKDGVKDGS-----
TATA_METPP       -------MGSFSIWHWLIVLLIVVLVFG-TKKLKNIGSDLGGAVKGFKDGVRDGS-----
TATA_ACIAC       -------MGSFSIWHWLIVLLIVVMVFG-TKKLKNIGSDLGGAVKGFKDGMKDGS-----
TATA_ACISJ       -------MGSFSIWHWLIVLLIVVMVFG-TKKLKNIGSDLGGAVKGFKDGMKDGA-----
TATA_ACIET       -------MGSFSIWHWLIVLLIVVMVFG-TKKLKNIGSDLGGAVKGFKDGMKDGA-----
TATA_VARPS       -------MGSFSIWHWLIVLLVVVMIFG-TKKLRNMGSDLGGAVKGFKDGMKDGS-----
TATA_POLNA       -------MGGFSIWHWLIVLLIVVMVFG-TKKLRNMGSDLGGAVKGFKDGMKDGG-----
TATA_POLSJ       -------MGSFSIWHWLIVLLIVVMVFG-TKKLKNMGSDLGSAVKGFKDGMKDGG-----
TATA_VEREI       -------MGTFSIWHWLIVLLVVVVVFG-TKKLRNIGTDLGSAVKGFKDGMKDAA-----
TATA_BORBR       -------MGSFSIWHWLIVLVIIALVFG-TKKLRNVGSDLGSAVKGFKEGMKDAS-----
TATA_BORPA       -------MGSFSIWHWLIVLVIIALVFG-TKKLRNVGSDLGSAVKGFKEGMKDAS-----
TATA_BORPE       -------MGSFSIWHWLIVLVIIALVFG-TKKLRNVGSDLGSAVKGFKEGMKDAS-----
TATA_BORPD       -------MGSFSIWHWLIVLVIVALVFG-TKKLRNIGSDLGGAVKGFKEGMKDAN-----
TATA_BORA1       -------MGSFSIWHWLIVLVIVALIFG-TKKLRNIGSDLGGAVKGFKDGMQEAN-----
TATA_DECAR       -------MGSFSIWHWLIVLVIVMLIFG-TKKLRNVGQDLGGAVKGFKDGMKEAN-----
TATA_CUPTR       -------MGSFSIWHWLIVLVIVMLVFG-TKKLRNIGQDLGGAVKGFKDGMKDGE-----
TATA_CUPNH       -------MGSFSIWHWLIVLVIVMLVFG-TKKLRNIGQDLGGAVKGFKDGMKDGE-----
TATA_CUPPJ       -------MGSFSIWHWLIVLVIVMLVFG-TKKLRNIGQDLGGAVKGFKDGMKEGD-----
TATA_CUPMC       -------MGSFSIWHWLIVLVIVMLVFG-TKKLRNIGQDLGGAVKGFKDGMKEGN-----
TATA_RALPJ       -------MGSFSIWHWLIVLVIIMMVFG-TKKLRNIGSDLGSAVKGFKDGMREGQ-----
TATA_RALSO       -------MGSFSIWHWLIVLLIIMMVFG-TKKLRNIGSDLGSAVKGFKEGMREGS-----
TATA_HERAR       -------MGSFSIWHWLIVLVIVALVFG-TKKIGSMGTDVGKAVKGFKDGMKG-E-----
TATA_JANMA       -------MGSFSIWHWLIVLVIVMLVFG-TKKLGNMGSDVGKAVKGFKDGMKGGE-----
TATA_POLNS       -------MGSFSIWHWLIVLVIVMLVFG-TKKLRNIGQDLGGAVKGFKDGMK-TF-----
TATA_POLAQ       -------MGSFSIWHWLIVLVIVMLVFG-TKKLRNIGQDLGGAVKGFKDGMK-SA-----
TATA_AZOSB       -------MGSFSIWHWLIVLVIVMLVFG-TKKLRNIGQDLGGAVKGFKDGMK-DA-----
TATA_AROAE       -------MGSFSIWHWLIVLVIVVLVFG-TKKLRNVGQDLGGAVKGFKDGMR-DS-----
TATA_LARHH       -------MGSFSIWHWVIVLVVVVLIFG-TKKLRNVGQDLGGAVKGFKEGMKSEG-----
TATA_THIDA       -------MGSFSIWHWLIVLVVVLLIFG-TKKLRNIGSDLGGAVKGFKEGMK--------
TATA_NITEU       -------MGSFSIWHWLVVLAIVVLVFG-TKKLRNLGSDLGGAVRGFKEGMKGAE-----
TATA_NITEC       -------MGSFSIWHWLVVLAIVVLVFG-TKKLRNLGSDLGGAVRGFKEGMKGAE-----
TATA_NITMU       -------MGSFSIWHWLIVLLIVVLVFG-TKKLRNLGSDLGGAVKGFREGVKSAD-----
TATA_BURCM       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURVG       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURA4       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURCA       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURCH       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURCC       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURCJ       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURL3       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKEGE-----
TATA_BURM1       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKDGD-----
TATA_BURMA       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURM9       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURM7       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURMS       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURPS       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURP0       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURP1       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURP6       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMKESE-----
TATA_BURTA       -------MGGLSIWHWLIVLLIVALVFG-TKKLRNIGNDLGSAVKGFKDGMREGE-----
TATA_PARPJ       -------MGSLSIWHWLIVLLIVALVFG-TKKLRNIGGDLGGAVKGFKEGMKEAD-----
TATA_PARXL       -------MGSLSIWHWLIVLLIVALVFG-TKKLRNIGTDLGGAVKGFKEGMKEAE-----
TATA_PARP8       -------MGSLSIWHWLIVLLIVALVFG-TKKLRNIGSDLGGAVKGFKEGMKDGE-----
TATA_CHRVO       -------MGSLSIWHWLIVLLIVVLVFG-TKKLPGIGKDLGNAVKGFKEGMNEGA-----
TATA_NEIG1       -------MGSFSLTHWIIVLIIVVLIFG-TKKLRNVGKDLGGAVHDFKQGLNE-------
TATA_NEIG2       -------MGSFSLTHWIIVLIIVVLIFG-TKKLRNVGKDLGGAVHDFKQGLNE-------
TATA_NEIM0       -------MGSFSLTHWIIVLIIVVLIFG-TKKLRNVGKDLGGAVHDFKQGLNE-------
TATA_NEIMA       -------MGSFSLTHWIIVLIIVVLIFG-TKKLRNVGKDLGGAVHDFKQGLNE-------
TATA_NEIMB       -------MGSFSLTHWIIVLIIVVLIFG-TKKLRNVGKDLGGAVHDFKQGLNE-------
TATA_PSYA2       -------MGSFSITHWLILLVVVVVVFG-TSKLRNAGKDLGGAVKGFKEAVKDEN-----
TATA_PSEAE       -------MGIFDWKHWIVILIVVVLVFG-TKRLKNLGSDVGEAIKGFRKAVNTEE-----
TATA_PSEA8       -------MGIFDWKHWIVILIVVVLVFG-TKRLKNLGSDVGEAIKGFRKAVNTEE-----
TATA_PSEAB       -------MGIFDWKHWIVILIVVVLVFG-TKRLKNLGSDVGEAIKGFRKAVNTEE-----
TATA_PSEA7       -------MGIFDWKHWIVILIVVVLVFG-TKRLKNLGSDVGEAIKGFRKAVNTEE-----
TATA_PSE14       -------MGIFDWKHWIVILIVVVLVFG-TKKLKGLGSDVGESIKGFRKAMNDD------
TATA_PSEU2       -------MGIFDWKHWIVILIVVVLVFG-TKKLKGLGSDVGESIKGFRKAMNDD------
TATA_PSESM       -------MGIFDWKHWIVILIVVVLVFG-TKKLKGLGTDVGESIKGFRKAMHDD------
TATA_PSEF5       -------MGIFDWKHWIVILVVVVLVFG-TKKLKNLGTDVGESIKGFRKAMNDDEKP---
TATA_PSEPF       -------MGIFDWKHWIVILVVVVLVFG-TKKLKNLGTDVGESIKGFRKAMNDDEKP---
TATA_PSEFS       -------MGIFDWKHWIVILVVVVLVFG-TKKLKNLGTDVGESIKGFRKAMNDDEKP---
TATA_AZOVD       -------MGIFDWKHWLIILIVVVLVFG-TKRLKTLGSDIGEAIKGFRKAVNTEEGE---
TATA_STRMK       -------MGSFSIWHWLVVLAIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMRDED-----
TATA_STRM5       -------MGSFSIWHWLVVLAIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMRDED-----
TATA_XANAC       -------MGGFSIWHWLIVLVIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMHDDD-----
TATA_XANC5       -------MGGFSIWHWLIVLVIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMHDDD-----
TATA_XANOM       -------MGGFSIWHWLIVLVIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMHDDD-----
TATA_XANOP       -------MGGFSIWHWLIVLVIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMHDDD-----
TATA_XANCP       -------MGSFSIWHWLIVLVIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMHDDD-----
TATA_XANC8       -------MGSFSIWHWLIVLVIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMHDDD-----
TATA_XANCB       -------MGSFSIWHWLIVLVIVLLVFG-TKRLTSGAKDLGSAVKEFKKGMHDDD-----
TATA_XYLFM       -------MGSFSLLHWLVVLVIVLLVFG-TKRLANGAKDIGSAIKEFKKSLHEDD-----
TATA_XYLF2       -------MGSFSLLHWLVVLVIVLLVFG-TKRLANGAKDIGSAIKEFKKSLHEDD-----
TATA_XYLFT       -------MGSFSLLHWLVVLVIVLLVFG-TKRLANGAKDIGSAIKEFKKSLHEDD-----
TATA_XYLFA       -------MGSFSLLHWLVVLVIVLLVFG-TKRLANGAKDIGSAIKEFKKSLREDD-----
TATA_ACIB5       -------MAGLSIWHVVIFAIVVILLFG-TSKLKNIGKDVGGAVRDFKKSVREED-----
TATA_ACIB3       -------MAGLSIWHVVIFAIVVILLFG-TSKLKNIGKDVGGAVRDFKKSVREED-----
TATA_ACIBC       -------MAGLSIWHVVIFAIVVILLFG-TSKLKNIGKDVGGAVRDFKKSVREED-----
TATA_ACIBT       -------MAGLSIWHVVIFAIVVILLFG-TSKLKNIGKDVGGAVRDFKKSVREED-----
TATA_ACIBY       -------MAGLSIWHVVIFAIVVILLFG-TSKLKNIGKDVGGAVRDFKKSVREED-----
TATA_ACIBS       -------MAGLSIWHVVIFAIVVILLFG-TSKLKNIGKDVGGAVRDFKKSVREED-----
TATA_RHILW       -------MGSFSMWHWLIVLVIVLLLFG-RGKIPELMGDVAKGIKSFKKGMTDED-----
TATA_RHIL3       -------MGSFSMWHWLIVLVIVLLLFG-RGKIPELMGDVAKGIKSFKKGMTDED-----
TATA_RHIE6       -------MGSFSMWHWLIVLVIVLLLFG-RGKIPELMGDVAKGIKSFKKGMTDDD-----
TATA_RHIEC       -------MGSLSMWHWLIVLVIVLLLFG-RGKIPELMGDVAKGIKSFKKGMTDED-----
TATA_AGRFC       -------MGSFSVWHWLIVLVIVLVLFG-RGKIPELMGDVAKGIKSFKKGMADEDQT---
TATA_AGRVS       -------MGSFSMWHWLIVLAIVLLLFG-RGKIPELMGDVAKGIKSFKKGMSDDDTA---
TATA_AGRRK       -------MGSLSIWHWLIVLAIALLLFG-RGKIPELMGDVAKGIKSFKKGMNDDEET---
TATA_BRUAB       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMADED-----
TATA_BRUA1       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMADED-----
TATA_BRUC2       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMADED-----
TATA_BRUME       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMADED-----
TATA_BRUMB       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMADED-----
TATA_BRUSU       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMADED-----
TATA_BRUSI       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMADED-----
TATA_OCHA4       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKQGMSDED-----
TATA_RHIME       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKKGMGDDE-----
TATA_SINMW       -------MGSFSIWHWLIVLAVVLLLFG-RGKIPELMGDVAKGIKNFKKGMSDED-----
TATA_SINFN       -------MGSFSIWHWLIVLVVVLLLFG-RGKIPELMGDVAKGIKNFKKGMTDEE-----
TATA_CHESB       -------MGSFSIWHWLIVLVVVLLLFG-RGKIPELMGDMAKGIKNFRKGMTDE------
TATA_RHILO       -------MGSFSIWHWMIVLVIVLLVFG-RGKIPELMGDMAKGIKSFKKGMADDD-----
TATA_RHORT       -------MGFSSIWHWIIVLVVVLLLFG-AGKIPRLMGDVAKGVKAFKKGMADDEDD---
TATA_AZOC5       -------MGSMSIWHWIVVLAVVLLLFG-RGKISDLMGDVAKGIKSFKKGMAEDDD----
TATA_XANP2       -------MGSLSIWHWIVVLAVVLLLFG-RGKISDLMGDVAKGIKSFKKGLAEDDEP---
TATA_BRASB       -------MGSLSIWHWIVVIAVVLLLFG-RGKISDLMGDVAQGIKAFKKGMQDDDK----
TATA_BRASO       -------MGSLSIWHWIVVIAVVLLLFG-RGKISDLMGDVAQGIKAFKKGMQDDDK----
TATA_BRADU       -------MGSLSIWHWILVIAVVLLLFG-RGKISDLMGDVAQGIKAFKKGMQDDDK----
TATA_RHOPA       -------MGSLSIWHWIVVIAVVLLLFG-RGKISDLMGDVAQGIKSFKKGLQDDEK----
TATA_RHOPT       -------MGSLSIWHWIVVIAVVLLLFG-RGKISDLMGDVAQGIKSFKKGLQDDEK----
TATA_RHOPB       -------MGSLSIWHWIVVIGVVLLLFG-RGKISDLMGDVAQGIKSFKKGLQDDEK----
TATA_RHOP5       -------MGSLSIWHWLVVIVVVLLLFG-RGKISDLMGDVAQGIKSFKKGLQDDDK----
TATA_RHOPS       -------MGSLSIWHWIVVIAVVLLLFG-RGKISDLMGDVAQGIKSFKKGLQDDEK----
TATA_RHOP2       -------MGSLSIWHWIVVIAVVLLLFG-RGKISDLMGDVAQGIKSFKKGLQDDEK----
TATA_NITHX       -------MGSLSIWHWIVVIAVILLLFG-RGKISDLMGDVAQGIKAFKKGMQDDEK----
TATA_NITWN       -------MGSLSIWHWIVVVAVILLLFG-RGKISDLMGDVAQGIKAFKKGMKDDEK----
TATA_METC4       -------MGSMSVWHWVIVAVVVMLLFG-RGKVSELMGDVAKGIKAFKKGMADDETQ---
TATA_METEP       -------MGSMSVWHWVIVAVVVMLLFG-RGKVSELMGDVAKGIKAFKKGMADDETQ---
TATA_METPB       -------MGSMSVWHWVIVAVVVMLLFG-RGKVSELMGDVAKGIKAFKKGMADDETQ---
TATA_METRJ       -------MGSMSIWHWVIVAVIVMLLFG-RGKVSDLMGDVAKGIKAFKKGMAEDETP---
TATA_METNO       -------MGGASIWHWIVVGVIVMLLFG-RGKVSELMGDVAKGIKAFKKGMADEDQPQA-
TATA_METS4       -------MGGASIWHWIVVGVIVMLLFG-RGKVSELMGDVAKGIKAFKKGMADEDQPQA-
TATA_SPHWW       -------MGSMSIWHWLVVGVLVLLLFG-KGRFSDMMGDVAKGIKSFKKGMSEEDEP---
TATA_SPHAL       -------MGSFSIWHWLVVGILVLLLFG-KGRFSDMMGDVAKGIKSFKKGMSEDDAP---
TATA_ZYMMO       -------MGGMSITHWIVVAVVVMIFFG-KGRFSDMMGDVAKGIKSFKKGMSEDDTT---
TATA_PELUB       --------MSIGIWQIAIVVILVVLLFG-RGKISSLMGDVAKGIKSFKKGMATDITD---
TATA_BEII9       -------MGSLSLWHWIIVGAVLLLLFGGKGKVSDIMGDVAKGIKSFKKGLSEDDEK---
TATA_METSB       -------MGSLSIWHWLIVGAVVLLVFGGKGKISDIMGDVAKGIKSFKRGLSEDEEK---
TATA_CAUVC       -------MGSMSWIHWVIVLGIVALLFGGRGKLSSIMGDAAKGIKAFKDGLKDESSS---
TATA_CAUVN       -------MGSMSWIHWVIVLGIVALLFGGRGKLSSIMGDAAKGIKAFKDGLKDESSS---
TATA_CAUSK       -------MGGMSWIHWVIVIAVVALLFGGRGKLSGIMGDAAKGIKAFKDGLKDDSSD---
TATA_PHEZH       -------MGSFSIWHWLIVLVVVALLFGGRGRLSGIMGDAAKGIRAFRDGLKGES-----
TATA_GLUDA       -------MGSLSIWHWLIVLAVVLVLFVGGGKISTLMGDVARGVKSFKKNMADDETM---
TATA_GLUOX       -------MGSMSPVHWLILAVVLLVVFGGGGKISGLMGDFAKGIKSFKKNMADDESM---
TATA_OLICO       -------MG-LSFQHILILLVVVLLLFG-RNKISDLMGDFAKGIKAFKKGMSDDEVE---
TATA_ERYLH       -------MGQIGIWQILIIALVILVLFG-RGKISDMMGDFGKGVSSFKKGLNEED-----
TATA_NOVAD       -------MGGLSLPHLIVLALVVLILFG-RGRISEMMGDFGKGIKSFKQGMNDEDS----
TATA_BARHE       ------MGNIFSPTHLIVILLIIIVLFG-RGKVSELMGDVAKGIKAFKKNMKDEEDILED
TATA_BARQU       ------MGNIFSPTHLIVILLIVLVLFG-RGKVSELMGDVAKGIKAFKKNMKEEGELLED
TATA_BART1       ------MGNIFSPTHLIIILLLILLLFG-RGRVAELMGDVAKGIKAFKKNMKEEEESIED
TATA_RICRO       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKDDG-----
TATA_RICRS       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKDDG-----
TATA_RICAE       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGLKDDG-----
TATA_RICCN       ------MGMSLS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKDDG-----
TATA_RICM5       ------MGMSVS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKDDG-----
TATA_RICPU       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKDDG-----
TATA_RICAH       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKNGMQDDG-----
TATA_RICCK       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKDDG-----
TATA_RICFE       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKDEG-----
TATA_RICPR       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKEGMKDDG-----
TATA_RICTY       ------MGMSFS--HLLIVLLIIFVLFG-AGKLPQVMSDLAKGLKAFKEGMKDDG-----
TATA_RICBR       ------MGMSFS--HLLIILLIIFVLFG-AGKLPQVMSDLAKGLKAFKDGMKED------
TATA_ANADE       ------MF-GLRMPELLLILAIVVILFG-ASRLPALGAGLGQGIRSFKKAFGGEDEKPT-
TATA_ANADF       ------MFPKLGMGELVVILLIVVILFG-ASKLPQLGAGLGQGIRSFKKSFSGEDEE---
TATA_DEHMB       -------MPKIGPMEILIIVLLVVVVFG-VGKLPQVGDAIGKGIRNFRKASTGEDAKE--
TATA_DEHMC       -------MPKIGPMEILIIVLLVVVVFG-VGKLPQVGDAIGKGIRNFRKASTGEDAKE--
TATA_DEHM1       -------MPKIGPMEILIIVLLVVVVFG-IGKLPQVGDAIGKGIRNFRKASSGEEEKE--
TATA2_AQUAE      -----MFPGGISMTELIIILAVILLLFG-AGRLPEAGRALGEGIRNFRKALSGETEVKE-
TATA1_AQUAE      ----MHFPLPW---QLILILLVILVIFG-ASKLPEVGKGLGEGIRNFKKALSGEEE----
TATA_RUBXD       -----MIPANFGGTELIILLVIILLLFG-AKRIPELARGLGTGVREFRKGTSGAYEELE-
TATA_SULSY       -------MGSIGMTELLLIFGIIVLLFG-AKKLPEIGRGLGEGIRSFKSAISGEEKKED-
TATA_WOLPP       --------MSLGPWQLFLVLIIILVLFG-AGRLPQVMGDLGKGIKNLKQELK----DSE-
TATA_WOLPM       --------MSLGPWQLFLVLIIILVLFG-AGRLPQVMGDLGKGIKNLKQELK----DSE-
TATA_WOLTR       --------MSLGPWQLFLVLIIILVLFG-AGRLPQVMGDLGKGIKNLKQELK----DSE-
TATA_EHRRW       --------MALGPWQIFLILVIILVLFG-AGKLPDVMSDLGKGIRNLKQELK----DN--
TATA_LEPIN       MFAPLAVFGSLGWTEILLILFIALLLFG-GKRLPSLAKDLGDGIRSFRKSLTGESDDSS-
TATA_LEPIC       MFAPLAVFGSLGWTEILLILFIALLLFG-GKRLPSLAKDLGDGIRSFRKSLTGESDDSS-
TATA_CHLCH       -------MFGLGGQELVLILLIVLLLFG-AQKLPELAKGLGKGMKEFKRAQNEIE-----
TATA_CHLTE       -------MFGLGGQELVLILLIVLLLFG-AQKLPELAKGLGKGIKEFKKAQNEIE-----
TATA_CHLPB       -------MFGLGGQELVLILLIILLLFG-AKKLPELAKGLGKGMKEFKKAQSEIE-----
TATA_CHLPD       -------MFGLGGQELVLILLIILLLFG-AKKLPELARGLGRGMKEFKKAQTEIE-----
TATA_PELPB       -------MFGLGGQELILILLIILLLFG-AKKLPELARGLGKGMKEFKKAQTEIE-----
TATA_CHLL2       -------MFGLGGQELILILLIILLLFG-AKKLPELARGLGKGMKEFKKAQTEIE-----
TATA_PELLD       -------MFGLGGQELILILMIILLLFG-AKKLPELAKGLGKGMKEFKKAQNEME-----
TATA_PROA2       -------MFGLGGQELLLILLIILLLFG-AKKLPELAKGLGKGMKEFKKAQTEIE-----
TATA_CHLPM       -------MFGLGGQELILILLIILLLFG-AKKLPELAKGLGRGMKEFKKAQTEIE-----
TATA_DEIDV       -------MLGFGPFELILIVVIIALLFG-ARKLPELGKGMGRGIKEFKQEMHEPSPPRP-
TATA_DESAH       ------MIGGLGMPELIIILVIILIIFG-AGKLPEIGSGIGKGIKNFKKATRDAE-----
TATA_SYNFM       ------MIGGIGMPELIVILVIVLIIFG-AGRLPELGAGLGKGIKNFRKATSELE-----
TATA_GEOMG       -------MFGIGMPELIVILVIVLVVFG-AGRLPEIGGALGKSIRNFKKASDGKD-----
TATA_SYNAS       -------MFGIGMPEMLIILVIILIIFG-AGKLPEIGGAIGKGIKNFKKASNESE-----
TATA_DESVH       -------MFGIGFQELLVVLVLVLLVFG-ANKLPEIGGGLGRAIRNFKRAASEPD-----
TATA_DESVM       -------MFGIGIQELLVVLVLVLLVFG-ANKLPEIGGGLGRAIRNFKRATSEPD-----
TATA_DESAG       -------MFGIGIPELLVIFVLILLVFG-AKRLPEIGGGLGRAIKNFKKATTEPD-----
TATA_DESAD       -------MFGLGITEILLILGIIILIFG-AKKLPEVGSGLGRAIQNFKKASSESE-----
TATA_MAGMM       -------MFGLGTMEMVIILVIVLVIFG-AGKLPKVMGDMGRGVKSFKKAMNAED-----
TATA_CHLAA       ------MIGGLGWGELLIILIIVIAIFG-AGKLAGLGGALGSSIREFRKAVKGDD-----
TATA_ROSS1       -------MPQLGMGELLIILIIVLLLFG-ASRITGVASALGGSIKAFRKAVRDDD-----
TATA_HERA2       -------MAGLGVTELLIILAIVIVLFG-ASRIGDLGGAMGRGIREFRRGVRDED-----
TATA_CAMC1       ------MGSF-SIGHWLIVLAIIVLLFG-AKKIPELAKGLGKGIKTFKAEMEDTTPE---
TATA_CAMFF       ------MGSF-SMGHWLIVLAIIVLLFG-AKKIPELAKGVGKGIKTFKKEMEDETP----
TATA_CAMC5       -------MAI-GVNQLLIILVIIVLLFG-AKKIPELAKGLGKGIKSFKAEMEDDKP----
TATA_CAMJE       -----MGGWS-SPSHWLIILLIVVLLFG-AKKIPELAKGLGKGIKTFKDEMNNDDE----
TATA_CAMJR       -----MGGWS-SPSHWLIILLIVVLLFG-AKKIPELAKGLGKGIKTFKDEMNNDDE----
TATA_CAMJD       -----MGGWS-SPSHWLIILLIVVLLFG-AKKIPELAKGLGKGIKTFKDEMNNDDE----
TATA_CAMJJ       -----MGGWS-SPSHWLIILLIVVLLFG-AKKIPELAKGLGKGIKTFKDEMNNDDE----
TATA_CAMJ8       -----MGGWS-SPSHWLIILLIVVLLFG-AKKIPELAKGLGKGIKTFKDEMNNDDE----
TATA_CAMLR       ------MHMP-SGTQWLIILLIVVLLFG-AKKIPELAKGLGKGIKTFKDEMNTEDDKKI-
TATA_NITSB       ------MGMP-SMPELLIILLIVVLLFG-AKKIPELAKGLGSGIKNFKKAMK-EDEE-E-
TATA_WOLSU       ------MGMP-SMPELLVILAIVVLLFG-AKKIPDLAKGLGSGIKNFKKAMK-EDEESE-
TATA_SULDN       ------MGMP-SGQELLIILAIVVLLFG-AKKIPELAKGIGKGIKNFKAEMKNEDDDTE-
TATA_SULNB       ------MGMP-SMPELLIVLAIVVLLFG-AKKIPDLAKGMGKGIKDFKKAIKEDDEEEE-
TATA_HELHP       ------MHPP-SITQLLIILLIIVLLFG-AKKIPELAKGLGSGIKNFKKAVKEDEEDNQ-
TATA_FLAJ1       ------MGRL-GLTEILVIVGIVILLFG-GKKIPELMKGLGSGIKEFKNAAKDDQP----
TATA_FLAPJ       ------MGRL-GVTEILMILAVVLLLFG-GKKIPELMKGLGSGLSEFKKAAKGDE-----
TATA_HELPY       ------MGGFTSIWHWVIVLLVIVLLFG-AKKIPELAKGLGSGIKNFKKAVKDDEEEAK-
TATA_HELP2       ------MGGFTSIWHWVIVLLVIVLLFG-AKKIPELAKGLGSGIKNFKKAVKDDEEEAK-
TATA_HELPH       ------MGGFTSIWHWVIVLLVIVLLFG-AKKIPELAKGLGSGIKNFKKAVKDDEEEAK-
TATA_HELPJ       ------MGGFTSIWHWVIVLLVIVLLFG-AKKIPELAKGLGSGIKNFKKAVKDDEEEAK-
TATA_HELPS       ------MGGFTSIWHWVIVLLVIVLLFG-AKKIPELAKGLGSGIKNFKKAVKDDEEEAK-
TATA_HELAH       ------MGGFTSIWHWVIVLLVIVLLFG-AKKIPELAKGLGSGIKNFKKAVKDDEEEAK-
TATA_TROW8       ------MGNVFSGWHLLVILLVIVLLFG-TSRLPKLSKSVVEALKIFRRSFNEASDITR-
TATA_KORVE       ------MFGELGVPEVLFILGIALLIFG-PKKLGDLGKGLGEGVRGFKSALRDE------
TATA_GLOVI       ------MPFGLGLPEILVIGVIALLIFG-PKKLPEMGSALGKAIRGFKSGVSDE------
TATA_ALKMQ       ------MFGKLGMPELVLIFAVALVIFG-PSKLPEIGKSLGKSIKEFKKFSKEM------
TATA_ALKOO       ------MFGKLGTSELVLILGIALIIFG-PGKLPELGKSLGKAISEFKSFSKEV------
TATA_BACAN       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACAA       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACAC       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACC3       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACC7       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACC0       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACC1       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACCR       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACC4       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACC2       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACCQ       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACCZ       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACAH       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACHK       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACMK       ------MFSNIGFPGLILILVAVLILFG-PKKLPEIGKALGETLKEFKKSTKEL------
TATA_BACCN       ------MLSNIGFPGLILILVAILILFG-PKKLPEIGRSLGETLKEFKKSTREL------
TATA_ANOFW       ------MLSNIGVPGLILILVIALVIFG-PKKLPEIGRAFGETLREFKKSTKGL------
TATAD_BACSU      ------MFSNIGIPGLILIFVIALIIFG-PSKLPEIGRAAGRTLLEFKSATKSL------
TATA_NATTJ       ------MFGRIGLPEILLILAIALIIFG-PKKLPELGKALGSSLREFKSATKEL------
TATA_BACSK       -------MGGLSVGSVVLIALVALLIFG-PKKLPELGKAAGSTLREFKNATKGL------
TATAY_BACSU      --------MPIGPGSLAVIAIVALIIFG-PKKLPELGKAAGDTLREFKNATKGL------
TATA_MOOTA       -------MFGLGAPELILILILALIIFG-PGKLPEVGRALGKGIREFKNATNSV------
TATA_PROMS       -----MNIFGVGLPEVTVILILALLIFG-PKKLPELGKQLGKTLKSLKKASNEF------
TATA_PROM2       -----MNIFGVGLPEVTVILILALLIFG-PKKLPELGKQLGKTLKSLKKASNEF------
TATA_PROM0       -----MNIFGVGLPEVTVILILALLIFG-PKKLPELGKQLGKTLKSLKKASNEF------
TATA_SYNE7       -----MNFFGIGLPEMLVILAIALLVFG-PKKLPEIGRSLGKALRGFQDASREF------
TATA_SYNP6       -----MNFFGIGLPEMLVILAIALLVFG-PKKLPEIGRSLGKALRGFQDASREF------
TATA_THEEB       -----MNVFGIGLPELIVILVVALLIFG-PKKLPEIGRSLGKTKRAFEEASREF------
TATA_TRIEI       -----MNIFGIGLPEMIVILVVALLIFG-PKKLPEIGRSLGQAINSFKAGARDF------
TATA_BDEBA       -------MGEFSLTHILLLAVIFLIFFG-PSRLPQLGQSMGKAIRGFKQGLNEIDVD---
TATAC_BACSU      --------MELSFTKILVILFVGFLVFG-PDKLPALGRAAGKALSEFKQATSGL------
TATA_COREF       --------MSLGPWEIAIIVLLIIVLFG-AKKLPDAARSIGRSMRIFKSEVKEMQKD---
TATA_CORGL       --------MSLGPWEIGIIVLLIIVLFG-AKKLPDAARSIGRSMRIFKSEVKEMNKD---
TATA_CORGB       -------MTPAGPAQLLIVALVVIVLFG-SNKLPDVARSVGRSMRIFKSEIKEMNKD---
TATA_CORDI       --------MNLGPTEILLILVIVVLLFG-AKKLPDAARSLGRSMRIFKSEVKEMSND---
TATA_CORJK       -------MPNLGVPELLIIALVIFLLFG-ATRLPNAARSLGRSMRIFKSEMDEMKTD---
TATA_CORK4       -------MANLGFPELVLIAVVILVLFG-WKKLPDAARSVGRSMRIFKSEVSEMKND---
TATA_STRAW       ------MFGRLGAPEIILILVVIILLFG-AKKLPDMARSLGKSARILKSEAKAMK-----
TATA_STRCO       ------MFGRLGAPEIILILVVIILLFG-AKKLPDMARSLGKSARILKSEAKAMK-----
TATA_STRGG       ------MIGNLKPLEIVLIIAVILLLFG-AKKLPDMARSLGKSARILKSEAKAMKKD---
TATA_RHOOB       -------MGAMSPWHWAIVALVVVILFG-SKKLPDAARGLGRSLRIFKSEVKEMQND---
TATA_RHOJR       -------MGAMSPWHWAIVALVVIILFG-SKKLPDAARGLGRSLRIFKSEVKEMQND---
TATA_RHOER       -------MGAMSPWHWAIVALVVVILFG-SKKLPDAARGLGRSLRIFKSEVKEMQND---
TATA_RHOE4       -------MGAMQPMHWLIVAVVVVILFG-SKKLPDAARGLGRSLRIFKSEVKEMQND---
TATA_NOCFA       ------MSGTFSWTHLLIIALLFVVLFG-AKRLPDAARGLGRSLRIFKSEVNQMQHE---
TATA_FRACC       -------MGDIGAPELIIIILVVVVLFG-SKRLPDAARSLGRSLRIFKSEIKGLHDD---
TATA_MYCA1       -------MGSLSPWHWAILAVVVILLFG-AKKLPDAARSLGKSMRIFKSELREMQSE---
TATA_MYCPA       -------MGSLSPWHWAILAVVVILLFG-AKKLPDAARSLGKSMRIFKSELREMQSE---
TATA_MYCBO       -------MGSLSPWHWAILAVVVIVLFG-AKKLPDAARSLGKSLRIFKSEVRELQNE---
TATA_MYCBP       -------MGSLSPWHWAILAVVVIVLFG-AKKLPDAARSLGKSLRIFKSEVRELQNE---
TATA_MYCBT       -------MGSLSPWHWAILAVVVIVLFG-AKKLPDAARSLGKSLRIFKSEVRELQNE---
TATA_MYCTU       -------MGSLSPWHWAILAVVVIVLFG-AKKLPDAARSLGKSLRIFKSEVRELQNE---
TATA_MYCTA       -------MGSLSPWHWAILAVVVIVLFG-AKKLPDAARSLGKSLRIFKSEVRELQNE---
TATA_MYCMM       -------MGSLSPWHWAILAVVVIVLFG-AKKLPDAARSLGKSMRIFKSEMREMQSE---
TATA_MYCUA       -------MGSLSPWHWAILAVVVIVLFG-AKKLPDAARSLGKSMRIFKSEMREMQSE---
TATA_MYCLE       -------MGSLSPWHWVVLVVVVVLLFG-AKKLPDAARSLGKSMRIFKSELREMQTE---
TATA_MYCGI       -------MGGLQPWHWLIVIAVFVLLFG-AKKLPDAARSLGKSMRIFKSEIKEMQSD---
TATA_MYCVP       -------MGGLQPWHWVIVIAVFVLLFG-AKKLPDAARSLGKSMRIFKSEIKEMQAD---
TATA_MYCSJ       -------MGGLQPWHWVIVIAVFVLLFG-AKKLPDAARSLGKSMRIFKSEIKEMQSE---
TATA_MYCSK       -------MGGLQPWHWVIVIAVFVLLFG-AKKLPDAARSLGKSMRIFKSEIKEMQSE---
TATA_MYCSS       -------MGGLQPWHWVIVIAVFVLLFG-AKKLPDAARSLGKSMRIFKSEIKEMQSE---
TATA_MYCS2       -------MGGLQPWHWVIVIAVFVLLFG-AKKLPDAARSLGKSMRIFKSEIKEMQAE---
TATA_SALAI       -------MGALKPWHIAVLVVVLILLFG-AKRLPDAARSLGRSLRIIKAETKSLHDD---
TATA_SALTO       -------MGALRPWHIAVLVVVLILLFG-AKRLPDAARSLGRSLRIIKAETKSLHDD---
TATA_LEIXX       ------MLGGLTGWHLLIILAVILLLFG-APKLPALAKSVGQSMRIFKGEVNEMKKD---
TATA_MICLC       -------MAGLQGWQLVIIILLAILLFA-APKLPAMARNLGQSMRIFSSEVKQMRTE---
TATA_SACEN       -------MGLPGGWELVLIVGVLVLLFG-ATKLPQMARSLGQSARVFKAEARGMKED---
                                  ..      .*    :.             :             

TATA_LEGPL       ---ETN------DTQK-----------------DDHKP------S---------------
TATA_LEGPA       ---ETN------DTQK-----------------DDHKP------S---------------
TATA_LEGPC       ---ETN------DTQK-----------------DDHKP------L---------------
TATA_PSEHT       ---KNT------DKEKPEQIQKS----------EESAP------LDSAH---TEKNKDNN
TATA_HAHCH       ---ESE------EDKEPKKLSQN----------ESRTI------EGSVE---RNDAKTES
TATA_ACTPJ       --KSQP-----QDASFEKV-EAK----------EAAS--------TEQK----AKEK--E
TATA_ACTP2       --KSQP-----QDASFEKV-EAK----------EAAS--------TEQK----AKEK--E
TATA_ACTP7       --KSQP-----QDASFEKV-EAK----------EAAS--------TEQK----AKEK--E
TATA_HAEDU       --KSQ-------DANFDKV-EAK----------ESTS--------TTEK----TKEK--E
TATA_HAEPS       --KAK-------DAEFEKV-EQK----------TAES--------TEQK----AKEK--E
TATA_MANSM       --EPK-------DAEFKSLNKDE----------SATA--------GSEK----VKDK--E
TATA_PASMU       --KEK-------DAEFKSLSDDS----------ETTA--------KTEK----AKDK--E
TATA_ACTSZ       ---PK-------DAEFKSLDKAE----------NTAQ--------TKKE----EKEK--E
TATA_ECOLI       KQDKTS-----QDADFTAKTIAD----------KQADTNQEQAKTEDAK----RHDK--E
TATA_ECO57       KQDKTS-----QDADFTAKTIAD----------KQADTNQEQAKTEDAK----RHDK--E
TATA_ECOL6       KQDKTS-----QDADFTAKTIAD----------KQADTNQEQAKTEDAK----RHDK--E
TATA_SHIFL       KQDKTS-----QDADFTAKTIAD----------KQADTNQEQAKTEDAK----RHDK--E
TATA_SALTI       KQDKTS-----QDADFTAKSIAD----------KQGE-----AKKEDAK----SQDK--E
TATA_SALTY       KQDKTS-----QDADFTAKSIAD----------KQGE-----AKKEDAK----SQDK--E
TATA_SODGM       SSDKSS-----QDADFTAPPIEP----------KANL-----ACPDEAK----NKDK--E
TATA_PHOLL       QAQKTS-----SDADFETKNITE----------KQSV-----AQSETSE----SKNK--E
TATA_PROMH       NAEKTT-----NDADFDTKNLAQ----------KTST-----EEKSTTE----SKNK--E
TATA_YERPE       NVDKTS-----NDADFAKSITEK----------QQPV-----AKAEESK----SHEK--E
TATA_ALIF1       -EPAKE---AKKDADFVPQNLEK----------KEAET------VEKQK----QNDK--E
TATA_ALIFM       -EPAKD---AKKDADFVPQNLEK----------KEAET------VEKQK----QNDK--E
TATA_ALISL       -ESAKD---AKKDADFVPQNLEK----------KEAET------VEKQK----QNDK--E
TATA_VIBVU       -ESE------KKDADFEPKSLE-----------QQSKQ------AATES----KKDK--E
TATA_VIBVY       -ESE------KKDADFEPKSLE-----------QQNKQ------AATES----KKDK--E
TATA_VIBCH       -ESNSAA--NQKDADFETKNLE-----------QAKTN------ASAEV----KKDK--E
TATA_VIBCB       -EPAKK---DDKDADFEPKSLEE----------QQKKE------AAPES----KKDK--E
TATA_VIBPA       -DSAK----NEKDADFEPKSLEK----------QQQKE------AAPET----KKDK--E
TATA_VIBTL       -DKPAD----KKDADFEPKNIE-----------QQKTE------ASAETTAETKKDK--E
TATA_PHOPR       -ELTVKKDNTEADADFEQKTLSK----------EEQQS------EDPVQ--KSQKDK--E
TATA_SHEB5       -EDKKA--LEDTEAAK---TAQT----------TQQAT------EKKPE----SNK---E
TATA_SHEB8       -EDKKA--LEDTEAAK---TAQT----------TQQAT------EKKPE----SNK---E
TATA_SHEB9       -EDKKA--LEDTEAAK---TAQT----------TQQAT------EKKPE----SNK---E
TATA_SHEB2       -EDKKA--LEDTEAAK---TAQT----------TQQAT------EKKPE----SNK---E
TATA_SHEPC       -EDKKA--LEDTEAAK---TAQT----------TQQAT------EKKPE----SNK---E
TATA_SHESW       -EDKKA--LEDTEAAK---TAQT----------TQQAT------EKKPE----SNK---E
TATA_SHESM       -EDKKA--LEDAEAAKPVQTAQT-------AQPTQQAT------EKKPE----SNK---E
TATA_SHESR       -EDKKA--LEDAEAAKPVQTAQT-------AQPTQQAT------EKKPE----SNK---E
TATA_SHESA       -EDKKA--LEDAEAAKSVQTAQT-------AQPTQQAT------EKKPE----SNK---E
TATA_SHEON       -EDKKA--LEDAEAAKPVQTAQTVQS----AQPTQQAT------EKKPE----SNK---E
TATA_SHEAM       -EEKKA--LEDKEAAA-----QT----------TQQAT------EKKPE----ADKK--E
TATA_SHEFN       -DENKS--LDDKEKDQ---TAAT----------SQQAA------EKQPE----TESKD-K
TATA_SHEHH       -EDKKA--LEDNAADKPAADAAKVTE----TAKVAETAPVAETAEKKAE----SKGK--E
TATA_SHEPA       -EEKKA--LEENATDKPAADTAKVTE----TAKVAETA------EKKAE----SKGK--E
TATA_SHEPW       -EEKKA--LEDSAAEKKAEST--------------DTA------EKKAE----SKDK--E
TATA_SHELP       -DEKKA--IEDTSAEKTAQTE-----------------------EKKTE----SKDK--E
TATA_SHESH       -EEKKA--IEDSASEKTAQTE-----------------------EKKTE----SKDKDKE
TATA_SHEDO       -EEKKA--LEDSQTAQTSQQA-----------------------EKKPE----SKDK--E
TATA_SHEWM       -EEKKA--LEETASEKATPSVEKTAP----NA------------EKKTE----TKDK--E
TATA_ALTMD       --EK--------DADFEQKKQVE---------EKSAAEPV----STETQ----SDVK--E
TATA_HYDCU       --DKKE------DEKVTAEQKLE---------QKEGENVF----DVKAE----QKAD--E
TATA_PSEMY       --EAEK------PAVEEPKGQ------------TIDAQAR----KVEEP----AKKD---
TATA_PSEST       --ETTT------QA---------------------EASSR----S---------------
TATA_SACD2       --EAAK------QEAEEAEQKKV---------AAEEAAAA----KTAEQ----KEKT--E
TATA_CHRSD       --EQKK-----QDGEETAQHRVA---------HDTNEEPLDTSSKATQSSGADEKSE--R
TATA_MARMS       --DTEA-----EDGK-TAQHKVI---------DADVKK--------------DDKSA---
TATA_ALCBS       --EDEQ-----DHKRLADDDQPQ---------NKQDAEQKAE----------QEKDK--A
TATA_MARHV       -KNAEQ----------QPLEKQN---------AEQQAQ-----AEDKPK----EKQG---
TATA_NITOC       -RDAEEAA---TIEHKQAHKAEN---------PSQRQQ-----ADADFK----IKSGNDE
TATA_HALHL       -EEAQKRADGESSDEPEPLEHQDE------PAPEQTTQ-----ARESSS----ARQSAEH
TATA_ALKEH       ----------AKEGEKSEPSKLE----------QPPEEEKESGEGHTIEGERSEQPRDRH
TATA_DICNV       --------------EPTEPEKLE----------QQPP---------VIEVVATQKEKTKG
TATA_METCA       --------------ENEDKPS--------------------EGGARTLEGEVVDK-KEKD
TATA_PSYIN       --------------EDNDKDSTQVDD----KDSTQVDDNAKQPSNKKVEENIKEQSKEKD
TATA_RUTMC       --------------EPADQIN---------------------TKDNIVEAKTTKESTK--
TATA_VESOH       --------------ESTDSIN---------------------NKDDIVEAKIIKKEIKQE
TATA_HAEIN       ----------VKDAEFKSIDNET----------ASAK-------KGKYKR---ERNRLNP
TATA_HAEIE       ----------VKDAEFKSIDNET----------ASAK-------KENIK----EKEQA--
TATA_HAES1       ----------PKDAEFKKISEEV----------EQTS-------VENSK----QKEQA--
TATA_HISS2       ----------PKDAEFKKISEEV----------EQTS-------VENSK----QKEQA--
TATA_LEPCP       ----------EADAAAAKAAEPA----------AQVS-------AEKRIDT--QTIDVEA
TATA_RHOFT       ----------AADAPAAAPQQVA----------SSAT-------AAK------ETIDVEA
TATA_DELAS       ------------TSTDTPAAA-------PGQVAGQTA--ADKT---TIDVEAKQKG----
TATA_METPP       ------------TAPADPAQ----------QVTANKS--ADAN---TVDVEAKQKS----
TATA_ACIAC       ------------TPEGTPASTTAATP-PAGQVTNQQAHAADPG---TIDVEAKHKG----
TATA_ACISJ       ------------STDD--SATTSA---PAGQVTNNSTA-ADKT---TIDVEAKHKS----
TATA_ACIET       ------------STDD--SATTSA---PAGQVTNNSAA-ADKT---TIDVEAKHKS----
TATA_VARPS       ------------TTDA--PAASSA---PAAQVTGQPAN-SDKS---TIDVEARQKS----
TATA_POLNA       ------------QSPA--DEKPVV---PASQVTNAQA--ADKAERNTIDVEARQKS----
TATA_POLSJ       ------------QSAAATDDKPAA---PAGQVTNAQA--SDKT---TIDVEARQKS----
TATA_VEREI       ------------TDTA-----------PAGQVANQST--ADQT----IDVQTKPKG----
TATA_BORBR       ------------ADKPADQVT---------QQRVSDD---------TIDVQAKEKSNS--
TATA_BORPA       ------------ADKPADQVT---------QQRVSDD---------TIDVQAKEKSNS--
TATA_BORPE       ------------ADKPADQVT---------QQRVSDD---------TIDVQAKEKSNS--
TATA_BORPD       ------------SDKPAEQVT---------QQKVADD---------TIDVQAKEKTNS--
TATA_BORA1       ------------ADK-TEQVT---------QQQT------------TIDVQAKEKQNS--
TATA_DECAR       ------------ADKPAEEAQP--------TQQVGGH---------TIDVEVKEKTKS--
TATA_CUPTR       ------------DKG-AQP--------AASKELRDST---------TIDVDAKEKSRQQ-
TATA_CUPNH       ------------GKAAADP--------AQSKELRDST---------TIDVEAKEKTRQQ-
TATA_CUPPJ       ------------DKA------------APAKELRDST---------TIDVDAKEKTRQQ-
TATA_CUPMC       ------------TDEPATP--------TPAKELRDST---------TIDVEAKEKSRQQ-
TATA_RALPJ       ------------EDKPAGSQQPQQTAGQPPRELHDAT---------TIDVEARDKSKQG-
TATA_RALSO       ------------EDKPAGSQQGQQAAGQPPRELHDST---------TIDVEARDKSKQG-
TATA_HERAR       ------------DDKPAAQNA-------APSQVADKG---------TVDVEVKEKSNS--
TATA_JANMA       ------------DDKPAAQNA-------APSQVADKG---------TVDVEVKEKSNS--
TATA_POLNS       ------------EEPKEQI---------QQSSATAEK---------TVDVQAKD-VNK--
TATA_POLAQ       ------------EDPNEQI---------PQSTTTAEK---------TVDVQAKD-INK--
TATA_AZOSB       ------------DAAADAS---------TQQKISGGQ---------TLEGEAREKVEKTH
TATA_AROAE       ------------EKSGEDV---------QQK--IGGD---------TLDAQATDKSHTVS
TATA_LARHH       ------------EDAAQTP---------PAAQKEGGR---------VIDAEPADKK----
TATA_THIDA       ------------DDAPKIS---------ESDK--GGH---------TIDAEVKDKQNS--
TATA_NITEU       ------------EESTPPP---------P-AQQVTGH---------SIKSEIEEKDQTKV
TATA_NITEC       ------------EENTQPP---------PSHQQVTGH---------SIKSEIEEKDQTKV
TATA_NITMU       ------------EEEI------------SAHNHTEAR---------IIDADIKDKAQSKS
TATA_BURCM       ------------TPA-DAQQ-----------LPRTGT----------VDVNAKETTRS-D
TATA_BURVG       ------------TPA-DAQQ-----------LPRTGT----------VDVNAKETTRS-D
TATA_BURA4       ------------TPA-DAQQ-----------LPRTGT----------VDVNAKETTRS-D
TATA_BURCA       ------------TPA-DAQQ-----------LPRSGA----------VDVNAKETTRS-D
TATA_BURCH       ------------TPA-DAQQ-----------LPRSGA----------VDVNAKETTRS-D
TATA_BURCC       ------------TPA-DAQQ-----------LPRSGA----------VDVNAKETTRS-D
TATA_BURCJ       ------------TPA-DAQQ-----------LPRSGA----------VDVNAKETTRS-D
TATA_BURL3       ------------APA-DAQQ-----------LPRSGS----------VDVNAKETTRS-D
TATA_BURM1       ------------APA-DAQQ-----------LPRSGT----------VDVNAKEATRS-D
TATA_BURMA       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURM9       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURM7       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURMS       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURPS       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURP0       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURP1       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURP6       ------------APA-DAQQ-----------LPRSGS----------VNVDAKDAARSSD
TATA_BURTA       ------------APA-DPQQ-----------LPRSGS----------VNVDAKDATRSSD
TATA_PARPJ       ------------APAAEAQQR--------E-LPRNGA----------VDVEAKEKTPRSG
TATA_PARXL       ------------TPAGEAQQR--------E-LPRNGA----------VDVDAKEKAPRSG
TATA_PARP8       ------------TP--EGQQR--------DQLSRTNT----------VDVDAKEKAPHSG
TATA_CHRVO       ------------KDG---QP------------PAKDA----------GRIIDGEADKK--
TATA_NEIG1       --------------------------------GTDG-----------KEAQKDDVIEHKK
TATA_NEIG2       --------------------------------GTDG-----------KEAQKDDVIEHKK
TATA_NEIM0       --------------------------------GTDG-----------KEAQKDDVIEHKK
TATA_NEIMA       --------------------------------GTDG-----------KEAQKDDVIEHKK
TATA_NEIMB       --------------------------------GTDG-----------KEAQKDDVIEHKK
TATA_PSYA2       ------------TEHAKKHVVL------DHDAGTNPPN--------ITGTQSDTTSANKV
TATA_PSEAE       -------DDKKDQPAAQPAQ------------PLNQPH--------TIDAQAQKVEEPAR
TATA_PSEA8       -------DDKKDQPAAQPAQ------------PLNQPH--------TIDAQAQKVEEPAR
TATA_PSEAB       -------DDKKDQPAAQPAQ------------PLNQPH--------TIDAQAQKVEEPAR
TATA_PSEA7       -------DDKKEQPAAQPAQ------------PLNQPH--------TIDAQAQKVEEPAR
TATA_PSE14       -------DKPAEQPAPQPQQAQAA----PQGSPLNQPH--------TIDAQAHKVDEPIR
TATA_PSEU2       -------DKPAEQPAPQPQQAQPA----PQGSPLNQPH--------TIDAQAHKVDEPIR
TATA_PSESM       -------DKPAEQPAPQPQQAQPA----PQGSPLNQPH--------TIDAQAHKVDEPIR
TATA_PSEF5       -------AEPVVPPAAQPVPPVQP----QQSAPLNQPH--------TIDVQAQKVEEPTR
TATA_PSEPF       -------ADPTVTPA-QPVPPVQP----QATAQANPPH--------TIDVQAQKVEEPIR
TATA_PSEFS       -------ADPVVNPV-PPAQPVHP----QATQPITERR--------TFDVQAEKVEEPTR
TATA_AZOVD       -------NRPAEPQTGTSAG-----------DTLNKTQ--------TIEGQAQKVDTPVR
TATA_STRMK       ------------KPNAQLGD-----------ESRTQDA--------SRTAQDEHDRNAR-
TATA_STRM5       ------------KPNAQLGD-----------ESRSQDA--------SRTAQDEHDRTPR-
TATA_XANAC       ------------KPAGKLGD-----------DSRTAEQ--------AREAQAERDRDAR-
TATA_XANC5       ------------KPAGKLGD-----------DSRTAEQ--------AREAQAERDRDAR-
TATA_XANOM       ------------KPAGKLGD-----------DSRTAEQ--------AREAQAERDRDAR-
TATA_XANOP       ------------KPAGKLGD-----------DSRTAEQ--------AREAQAERDRDAR-
TATA_XANCP       ------------KPAGKLGD-----------DSRSAEQ--------AREAQAERDRDAR-
TATA_XANC8       ------------KPAGKLGD-----------DSRSAEQ--------AREAQAERDRDAR-
TATA_XANCB       ------------KPAGKLGD-----------DSRSAEQ--------AREAQAERDRDAR-
TATA_XYLFM       ------------KPTDQLGS-----------TSQST----------ASGPQQDHGKH---
TATA_XYLF2       ------------KPTDQLGS-----------TSQST----------ASGPQQDHGKH---
TATA_XYLFT       ------------KPTDQLGS-----------TSQST----------ASGPQQDHGKH---
TATA_XYLFA       ------------KPTDQLGS-----------TSQST----------ASGPQQDHGKH---
TATA_ACIB5       ------------EAA----------------SLNSPR---------TIDAQVKTSESTSV
TATA_ACIB3       ------------EAA----------------SLNSPR---------TIDAQVKTSESTSV
TATA_ACIBC       ------------EAA----------------SLNSPR---------TIDAQVKTSESTSV
TATA_ACIBT       ------------EAA----------------SLNSPR---------TIDAQVKTSESTSV
TATA_ACIBY       ------------EAA----------------SLNSPR---------TIDAQVKTSESTSV
TATA_ACIBS       ------------EAA----------------SLNSPR---------TIDAQAKTSESTSV
TATA_RHILW       --------------APDTAK--------------TVDHK------ADETK----------
TATA_RHIL3       --------------APDTAK--------------TVDHK------ADETK----------
TATA_RHIE6       --------------APDTAK--------------TVDHK------ADETK----------
TATA_RHIEC       --------------APETAK--------------TVDHK------ADETK----------
TATA_AGRFC       --------PP-PADANANAK--------------TVDHK------ADEIK----------
TATA_AGRVS       --------PDGTPKPADQSK--------------TVDHR------ADDHK----------
TATA_AGRRK       --------PP--PAQSTTSR--------------TVEHK------ADESK----------
TATA_BRUAB       --------------AKEDPR--------------TIDAK------AEEPVKDV-KKTTKS
TATA_BRUA1       --------------AKEDPR--------------TIDAK------AEEPVKDV-KKTTKS
TATA_BRUC2       --------------AKEDPR--------------TIDAK------AEEPVKDV-KKTTKS
TATA_BRUME       --------------AKEDPR--------------TIDAK------AEEPVKDV-KKTTKS
TATA_BRUMB       --------------AKEDPR--------------TIDAK------AEEPVKDV-KKTTKS
TATA_BRUSU       --------------AKEDPR--------------TIDAK------AEEPVKDV-KKTTKS
TATA_BRUSI       --------------AKEDPR--------------TIDAK------AEEPVKDV-KKTTKS
TATA_OCHA4       --------------AKDDARDSGR----------TIDAK------ADETVNDV-KKTTKS
TATA_RHIME       --------------VASADK--------------SVDGK------TVDHKSDE-VR----
TATA_SINMW       --------------AAAADK--------------SIDGK------TVDHKSDE-VR----
TATA_SINFN       --------------AASADK--------------TIDGK------TVEHKSDE-VR----
TATA_CHESB       ---------------AEEAK--------------TVEHR------TDEPVGEVKQKASKS
TATA_RHILO       --------------VADDKR--------------TVEHR------ADETVSAVKEKASKS
TATA_RHORT       --------E--AASVSAERRG-------------IEDGK------PAQTIYPPQQPQQPQ
TATA_AZOC5       ----------APAKPAEPPR--------------AVPH-------QATPAPES-----EK
TATA_XANP2       --------AKTPAAPPEAPR--------------PLPH-------QTSSAAEA-----EK
TATA_BRASB       -----------APEKTEPVK--------------SIDH-------GATPSATR--TDVGS
TATA_BRASO       -----------APEKTEPVK--------------SIDH-------GATPSATR--TDVGS
TATA_BRADU       -----------PADKPEPAK--------------SIEH-------NAAPTAAR--SDVGS
TATA_RHOPA       -----------TAEKSEPVK--------------SIDH-------TSTPGATN-RTDVGS
TATA_RHOPT       -----------TAEKSEPVK--------------SIDH-------TSTPGATN-RTDVGS
TATA_RHOPB       -----------TAEKPEPVK--------------SIDH-------TAPPAAAP-RTDVGS
TATA_RHOP5       -----------TAEKTEPVK--------------SIDH-------AAPPASAP-RSDVGS
TATA_RHOPS       -----------TAEKPDPVK--------------SIDH-------NAPTAAAPTRTDVGS
TATA_RHOP2       -----------TAEKPDAVK--------------SLDH-------NATTGTPPNRTDVGS
TATA_NITHX       -----------TAEKPEPVK--------------TIDH-------NAPAPGAS-RSDVGS
TATA_NITWN       -----------TAEKPEPVK--------------TINH-------NADGSGAA-RSDTGS
TATA_METC4       ---PNTATSVPPVGPNDPVR--------------TLPHQGAPGTAPQPPHVQPHVSAGDH
TATA_METEP       ---PNTATSVPPVGPNDPVR--------------TLPHQGAPGTAPQPPHVQPHVPAGDH
TATA_METPB       ---PTNTTSVPPVGPNDPVR--------------TLPHQGAPGTAPQ----QTHVPAGDH
TATA_METRJ       ---PAVQAAPPPA---EPVR--------------TIPH--ATETSPGTAIPASHLPGGER
TATA_METNO       ---PVANQSPPPVSATEPVR--------------TLPP------HQGEPAPAANASV-DR
TATA_METS4       ---PVV--AAPPVTATEPVR--------------TLPP------HPTEPAPATHATV-DR
TATA_SPHWW       ----------TQPAEPRPTP--------------RLQQQ----PPIEPNADPKLQPMQDD
TATA_SPHAL       ----------TPAPK-------------------QIDAQ----RAPDLSATPTPTAETEN
TATA_ZYMMO       ----------PPAAPPAPAP--------------RLENQ----PLPPENTTQNVAQNVPN
TATA_PELUB       --------------EPEPKN--------------VSEN-------NQDSKDKE-------
TATA_BEII9       -----------PEAARPAEP---------------ARSL------DHQPVAEQPKVSETH
TATA_METSB       -----------AEAKPVGEP--------------SLRSL------DHQGAGDPLKTPDAR
TATA_CAUVC       -----------EVADNKAKS--------------ALPRT------EAEAEE--LRKS---
TATA_CAUVN       -----------EVADNKAKS--------------ALPRT------EAEAEE--LRKS---
TATA_CAUSK       -----------EVSANKATG--------------ALPRT------EAEKED--LRKS---
TATA_PHEZH       -----------EQAEDETAK--------------PLPK-------ERDKDS--ARG----
TATA_GLUDA       -----------EGSTGSG----------------GHIAP------PGPAAGTVQRDASFS
TATA_GLUOX       -----------TATDATQAP--------------GHISP------PNQNPGYSQTTSSET
TATA_OLICO       ------------TAKSDSIK--------------TIDNT------GKPTNVQANPQRQDS
TATA_ERYLH       -----------KP-AEPAAK---------------IEGPS----HEAKPAGEAAKDPRPA
TATA_NOVAD       -----------KPVTPPPAQ---------------IPPASL---QQTPPPAQPAPQPTST
TATA_BARHE       ---KLERAHHSETVDVEPQKFQSL----------SVKRATT--RVKGSSSSRKGKTSVVK
TATA_BARQU       ---KLEMSDYSKTTDVRPQQSQPL----------SVKRAAE--RRKGSSSFKEGKASVAK
TATA_BART1       ---KVEMADTSQVINEESQQSQPL----------SVKRAAI--RRKASSDSKGGKASIAK
TATA_RICRO       -----------------------------------------------------SDND--K
TATA_RICRS       -----------------------------------------------------SDND--K
TATA_RICAE       -----------------------------------------------------SDND--K
TATA_RICCN       -----------------------------------------------------SDND--K
TATA_RICM5       -----------------------------------------------------SDND--K
TATA_RICPU       -----------------------------------------------------SDNDNDK
TATA_RICAH       -----------------------------------------------------SDND--K
TATA_RICCK       -----------------------------------------------------NDND--R
TATA_RICFE       -----------------------------------------------------SDND--K
TATA_RICPR       -----------------------------------------------------NDND--K
TATA_RICTY       -----------------------------------------------------NDND--K
TATA_RICBR       ------------------------------------------------------DST--K
TATA_ANADE       -----------------------------------AS-----GNGSTPTQSSS-------
TATA_ANADF       -------------------------------------------KPSTPGATSS-------
TATA_DEHMB       -------------------------------------------EVETKEETKP-------
TATA_DEHMC       -------------------------------------------EVETKEETKP-------
TATA_DEHM1       -------------------------------------------EVETKEETKT-------
TATA2_AQUAE      -----------------------------------VKAEDVKTEERKEE--KK-------
TATA1_AQUAE      -------------------------------------------EKGKEV--KK-------
TATA_RUBXD       -----------------------------------EK----KGEEEKDEGGKKEAEASGR
TATA_SULSY       -----------------------------------EK--VVTPKEIEAEVIKK-------
TATA_WOLPP       -------------------------------------------KLSSNEPDR--------
TATA_WOLPM       -------------------------------------------KLSSNEPDR--------
TATA_WOLTR       -------------------------------------------KLSSNEPDR--------
TATA_EHRRW       -------------------------------------------KLASTEDESNL------
TATA_LEPIN       -------------------------------------------QQISQEQERSVPKEETK
TATA_LEPIC       -------------------------------------------QQISQEQERSVPKEETK
TATA_CHLCH       ------------------------------------------EEFNKSMDDNPKKE-KAT
TATA_CHLTE       ------------------------------------------EEFNKATDDSSSKE-KKE
TATA_CHLPB       ------------------------------------------EELNKAVDDTPEKE-KKS
TATA_CHLPD       ------------------------------------------EEFNKVVEEPPAKE-KTT
TATA_PELPB       ------------------------------------------EEFNSVVDEKPKKE-KTA
TATA_CHLL2       ------------------------------------------DEFNKVVDEPPRKTPENS
TATA_PELLD       ------------------------------------------DEFNKAMDDETPKKKDFG
TATA_PROA2       ------------------------------------------DEFNKAMSDPPEKKEKES
TATA_CHLPM       ------------------------------------------EEFNNAIEDTPAQKKETI
TATA_DEIDV       -----------------------------------QVTDIPSQRLDPVTGAPVSTESTVP
TATA_DESAH       -------------------------------------------LNE-GDKDDKEKEQEKL
TATA_SYNFM       -------------------------------------------SAATGEKKPEELEEKK-
TATA_GEOMG       -------------------------------------------EIE--IKPEKKDDPSK-
TATA_SYNAS       -------------------------------------------EID--ENSRPKKIEPK-
TATA_DESVH       -------------------------------------------EIDVTPT-DKKDKND--
TATA_DESVM       -------------------------------------------EIDITPG-KKNGKTDKD
TATA_DESAG       -------------------------------------------EIDVTPSSEKKHKDE--
TATA_DESAD       -------------------------------------------EIDVTPS-KDKNKDA--
TATA_MAGMM       -----------------------------------------DAPAEPEVSKPAAAESTEK
TATA_CHLAA       ---------------------------------------------EPRS------DAKTE
TATA_ROSS1       ---------------------------------------------VPASKSEPAESTDKK
TATA_HERA2       ---------------------------------------------ATAP------TDASK
TATA_CAMC1       --------------------------------------KSEKVE---HKEESATSQKIEE
TATA_CAMFF       ---------------------------------------VEKIE---KADSETQSTKQNE
TATA_CAMC5       ---------------------------------------IEKVE---KKGDDVVDAKVEE
TATA_CAMJE       -----------------------------------VAKNTQKIEENKNTTNNTNADASID
TATA_CAMJR       -----------------------------------VAKNTQKIEENKNTTNNTNADASID
TATA_CAMJD       -----------------------------------VAKNTQKIEENKNTTNNTNADASID
TATA_CAMJJ       -----------------------------------VAKNTQKIEENKNTTNNTNADASID
TATA_CAMJ8       -----------------------------------VAKNTQKIEENKNTTNNTSADASID
TATA_CAMLR       -----------------------------------TQEDAQKIE--KINEKDILAKENNE
TATA_NITSB       -----------------------------------VATENKKEIEEKTTASTTKTTADQD
TATA_WOLSU       -----------------------------------VSVTKSEKIEEAPKNEKSASTPIQD
TATA_SULDN       -----------------------------------VKSASTEAPKKVESAEEVASKESSK
TATA_SULNB       -----------------------------------VKEITKKEEPKVEAAAEEKKSENA-
TATA_HELHP       -----------------------------------SEENTKSQIKQSESKNENVSKTHTD
TATA_FLAJ1       --------------------------------------------APAKKQEEEQK-----
TATA_FLAPJ       --------------------------------------------VPDSKKDETKE-----
TATA_HELPY       -----------------------------------NEPKTLDAQATQTKVHESSEIKSKQ
TATA_HELP2       -----------------------------------NEPKTLDAQATQTKAHESSEIKSKQ
TATA_HELPH       -----------------------------------NEPKTLDAQATQTKVHETSEIKSKQ
TATA_HELPJ       -----------------------------------NELKTLDAQATQTKVHETSEIKSKQ
TATA_HELPS       -----------------------------------NEPKTLDAQVAQTKVHETSEIKSKQ
TATA_HELAH       -----------------------------------NEPKTLDAQVTQAKVHESSEIKNKQ
TATA_TROW8       ------------SQDGHPDSQ------------GNFAESASSVPFVKSEKQSEKRASVTE
TATA_KORVE       ----------PKKEETKA------------------------------------------
TATA_GLOVI       ----------PAPQQSASKETAP-----------------------NPPQSLPSGKDS--
TATA_ALKMQ       ----------KDDLSLEERE--------------------------TKDKDTVKVKEE--
TATA_ALKOO       ----------KEDISLDDK----------------------------KANNTLND-----
TATA_BACAN       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACAA       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACAC       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACC3       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACC7       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACC0       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACC1       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACCR       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACC4       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACC2       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACCQ       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACCZ       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACAH       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACHK       ----------TDDAFQEKE---------------------------KKEKM---------
TATA_BACMK       ----------TDEAFQEKE---------------------------KNK-----------
TATA_BACCN       ----------TDDAFQEKE---------------------------KK------------
TATA_ANOFW       ----------RDEVLEELD---------------------------ENKK----------
TATAD_BACSU      ----------VSGDEKEEKSA---------------ELT-----AVKQDKNAG-------
TATA_NATTJ       ----------REEVNEVEEEVKENK------SSDVKENE-----DNKTEKST--------
TATA_BACSK       ----------ADDDDDTKSTN------------------------VQKEKA---------
TATAY_BACSU      ----------TSDEEEKK-----------------------------KEDQ---------
TATA_MOOTA       ----------TEEIKEAAKIDD--------------GNN-----NSDKEKATRQAS----
TATA_PROMS       ----------QNEIDQV---------------------------MNEQDKDESPISIESN
TATA_PROM2       ----------QNEIDQV---------------------------MNEED--ESPKSIESN
TATA_PROM0       ----------QNEIDQV---------------------------MKEEDKDESPKSIESN
TATA_SYNE7       ----------ESEIKREIDRTP----------------------ATPAEATVEPPVLDSA
TATA_SYNP6       ----------ESEIKREIDRTP----------------------ATPAEATVEPPVLDSA
TATA_THEEB       ----------QDEIKRQ---------------------------TAALEEEQQAKAEAES
TATA_TRIEI       ----------ENEFKRE---------------------------AKHLEEGVKVSTSASE
TATA_BDEBA       ----------AKDIHDNQQV-------------------------SHQNKQSMGQTQKQG
TATAC_BACSU      ----------TQDIRKNDSE-------------------------NKEDKQM--------
TATA_COREF       ----------DE----TPAQPEQQPQGYQHPQQIEAPQNLQQPNFQQHYQNQ-------P
TATA_CORGL       ----------GD----TPEQ-QQQPQQQIAPNQIEAPQ----PNFEQHYQGQQVQQPQNP
TATA_CORGB       --------------------------------QIESSD--------QTLKN---------
TATA_CORDI       ----------DQ----RYEEQQQQ-------RQIAAQA-------QQQVVNPVEIP--QP
TATA_CORJK       ----------GD----KKELAE---------KQAPTAE-------QQQAQDL-------A
TATA_CORK4       ----------GA----EAEKTSAASTKTDEITSVSSTD------TPQPTVTV--------
TATA_STRAW       ----------------SEGQ--ESTPAGPPNTDEQPPA--------QRTIQAAPGDVTSS
TATA_STRCO       ----------------SEAKADDAAPADPPNP-EQSAA--------QRTIQAAPGDVTSS
TATA_STRGG       ----------DA----ATAAPTTETVADDTVP-PQSTT--------ARTIQAAPGDVTSS
TATA_RHOOB       ----------NS--TPAPTAQ-----QSAPAELPVADT--------TTAPVTPPAPVQPQ
TATA_RHOJR       ----------NS--TPAPTAQ-----QSAPAELPVADT--------TTAPVTPPAPVQPQ
TATA_RHOER       ----------NS--TPAPTAQSAPPPQSAPAELPVADT--------TTAPVTPPAPVQPQ
TATA_RHOE4       ----------DA--APASAPVA----QPAPAQLPTANT--------AVVANGAAAPVAQP
TATA_NOCFA       ----------TP--QANAAPV-----QQPAQQLPPAQP--------AQAP---AQPVNQA
TATA_FRACC       ----------EA--PAPTAAVA----AAPTQVTGPAPA--------APHTPPSAEPATPA
TATA_MYCA1       ----------N-----KTETSALGAQSESSAANPTPVQ--------SQRV---DPPAPSE
TATA_MYCPA       ----------N-----KTETSALGAQSESSAANPTPVQ--------SQRV---DPPAPSE
TATA_MYCBO       ----------N-----KAEAS-----IET----PTPVQ--------SQRV---DPSAASG
TATA_MYCBP       ----------N-----KAEAS-----IET----PTPVQ--------SQRV---DPSAASG
TATA_MYCBT       ----------N-----KAEAS-----IET----PTPVQ--------SQRV---DPSAASG
TATA_MYCTU       ----------N-----KAEAS-----IET----PTPVQ--------SQRV---DPSAASG
TATA_MYCTA       ----------N-----KAEAS-----IET----PTPVQ--------SQRV---DPSAASG
TATA_MYCMM       ----------T-----KAEPSA----IETNTANPTPVQ--------SQRI---DPAAATG
TATA_MYCUA       ----------T-----KAEPSA----IETNTANPTPVQ--------SQRI---DPAAATG
TATA_MYCLE       ----------N-----QAQASA----LETPMQNPTVVQ--------SQRV---VPPWSTE
TATA_MYCGI       ----------SN--AAKSDQ-------------PEQIT--------SERVVV-DPSTQST
TATA_MYCVP       ----------SQ--SAKPDQPA----------APTQIA--------SERV----PEAEPS
TATA_MYCSJ       ----------G-----KSDNP-----------PATPIT--------SERV----DTNPTA
TATA_MYCSK       ----------G-----KSDNP-----------PATPIT--------SERV----DTNPTA
TATA_MYCSS       ----------G-----KSDNP-----------PATPIT--------SERV----DTNPTA
TATA_MYCS2       ----------S-----KGDEPK----------PATPIA--------SERV----DTTAPE
TATA_SALAI       ----------DRDLAEKANAQA------GYQPLPPQVQ--------QEPYPQQTPYQAPP
TATA_SALTO       ----------DRDLAEKADAQA------GYQPMPPQVQ--------QGQHPQQSPYPAPP
TATA_LEIXX       ----------GD----KDKGEG-----------------------GSTAP-------ATD
TATA_MICLC       ----------GK----DAKDERS---------GT-----------GSTAADEPVEGRVVD
TATA_SACEN       ----------EE----AAKREKQ---------AKSEPQ-------QLTAGESSAPTVASP
                                                                             

TATA_LEGPL       ------------------
TATA_LEGPA       ------------------
TATA_LEGPC       ------------------
TATA_PSEHT       KV----------------
TATA_HAHCH       KHS---------------
TATA_ACTPJ       QA----------------
TATA_ACTP2       QA----------------
TATA_ACTP7       QA----------------
TATA_HAEDU       QA----------------
TATA_HAEPS       QA----------------
TATA_MANSM       QA----------------
TATA_PASMU       QA----------------
TATA_ACTSZ       QA----------------
TATA_ECOLI       QV----------------
TATA_ECO57       QV----------------
TATA_ECOL6       QV----------------
TATA_SHIFL       QV----------------
TATA_SALTI       QV----------------
TATA_SALTY       QV----------------
TATA_SODGM       HV----------------
TATA_PHOLL       QV----------------
TATA_PROMH       QV----------------
TATA_YERPE       QG----------------
TATA_ALIF1       QA----------------
TATA_ALIFM       QA----------------
TATA_ALISL       QA----------------
TATA_VIBVU       QA----------------
TATA_VIBVY       QA----------------
TATA_VIBCH       QA----------------
TATA_VIBCB       QA----------------
TATA_VIBPA       QA----------------
TATA_VIBTL       QA----------------
TATA_PHOPR       QV----------------
TATA_SHEB5       QA----------------
TATA_SHEB8       QA----------------
TATA_SHEB9       QA----------------
TATA_SHEB2       QA----------------
TATA_SHEPC       QA----------------
TATA_SHESW       QA----------------
TATA_SHESM       QA----------------
TATA_SHESR       QA----------------
TATA_SHESA       QA----------------
TATA_SHEON       QA----------------
TATA_SHEAM       QA----------------
TATA_SHEFN       QA----------------
TATA_SHEHH       QA----------------
TATA_SHEPA       QA----------------
TATA_SHEPW       QA----------------
TATA_SHELP       QA----------------
TATA_SHESH       QV----------------
TATA_SHEDO       QA----------------
TATA_SHEWM       QV----------------
TATA_ALTMD       KS----------------
TATA_HYDCU       KSETKDKA----------
TATA_PSEMY       ------------------
TATA_PSEST       ------------------
TATA_SACD2       AK----------------
TATA_CHRSD       K-----------------
TATA_MARMS       ------------------
TATA_ALCBS       ------------------
TATA_MARHV       ------------------
TATA_NITOC       HK----------------
TATA_HALHL       HDRSTS------------
TATA_ALKEH       SS----------------
TATA_DICNV       ------------------
TATA_METCA       KV----------------
TATA_PSYIN       RA----------------
TATA_RUTMC       ------------------
TATA_VESOH       K-----------------
TATA_HAEIN       CLILVFQNLFY-------
TATA_HAEIE       ------------------
TATA_HAES1       ------------------
TATA_HISS2       ------------------
TATA_LEPCP       KTK---------------
TATA_RHOFT       KTKA--------------
TATA_DELAS       ------------------
TATA_METPP       ------------------
TATA_ACIAC       ------------------
TATA_ACISJ       ------------------
TATA_ACIET       ------------------
TATA_VARPS       ------------------
TATA_POLNA       ------------------
TATA_POLSJ       ------------------
TATA_VEREI       ------------------
TATA_BORBR       ------------------
TATA_BORPA       ------------------
TATA_BORPE       ------------------
TATA_BORPD       ------------------
TATA_BORA1       ------------------
TATA_DECAR       ------------------
TATA_CUPTR       ------------------
TATA_CUPNH       ------------------
TATA_CUPPJ       ------------------
TATA_CUPMC       ------------------
TATA_RALPJ       ------------------
TATA_RALSO       ------------------
TATA_HERAR       ------------------
TATA_JANMA       ------------------
TATA_POLNS       ------------------
TATA_POLAQ       ------------------
TATA_AZOSB       S-----------------
TATA_AROAE       H-----------------
TATA_LARHH       ------------------
TATA_THIDA       ------------------
TATA_NITEU       ------------------
TATA_NITEC       ------------------
TATA_NITMU       ------------------
TATA_BURCM       SNKA--------------
TATA_BURVG       SNKA--------------
TATA_BURA4       SNKA--------------
TATA_BURCA       SNKA--------------
TATA_BURCH       SNKA--------------
TATA_BURCC       SNKA--------------
TATA_BURCJ       SNKA--------------
TATA_BURL3       SNKA--------------
TATA_BURM1       SNKA--------------
TATA_BURMA       SNKA--------------
TATA_BURM9       SNKA--------------
TATA_BURM7       SNKA--------------
TATA_BURMS       SNKA--------------
TATA_BURPS       SNKA--------------
TATA_BURP0       SNKA--------------
TATA_BURP1       SNKA--------------
TATA_BURP6       SNKA--------------
TATA_BURTA       SNKA--------------
TATA_PARPJ       DYR---------------
TATA_PARXL       DYR---------------
TATA_PARP8       DSR---------------
TATA_CHRVO       ------------------
TATA_NEIG1       DEDKA-------------
TATA_NEIG2       DEDKA-------------
TATA_NEIM0       DEDKA-------------
TATA_NEIMA       DEDKA-------------
TATA_NEIMB       DEDKA-------------
TATA_PSYA2       DDTHNV------------
TATA_PSEAE       KD----------------
TATA_PSEA8       KD----------------
TATA_PSEAB       KD----------------
TATA_PSEA7       KD----------------
TATA_PSE14       KDQV--------------
TATA_PSEU2       KDQV--------------
TATA_PSESM       KDQV--------------
TATA_PSEF5       KDS---------------
TATA_PSEPF       KDV---------------
TATA_PSEFS       KDS---------------
TATA_AZOVD       KD----------------
TATA_STRMK       ------------------
TATA_STRM5       ------------------
TATA_XANAC       ------------------
TATA_XANC5       ------------------
TATA_XANOM       ------------------
TATA_XANOP       ------------------
TATA_XANCP       ------------------
TATA_XANC8       ------------------
TATA_XANCB       ------------------
TATA_XYLFM       ------------------
TATA_XYLF2       ------------------
TATA_XYLFT       ------------------
TATA_XYLFA       ------------------
TATA_ACIB5       KS----------------
TATA_ACIB3       KS----------------
TATA_ACIBC       KS----------------
TATA_ACIBT       KS----------------
TATA_ACIBY       KS----------------
TATA_ACIBS       KS----------------
TATA_RHILW       ------------------
TATA_RHIL3       ------------------
TATA_RHIE6       ------------------
TATA_RHIEC       ------------------
TATA_AGRFC       ------------------
TATA_AGRVS       ------------------
TATA_AGRRK       ------------------
TATA_BRUAB       ------------------
TATA_BRUA1       ------------------
TATA_BRUC2       ------------------
TATA_BRUME       ------------------
TATA_BRUMB       ------------------
TATA_BRUSU       ------------------
TATA_BRUSI       ------------------
TATA_OCHA4       ------------------
TATA_RHIME       ------------------
TATA_SINMW       ------------------
TATA_SINFN       ------------------
TATA_CHESB       ------------------
TATA_RHILO       ------------------
TATA_RHORT       QPPQQPPVHRDDAPRG--
TATA_AZOC5       KAV---------------
TATA_XANP2       KPV---------------
TATA_BRASB       KAV---------------
TATA_BRASO       KAV---------------
TATA_BRADU       KAV---------------
TATA_RHOPA       KAV---------------
TATA_RHOPT       KAV---------------
TATA_RHOPB       KVV---------------
TATA_RHOP5       KAV---------------
TATA_RHOPS       KAV---------------
TATA_RHOP2       KAV---------------
TATA_NITHX       KTTV--------------
TATA_NITWN       KVI---------------
TATA_METC4       KAV---------------
TATA_METEP       KAV---------------
TATA_METPB       KAV---------------
TATA_METRJ       KPV---------------
TATA_METNO       KVG---------------
TATA_METS4       KVV---------------
TATA_SPHWW       RPQH--------------
TATA_SPHAL       R-----------------
TATA_ZYMMO       DIKNNQ------------
TATA_PELUB       ------------------
TATA_BEII9       RIG---------------
TATA_METSB       KIG---------------
TATA_CAUVC       ------------------
TATA_CAUVN       ------------------
TATA_CAUSK       ------------------
TATA_PHEZH       ------------------
TATA_GLUDA       GTGRPSGSSTP-------
TATA_GLUOX       HRNQV-------------
TATA_OLICO       TV----------------
TATA_ERYLH       DKQG--------------
TATA_NOVAD       DQAQ--------------
TATA_BARHE       KQRVK-------------
TATA_BARQU       KQRGK-------------
TATA_BART1       KQRVK-------------
TATA_RICRO       NK----------------
TATA_RICRS       NK----------------
TATA_RICAE       NK----------------
TATA_RICCN       NK----------------
TATA_RICM5       NK----------------
TATA_RICPU       NK----------------
TATA_RICAH       NK----------------
TATA_RICCK       KNN---------------
TATA_RICFE       KNN---------------
TATA_RICPR       TNN---------------
TATA_RICTY       NE----------------
TATA_RICBR       KD----------------
TATA_ANADE       -DQGSK--QA--------
TATA_ANADF       -DEASKAKQA--------
TATA_DEHMB       -AEKSE------------
TATA_DEHMC       -AEKSE------------
TATA_DEHM1       -IEKSE------------
TATA2_AQUAE      -EEKEKVEA---------
TATA1_AQUAE      -EGE--------------
TATA_RUBXD       GEEEQQARAAGEAGRKQG
TATA_SULSY       --EKVKENA---------
TATA_WOLPP       ------------------
TATA_WOLPM       ------------------
TATA_WOLTR       ------------------
TATA_EHRRW       ------------------
TATA_LEPIN       TSKSKKSKSA--------
TATA_LEPIC       TSKSKKSKSA--------
TATA_CHLCH       TASKS-------------
TATA_CHLTE       TKA---------------
TATA_CHLPB       SSEKS-------------
TATA_CHLPD       T-----------------
TATA_PELPB       SSTQS-------------
TATA_CHLL2       TGSKS-------------
TATA_PELLD       P-DRE-------------
TATA_PROA2       PSDKG-------------
TATA_CHLPM       K-DKE-------------
TATA_DEIDV       ASDRRS------------
TATA_DESAH       DK----------------
TATA_SYNFM       ------------------
TATA_GEOMG       ------------------
TATA_SYNAS       ------------------
TATA_DESVH       DKQA--------------
TATA_DESVM       DKQA--------------
TATA_DESAG       ------------------
TATA_DESAD       ------------------
TATA_MAGMM       KDA---------------
TATA_CHLAA       GETKV-------------
TATA_ROSS1       VETNV-------------
TATA_HERA2       NESK--------------
TATA_CAMC1       TTKNA-------------
TATA_CAMFF       TTKNV-------------
TATA_CAMC5       TTKNA-------------
TATA_CAMJE       ETKKA-------------
TATA_CAMJR       ETKKA-------------
TATA_CAMJD       ETKKA-------------
TATA_CAMJJ       ETKKA-------------
TATA_CAMJ8       KTKKA-------------
TATA_CAMLR       EVKKA-------------
TATA_NITSB       TTKA--------------
TATA_WOLSU       TTKQA-------------
TATA_SULDN       TPTQA-------------
TATA_SULNB       ------------------
TATA_HELHP       SQKQDT------------
TATA_FLAJ1       ------------------
TATA_FLAPJ       ------------------
TATA_HELPY       ES----------------
TATA_HELP2       ES----------------
TATA_HELPH       ES----------------
TATA_HELPJ       ES----------------
TATA_HELPS       ES----------------
TATA_HELAH       EG----------------
TATA_TROW8       AKKSK-------------
TATA_KORVE       ------------------
TATA_GLOVI       ------------------
TATA_ALKMQ       ------------------
TATA_ALKOO       ------------------
TATA_BACAN       ------------------
TATA_BACAA       ------------------
TATA_BACAC       ------------------
TATA_BACC3       ------------------
TATA_BACC7       ------------------
TATA_BACC0       ------------------
TATA_BACC1       ------------------
TATA_BACCR       ------------------
TATA_BACC4       ------------------
TATA_BACC2       ------------------
TATA_BACCQ       ------------------
TATA_BACCZ       ------------------
TATA_BACAH       ------------------
TATA_BACHK       ------------------
TATA_BACMK       ------------------
TATA_BACCN       ------------------
TATA_ANOFW       ------------------
TATAD_BACSU      ------------------
TATA_NATTJ       ------------------
TATA_BACSK       ------------------
TATAY_BACSU      ------------------
TATA_MOOTA       ------------------
TATA_PROMS       QTNEINQEKIDSENSKK-
TATA_PROM2       QTNEINQEKIDSENSKK-
TATA_PROM0       QSNEINQEKIDSENSNN-
TATA_SYNE7       PTEAVTVEKQTETQV---
TATA_SYNP6       PTEAVTVEKQTETQV---
TATA_THEEB       PR---EISP---------
TATA_TRIEI       PEKVVDVSSATNTNKN--
TATA_BDEBA       ENQNS-------------
TATAC_BACSU      ------------------
TATA_COREF       QQPDYRQNYEDPNRTP--
TATA_CORGL       QTPDYRQNYEDPNRTS--
TATA_CORGB       ------------------
TATA_CORDI       QPTDIQRPQQ--------
TATA_CORJK       QPKSEQPNEHNA------
TATA_CORK4       ESKDEKKHPA--------
TATA_STRAW       RPVSEPTDTTKR------
TATA_STRCO       RPVTEPTDTTKR------
TATA_STRGG       RPVSEAKPTTQS------
TATA_RHOOB       PQHTEPKSA---------
TATA_RHOJR       --HTEPKSA---------
TATA_RHOER       SQHTEPKSA---------
TATA_RHOE4       ---TEVKPL---------
TATA_NOCFA       ----EQKSA---------
TATA_FRACC       TGGSGNRSA---------
TATA_MYCA1       QGHSEARPAS--------
TATA_MYCPA       QGHSEARPAS--------
TATA_MYCBO       QDSTEARPA---------
TATA_MYCBP       QDSTEARPA---------
TATA_MYCBT       QDSTEARPA---------
TATA_MYCTU       QDSTEARPA---------
TATA_MYCTA       QDSTEARPA---------
TATA_MYCMM       QDQTEARPA---------
TATA_MYCUA       QDQTEARPA---------
TATA_MYCLE       QDHTEARPA---------
TATA_MYCGI       SSNSDKRPA---------
TATA_MYCVP       S--PDKRPA---------
TATA_MYCSJ       EQ-PDKRSA---------
TATA_MYCSK       EQ-PDKRSA---------
TATA_MYCSS       EQ-PDKRSA---------
TATA_MYCS2       QQSTDRHTA---------
TATA_SALAI       QQQPVVDPVQRARDS---
TATA_SALTO       QQQPVVDPVQRTRDS---
TATA_LEIXX       TGASSEQNSK--------
TATA_MICLC       RDETDPRDQR--------
TATA_SACEN       VEETQRNDSKK-------