CLUSTAL format seed alignment for MF_00237

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TATB_AGRFC      -MFDIGWSELLVIAVVLIVVVGPKDLPPMIRAFGKTMAGLRKMAGDFRTQFDEALKEADM
TATB_RHIME      -MLDIGWTELVVIAIVLIIVVGPKDLPPMLRAFGRMTSKMRGMASDFRRQFDEALREADL
TATB_CAUVC      MLPDIGGTELLIIAAVALIVVGPKDLPALLRKVGQFVGRMRGMASEFRASFDEMARQSEL
TATB_ECOLI      -MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQEL---KL
TATB_SALTI      -MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQEL---KL
TATB_SALTY      -MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQEL---KL
TATB_VIBCH      -MFDIGFWELVLIAIVALVVLGPERLPHAIRSVAKFVSAAKSMANSVKDELAHEL---KV
TATB_YERPE      -MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAATVQNELAQEL---KL
TATB_HAEIN      -MFDIGFSELILLMVLGLVVLGPKRLPIAIRTVMDWVKTIRGLAANVQNELKQEL---KL
TATB_PASMU      -MFDIGFSELFLILVIGLLVLGPKRLPVAIRTVMGWVATIRGLASNVQNELKQEL---KL
TATB_NEIMA      -MFDFGLGELVFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVGSVKQEFDTQI---EL
TATB_NEIMB      -MFDFGLGELVFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVGSVKQEFDTQI---EL
TATB_PSEAE      -MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNTIKQEVEREI---GA
TATB_XANAC      -MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELEREL---EA
TATB_XANCP      -MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELEREL---EA
TATB_XYLFA      -MFDIGFSELLLIAVVALVVLGPERLPKAARFAGLLVRRARTQWESIKQELEREL---EA
TATB_RALSO      -MIDLGISKLALIGAVALVVIGPERLPKVARTAGALIGRAQRYIADVKAEVSREI---EL
TATB_CORGL      MFSSVGWGEIFLLVVVGLVVIGPERLPRLIQDARAALLAARTAIDNAKQSLDSDFG-SEF
TATB_MYCTU      MFANIGWWEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIG-PEF
TATB_STRCO      MFNDIGALELVTLVVLAVLVFGPDKLPKVIQDVTRTIRKIREFSDSAKQDIRQELG----
TATB_CAMJE      ----MSFGEIIVILVVAILVLGPDKLPEAIVQIAKILKAVKRNIDDAKSSIEKEI---RI
TATB_HELPY      -MFGMGFFEILVVLVVAIIFLGPEKFPQAVVDVVKFFRAVKKTLNDAKDTLDKEI---NI
TATB_HELPJ      -MFGMGFFEILVVLIVAIIFLGPEKFPQAVVDIVKFFRAVKKTLNDAKDTLDKEI---NI
                    ..  ::  :  : ::..**. :*             :         .         

TATB_AGRFC      DDVRQTISDVRNLNPTNSLRDAMNPL--RQLGNEIKSDLQKATSPSDGLSSTAAPATSEP
TATB_RHIME      DDVRKTISDAQSLNPTAALRDAMNPL--RQLGNEIKSDLQKATTPDRPPASATPEPLVEP
TATB_CAUVC      DELRREVQAMRSGQFTNPVQDAADAARDVQVDQVFADIDASLSSGAMQAHPYAAGETHNS
TATB_ECOLI      QEFQDSLKKVEKAS----LTNLTPEL-KASM-DEL-------RQAAESMKRSYVANDPEK
TATB_SALTI      QEFQDSLKKVEKAS----LENLTPEL-KASM-DEL-------RQAAESMKRTYSANDPEQ
TATB_SALTY      QEFQDSLKKVEKAS----LENLTPEL-KASM-DEL-------RQAAESMKRTYSANDPEQ
TATB_VIBCH      QELQENLRKAEQMG----MQNLSPEL-QKSV-ESL-------KQAAQEVQRPYAATPS--
TATB_YERPE      QELQDSLKKVEQAG----LQNLTPEL-KASM-DEL-------KEAAEALKRSYHVDAGSE
TATB_HAEIN      QELQDSIKKAESLN----LQALSPEL-SKTV-EELKAQADKMKAELEDKAAQAGTTVEDQ
TATB_PASMU      QELQESIKKAEELN----FQQLSPEL-SKTV-EEL-------KASAEKMRTALEQKAA--
TATB_NEIMA      EELRKAKQEFEAAA-----AQVRDSL--KETGTDMEGNLHDISDGLKPWEKLPEQRTPAD
TATB_NEIMB      EELRKAKQEFEAAA-----AQVRDSL--KETGTDMEGNLHDISDGLKPWEKLPEQRTPAD
TATB_PSEAE      DEIRRQLHNEHILSMEREAQKLLAPL----------------------------------
TATB_XANAC      EELKRSLQDVQA-----SLREAEDQL-RNKQ-QQV-------EQGARALHDDVSRDIDIR
TATB_XANCP      EELKRSLQDVQAS-----LREAEGQL-RNTQ-QQV-------EDGARGLHDQARELHDEV
TATB_XYLFA      EALKRNLENAQQV-----IHDAQAQLQSNQQDMNIQNSISILHEQTK-------------
TATB_RALSO      EELRKMRTEFEEAA-----RNVEQTIH-----QEVSRHTSEINERLNEALGDPASR----
TATB_CORGL      DEIRKPLTQVAQYSRMSPKTAITKALFDND--SSFLDDFDPKKIMAEGTEGEAQRN----
TATB_MYCTU      DDLRGHLGELQKLRGMTPRAALTKHLLDGD------------------------------
TATB_STRCO      PEFKDF--EFEDLN---PKTFIRKQLDNEELGLKEIRNGFDLKKEMAEVTDAVHGRDAES
TATB_CAMJE      NDLKEEAKKYKD-EFSSTNENIRKKLSFEEFDDLKRDILDKTK-----------------
TATB_HELPY      EEIKKETLEYQKL-----FENKVESLKGVKI-EELEDAKVTAENEIKSIQDLMQDYQKSL
TATB_HELPJ      EEIKKETLEYQKL-----FENKVESLKGVKI-EELEDAKVTAENEIKSIQDLMQDYKRSL
                  .:                                                        

TATB_AGRFC      VAPLVNVPEPDMKLPDSPPAVAAAPAPVAAASVAAEKPKRARAKSIATVEAEAVAAKPKR
TATB_RHIME      V-------------NTDAVGETAAKATEKVAAAAVSSASRQMDRAADVPKASEPKPAPKP
TATB_CAUVC      I---------------LPTAEPSAEIVEAKPKRAPRKKAVAEPVAAEPVLVEPVKAPRKR
TATB_ECOLI      A---------------------------SDEAHTIHNPVVKDNEAAHEGVTPAAAQTQAS
TATB_SALTI      A---------------------------SDEAHTIHNPVVKGNETQHEGVTPAAAETQAS
TATB_SALTY      A---------------------------SDEAHTIHNPVVKGNETQHEGVTPAAAETQAS
TATB_VIBCH      ----------------------------SEASSTSSNPSSATEPDVRLDSASQPAEKKAE
TATB_YERPE      APHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVVDSVVEAAPVTTVK
TATB_HAEIN      I---------------------------KEIKSAAENAEKSQNAISVEEAAETLSEAERT
TATB_PASMU      ----------------------ATNTTLEEQIKEIKNATESTSQTLTEQLTPSEQVTEAT
TATB_NEIMA      FG---------VDENGNPFPDAANTLLDGISDVMPSERSYASAETLGDSGQTGSTAEPAE
TATB_NEIMB      FG---------VDENGNPLPDAANTLSDGISDVMPSERSYASAETLGDSGQTGSTAEPAE
TATB_PSEAE      ---------------------------------TGQNPPQETPPPAAESPAPSVPTPPPT
TATB_XANAC      AS--------ATPVATPLELAHADWSASPDVDTAAGATDAAGAAHTAPVIAQAQPIAPAP
TATB_XANCP      G-------------RDIDIRTSATPLAAPLELQADAPVVLEPGSAQPHTPVPAPAPVVAQ
TATB_XYLFA      ----------------------------RDIHPDRNTNTLELGTAVHHVHVTSPPPSTST
TATB_RALSO      ---------------------------QTATQAAEWRPAPAKSRNGRNSWRNKQLAMPKW
TATB_CORGL      ------------------------------------KQAADNNANVVERPADGSTARPTQ
TATB_MYCTU      ---------------------------DSLFTGDFDRPTPKKPDAAGSAGPDATEQIGAG
TATB_STRCO      ---------------------------SSSGSSSGSSSAASGNGRVDMSKKPEKPEKPGK
TATB_CAMJE      ----------------------------VDLTFDSRDDKVKNNLSGQNLNTEEKPNLSKL
TATB_HELPY      ET--------NTIPNHLN---------EEVSNEEALNKEVSSDESPKEVQLATDNNTKEH
TATB_HELPJ      ET--------NTIPNHLN---------EEVSNEEALNKEVSSDESPKEVQLTTDNNAKEH
                                                                            

TATB_AGRFC      VSRSKAVATPETTVATNASEPASPKPTVKTIAKKATVKKIAAEKSVAVADAKPAKAARTK
TATB_RHIME      RAQSKKPGTSVTKKAAGETAPKK------------------SPARKAPGEAPAANKSKTR
TATB_CAUVC      ASQKQEITVE-------------------------------APKAVRAPRKRASKAGDST
TATB_ECOLI      SPEQKPETTP-------------------------------EPVVKPAADAEPKTAAPSP
TATB_SALTI      APEQKPEPVKANVPESTET------------------------ASVAAIDAEKKSAAPVV
TATB_SALTY      APEQKPEPVKANVPESTET------------------------ASVATIDAEKKSAAPVV
TATB_VIBCH      ------------------------------------------------------------
TATB_YERPE      SVVQGEVLVKSTPVQEVGLADVMD-----------------KPVTKQQIDTIDSHGTDLS
TATB_HAEIN      PTDLTALETHEKVELNTHLS-----------------------SYYPPDDIEIAPASKSQ
TATB_PASMU      TDDVLSPAEQAELAEENDEMVY-------------------IQQYYPDDDDEPVFASKVK
TATB_NEIMA      TDQDRAWREYLTASAAAPVVQTVEVSYIDT---------AVETPVPHTTSLRKQAISRKR
TATB_NEIMB      TDQDRAWREYLTASAAAPVVQTVEVSYIDT---------AVETPVPHTTSLRKQAISRKR
TATB_PSEAE      STPAVPPADAA---------------------------------------APPAVAASTP
TATB_XANAC      HQTLVPAPHDAIVPAPHAAHLAS----------------APEPVAVVPVDAGTPAASMPS
TATB_XANCP      AQPMAPAPKQTLVPAPHGSL------------------------TSTQVTTHAPTASATA
TATB_XYLFA      HGNNGQEKSQ--------------------------------------------------
TATB_RALSO      YRRKQGVRMWAQSGAAR-----------------------------VKRHRPPIVAAQSR
TATB_CORGL      NDPKDGPNYSGGVSWTDII-----------------------------------------
TATB_MYCTU      PIPFDSDAT---------------------------------------------------
TATB_STRCO      TDKPAADDRPPFDMDAT-------------------------------------------
TATB_CAMJE      ETQDKNGKINV-------------------------------------------------
TATB_HELPY      DKEKENV-----------------------------------------------------
TATB_HELPJ      DKEKEHV-----------------------------------------------------
                                                                            

TATB_AGRFC      AAKPKKDEA--------
TATB_RHIME      AASRKKGDA--------
TATB_CAUVC      ASDIVS-----------
TATB_ECOLI      SSSDKP-----------
TATB_SALTI      ESSPSSSDKP-------
TATB_SALTY      ESSPSSSDKP-------
TATB_VIBCH      -----------------
TATB_YERPE      SAGPSRIHQPGGDQ---
TATB_HAEIN      SSKTKS-----------
TATB_PASMU      PQTEEIQDKKA------
TATB_NEIMA      DLRPKSRAKPKLRVRKS
TATB_NEIMB      DFRPKHRAKPKLRVRKS
TATB_PSEAE      PSPPSETPRNP------
TATB_XANAC      APAKIQEKQP-------
TATB_XANCP      SSTSPQEKTP-------
TATB_XYLFA      -----------------
TATB_RALSO      GRSFFE-----------
TATB_CORGL      -----------------
TATB_MYCTU      -----------------
TATB_STRCO      -----------------
TATB_CAMJE      -----------------
TATB_HELPY      -----------------
TATB_HELPJ      -----------------