CLUSTAL format seed alignment for MF_00238

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KCY_UREP2       -------MKKYIS---IAIDGPSGSGKSTAAKELAKKLGFLYINTGLMYRAYAYFLSINK
KCY_UREPA       -------MKKYIS---IAIDGPSGSGKSTAAKELAKKLGFLYINTGLMYRAYAYFLSINK
KCY_UREU1       -------MKKYIN---VAIDGPSGSGKSTAAKGLANKLGFLYINTGLMYRAYAYFLNENN
KCY_MYCGA       -------MTKQINSQQIAIDGPAGSGKSTVAKLVAQRLGFDYLSTGKIFRAFYYLIKENN
KCY_MYCPN       -------MYFQ-----IAIDGPSSSGKSSVAKTVARQLGFEYFSTGKMYRAFAYVMQVNR
KCY_MYCGE       -------MNWQ-----IAIDGPSSSGKSSVAKKIAEELDFFYFSSGKMYRAFAYVMQVNR
KCY_AQUAE       --------------MKIAIDGPSASGKSTVAKIISQKLNIPYLETGLVYRTYAYVSLKFK
KCY_HYDS0       -----------MNYKIIAIDGPASSGKSSVSRELSKILGYIYFNTGLVYRAIGFLKSK--
KCY_RICPU       MVDLKTKAFDISQNFTISLDGPAASGKGTIGLILAKKFSLKYFQSSIVYRQLAFDCISQK
KCY_RICAE       MVDLKTKAFDISQNFTISLDGPAASGKGTIGLILAKKFSLKYFQSSIVYRQLAFDCISQK
KCY_RICCN       MVDLKTKAFDISQNFTISLDGPAASGKGTIGLILAKKFSLKYFQSSIVYRQLAFDCISQK
KCY_RICRS       MVDLKTKAFDISQNFTIALDGPAASGKGTIGLILAKKFSLKYFQSSIVYRQLAFDCISQK
KCY_RICRO       MVDLKTKAFDISQNFTIALDGPAASGKGTIGLILAKKFSLKYFQSSIVYRQLAFDCISQK
KCY_RICFE       MVDLKTKAFDFSQNFTISLDGPAASGKGTIGLILAKKFSLKYFQSSIVYRQLAFDCINQK
KCY_RICCK       MMDLKTKAFDISQNFTISLDGPAASGKGTIGLMLAKKFSLKYFQSSIVYRQLTFDCISQK
KCY_RICAH       MVDLKTKAFDFAKNFAIALDGPAASGKGTIGLILAKKFSLQYFQSSIVYRQLAFDCINQK
KCY_RICTY       MVDLKTKAFDIAQNFTISLDGPAASGKGTIGLILAKKFALKYFQSSIVYRQLAFNCIHQQ
KCY_RICPR       MIDLKTKAFDIAQNFTISLDGPAASGKGTVGLILAKKFSLKYFQSSIVYRQLAFNCINQQ
KCY_RICB8       MTNLKSKALDFTQNFVIALDGPAASGKGTIGFMLAEKFSLKYVQSSIVYRQLAFNCIKEK
KCY_RICBR       MTNLKSKALDFTQNFVIALDGPAASGKGTIGFMLAEKFSLKYVQSSIVYRQLAFNCIKEK
KCY_THEM4       ------------MPCRIAIDGPAGSGKTTVAKLLADALGIFYLDTGAMYRIVGLYLSENN
KCY_THEAB       ------------MPCRIAIDGPAGSGKTTVAKILADKLGIYYLDTGAMYRIIGLYLDKKG
KCY_FERNB       ------------MHCKIAIDGPAGSGKTTVAKLIAQKLGIDYLDTGAMYRIVGLYLHSIG
KCY_THEMA       ------------MGFQIAIDGPAASGKSTIAKLLAEKLGFDHLNTGATYRAVAVYLHEKG
KCY_THESQ       ------------MGFQIAIDGPAASGKSTVARLLAEKLGFDHLNTGATYRAVAVYLHEKG
KCY_THEP1       ------------MGFQIAIDGPAASGKSTVARLLAEKLGFDHLNTGATYRSVAVYLHERG
KCY_THENN       ------------MGFQIAIDGPAASGKSTIAKLLAERLGFEHLNTGATYRAVAVYLKEKG
KCY_PSELT       -----------MNRFLIAIDGPAGSGKSSVAKLVAQKMNMNYLDTGAMYRAVALYLHSKG
KCY_LEPBJ       -----------MNENVIALDGPAGSGKSTVARQIAERIGFNYLDTGAFYRALTLYLFRLH
KCY_LEPBL       -----------MNENVIALDGPAGSGKSTVARQIAERIGFNYLDTGAFYRALTLYLFRLH
KCY_LEPIN       -----------MNENVIALDGPAGSGKSTVARQIAEKIGFNYLDTGAFYRALTLYLFRLY
KCY_THEYD       ------------MKKVVAIDGPSGAGKSTVSKEIAKALGFQYLDTGALYRAVAYYFSIKF
KCY_GEOKA       -----MKRR-----ISIAIDGPAAAGKSTVAKRIAERLSYVYIDTGAMYRALTYRALACG
KCY_GEOTN       -----MERR-----ICIAIDGPAAAGKSTVAKLIANRLSYVYIDTGAMYRALTYRALQCG
KCY_GEOSW       -----MRNN-----IRIAIDGPAAAGKSTVAKIIAKRLSYLYIDTGAMYRALTYVALQQK
KCY_ANOFW       -----MEKK-----ISIAIDGPAAAGKSTVAKRLAEALSYVYIDTGAMYRALTYCALQRG
KCY_BACC7       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACCZ       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACHK       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACC0       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACCQ       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACC3       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACAH       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACAN       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACAA       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACAC       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACC1       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACMK       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQK
KCY_BACC4       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKELSYVYIDTGAMYRTLTYAALEQK
KCY_BACCR       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKELSYVYIDTGAMYRTLTYAALEQK
KCY_BACC2       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKELSYVYIDTGAMYRTLTYAALEQK
KCY_BACCN       -----MDKR-----ISIAIDGPAAAGKSTVAKVVAKQLSYVYIDTGAMYRTLTYAALEQN
KCY_BACSU       -----MEKK-----LSIAIDGPAAAGKSTVAKIVAEKKSYIYIDTGAMYRAITYAALQEN
KCY_BACVZ       -----MDKK-----LSIAIDGPAAAGKSTVAKIVAEKKSYVYIDTGAMYRAITYTALKQN
KCY_BACP2       -----MKKK-----LSIAIDGPAAAGKSTVAKIVAAKKSYIYIDTGAMYRAITLAALQHG
KCY_BACLD       -----MEKK-----LCIAIDGPAAAGKSTVAKIVARKKSYIYIDTGAMYRAITYLALEKG
KCY_OCEIH       -----MEQR-----ITVAIDGPAAAGKSTVAKMIANQLGFIYVDTGAMYRALTYQALQEG
KCY_LISIN       -----MTKK-----ICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYIALKNN
KCY_LISW6       -----MTKK-----ICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYIAQKNN
KCY_LISMC       -----MTKK-----ICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYIALKNN
KCY_LISMF       -----MTKK-----ICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYIALKNN
KCY_LISMH       -----MTKK-----ICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYIALKNN
KCY_LISMO       -----MTKK-----ICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYIALKNN
KCY_STRPG       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRP8       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRP6       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRP3       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRPQ       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRPZ       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRPM       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRPF       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRPC       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRPB       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRP1       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STRPD       ------MKA-----IKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALTHG
KCY_STREM       ------MKA-----IRIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALKNG
KCY_STRE4       ------MKA-----IRIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIALKNG
KCY_STRU0       ------MKA-----IRIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRCATYIALKNN
KCY_STRA5       ------MNS-----INIAIDGPASSGKSTVAKIIAKNLNYTYLDTGAMYRCATYLALQHG
KCY_STRA3       ------MNS-----INIAIDGPASSGKSTVAKIIAKNLNYTYLDTGAMYRCATYLALQHG
KCY_STRA1       ------MNS-----INIAIDGPASSGKSTVAKIIAKNLNYTYLDTGAMYRCATYLALQHG
KCY_STRT2       ------MKD-----IRIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYLALQNG
KCY_STRT1       ------MKD-----IRIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYLALQNG
KCY_STRTD       ------MKD-----IRIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYLALQNG
KCY_STRGC       ------MKQ-----IQIAIDGPASSGKSTVAKIIAKDLGYTYLDTGAMYRAATYLALQHQ
KCY_STRSV       ------MKQ-----IQIAIDGPASSGKSTVAKIIAKDFGYTYLDTGAMYRAATYLALRHH
KCY_STRS2       ------MKS-----IQIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYLALTNG
KCY_STRSY       ------MKS-----IQIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYLALTNG
KCY_STRPI       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRP2       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRR6       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRPS       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRZJ       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRZP       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRPJ       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRPN       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRP7       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAVTYMALKNQ
KCY_STRP4       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRZT       ------MKT-----IQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQ
KCY_STRMU       ------MMG-----IRIAIDGPASSGKSTVAKIIAKKLGYVYLDTGAMYRSATYLALQND
KCY_LACLM       ------MKK-----IQIAIDGPASSGKSTVAKIIARNLGLIYLDTGAMYRVATLVALQEK
KCY_LACLS       ------MKK-----IQIAIDGPASSGKSTVAKIIARNLGLIYLDTGAMYRVATLVALQEK
KCY_LACLA       ------MKK-----IQIAIDGPASSGKSTVAKIIARNLDLIYLDTGAMYRVATFVALQKE
KCY_ENTFA       ------MGK-----ISIAIDGPASSGKSTVAKILAKQLNYVYCDTGAMYRAITYLALQNQ
KCY_LACS1       ----MVKK------LQIAIDGPASAGKSTVAKLVAKKLGYIYCDTGAMYRAVTYAALKAN
KCY_LACPL       ----MAKQA-----LQVAIDGPASAGKSTVAKLVAKRFGYIYVDTGAMYRAVTYWAMQQH
KCY_LEUMM       ------MTN-----FQVAIDGPASAGKSTIAKILATKLNYVYVDTGAMYRTITLAAKKNG
KCY_LEUCK       -----MSHN-----FQIAIDGPASAGKSTIAKILATNLKYVYVDTGAMYRTMTLAAKQAG
KCY_PEDPA       -----MNNK-----YQIAIDGPASAGKSTVAKIVAKDLQYVYCDTGAMYRVVTLKAIQNG
KCY_LACRD       -----MCKG-----LQVAIDGPASAGKSTVAKLVAKKFNYVYCDTGAMYRAVTLAVLNQG
KCY_LACRJ       -----MCKG-----LQVAIDGPASAGKSTVAKLVAKKFNYVYCDTGAMYRAVTLAVLNQG
KCY_LACF3       -----MVKG-----IQVAIDGPASAGKSTVAKLVAKRFGYIYCDTGAMYRSVTLAALERG
KCY_EXISA       -----MKKS-----LQIALDGPAGAGKSTIAKSLAKQLGYVYIDTGAIYRAVTYRALNEG
KCY_EXIS2       ------MKK-----IQIALDGPAGAGKSTIAKQLASHLDYVYIDTGAMYRAVTLAALEQG
KCY_LYSSC       -----MKKN-----IQIAIDGPAGAGKSTIAKIVAEALDFTYIDTGAMYRAVTYKAMQQN
KCY_STAAM       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAA9       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAA1       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAE       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAT       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAS       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAA2       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAN       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAW       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAC       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAR       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAAB       ------MKA-----INIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLK--
KCY_STAEQ       ------MSS-----INIALDGPAAAGKSTIAKRVASRLSMIYVDTGAMYRAITYKYLQ--
KCY_STAES       ------MSS-----INIALDGPAAAGKSTIAKRVASRLSMIYVDTGAMYRAITYKYLQ--
KCY_STAHJ       ------MDL-----INIALDGPAAAGKSTIARQVASKLSMIYVDTGAMYRAITYKYLQ--
KCY_STAS1       ------MKL-----LNIALDGPAAAGKSTIAKLLAAKLSMIYVDTGAMYRAITYKYLQ--
KCY_STACT       ------MNL-----INIAIDGPAAAGKSTIARRVAESHSMIYVDTGAMYRAITYKYLQ--
KCY_MACCJ       ------MNK-----INIAIDGPAAAGKSTIAKRVAEALSMIYVDTGAMYRAITLAHLE--
KCY_BACSK       -----MAKG-----FNVAIDGPAGAGKSTVAKKTAEKLGFLYIDTGAMYRAITFAALAEG
KCY_BACHD       ------MKK-----MNIAIDGPAGAGKSTVAKQVAQALSFLYIDTGAMYRALTYAAIEHH
KCY_LACJO       -----MKKKGLNYLMQVAIDGPASAGKSTVAKIIAHNLGYIYIDTGAMYRACTLIAHDNN
KCY_LACGA       -----MKKKGLNFLMQVAIDGPASAGKSTVAKIIAHNLGYIYIDTGAMYRACTLIAHDNH
KCY_CARHZ       --------------MRIAIDGPAGAGKSTVARILAKKLSFTYLDTGAMYRAVTVLFLENN
KCY_CALS4       ----MINLT-----VKIAIDGPAGAGKSTVAKKLAKLLGFTYIDTGAMYRAITLKVLREN
KCY_CLOB1       ------MLD-----ISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNN
KCY_CLOBH       ------MLD-----ISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNN
KCY_CLOBJ       ------MLD-----ISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNN
KCY_CLOBK       ------MLD-----ISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNN
KCY_CLOBL       ------MLN-----ISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNN
KCY_CLOBM       ------MLN-----ISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNN
KCY_CLOTE       -------MR-----VLVAIDGPAGAGKSTIAKLVAKKFNLMYIDTGAMYRAITYLAQNKN
KCY_CLOAB       -------MR-----LNIAIDGPAGAGKSTIAKLVAKKFRLMYINTGAMYRAVTLMAMRQN
KCY_CLOP1       -----MNKL-----ITVAIDGPAGAGKSTIAKIIGEKFNLMYINTGSMYRAVTLKALENN
KCY_CLOPE       -----MNKL-----ITVAIDGPAGAGKSTIAKIIGEKFNLMYINTGSMYRAVTLKALENN
KCY_CLOPS       -----MNKL-----ITVAIDGPAGAGKSTIAKIIGEKFNLMYINTGSMYRAVTLKALENN
KCY_FUSNN       ------MDN-----IIVAIDGPAGSGKSTIAKLIAKKFNFTYIDTGAMYRMITLYLLENN
KCY_ALKOO       ------MEF-----VQIAIDGPAGAGKSTIAKRIAERLNITYIDTGAMYRALTYKVLANN
KCY_CLOD6       ------MGN-----LVIAVDGPAGAGKSTIAKIVAKKLNINYIDTGAMYRAVTYKCLKSG
KCY_ALKMQ       ------MTF-----KQIAIDGPAGAGKSTVAKKLAALLGYTYVDSGAMYRALTYWALKND
KCY_CALBD       ------MKK-----INIAIDGPAGAGKSTISKLLASQLGYIHIDTGAMYRAVGLKVLKNN
KCY_CALS8       ------MKK-----INIAIDGPAGAGKSTISKLLAKKLGYIHIDTGAMYRAIGLKVLNSN
KCY_ONYPE       ----MHMKS-----FKIAIDGPAGSGKSTISKKLSQKLGWNHVDTGAMFRALTLYLLENE
KCY_AYWBP       ----MHMRS-----FKIAIDGPAGSGKSTISKKLSQKLGWNHIDTGAMFRALTLYLLENE
KCY_PHYAS       ------MQG-----FKLAIDGPAGAGKSTVCQKLSQKLGWEHIDTGAMFRALTLYLLENK
KCY_PHYMT       ------MKG-----FKIAIDGPAASGKSTICKLIAEKLNCVHIDTGLMFRVITLYLIKNK
KCY_ACHLI       ------MAG-----FKVAIDGPAGSGKSSISKNVAHKLGMTHIDTGAMYRAVTLLAIENQ
KCY_PARUW       --------------MIITIDGPVATGKSTIAKKLAESIGFIFFDTGAMYRALTFGILKNQ
KCY_RHOBA       --------------MIITIDGPAGAGKSSIARRVASELGFEFLDTGAMYRAVTWGVMQQG
KCY_ECOL6       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOSM       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SHIFL       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOUT       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO81       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO55       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO7I       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOSE       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOK1       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOHS       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOLU       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOL5       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOBW       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SHIF8       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO57       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO24       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOLC       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECOLI       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO5E       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO45       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SHIB3       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO8A       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECODH       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ECO27       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SHIDS       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SHIBS       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SHISS       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ESCF3       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALNS       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALTI       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALDC       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALPC       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALSV       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALEP       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALG2       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALHS       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALPB       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALA4       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALTY       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALPK       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALPA       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALCH       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_SALAR       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_CITK8       ---------MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_ENT38       ---------MTAAAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHH
KCY_KLEP7       ---------MTANIPVITIDGPGGAGKGTLCKAMAEALGWHLLDSGAIYRVLALAALHHH
KCY_KLEP3       ---------MTANIPVITIDGPGGAGKGTLCKAMAEALGWHLLDSGAIYRVLALAALHHH
KCY_ERWT9       ---------MTATAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHQ
KCY_SODGM       ---------MTVIAPVITIDGPSGAGKGTLCKALAETLQWHLLDSGAIYRVLVLAALHHQ
KCY_YERPP       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERPE       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERPG       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERPY       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERPB       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERPA       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERPN       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERP3       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERPS       ---------MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQ
KCY_YERE8       ---------MTASAPVITVDGPSGAGKGTLCKALAESLDWRLLDSGAIYRVLALAALHHQ
KCY_SERP5       ---------MTATAPVITVDGPSGAGKGTLCKALAESLGWRLLDSGAIYRVLALAALHHQ
KCY_PECCP       ---------MTVMAPVVTVDGPSGAGKGTLCKALAEALQWNLLDSGAIYRVLALAALHHH
KCY_PECAS       ---------MTVMAPVVTVDGPSGAGKGTLCKALAEALQWNLLDSGAIYRVLALAALHHH
KCY_EDWI9       ---------MTAIVPVITVDGPSGAGKGTLCKALAQALGWHLLDSGAIYRVLALAALHHQ
KCY_PROMH       ---------MAVIVPVITVDGPSGAGKGTLCQALAKAFGWHLLDSGAIYRVLALAALHHH
KCY_PHOLL       ---------MVAIAPVITVDGPSGAGKGTLCQALAEVLGWQLLDSGAIYRVLALAAIHHQ
KCY_AERS4       ---------MPQMAPVMTIDGPSGAGKGTLCQLLAEKLGWHLLDSGAIYRVLALAALHHD
KCY_AERHH       ---------MPQMAPVMTIDGPSGAGKGTLCQLLAEKLGWHLLDSGAIYRVLALAALHHD
KCY_ALIF1       ---------MTTHSPVVTVDGPSGAGKGTLCMLLAEKLGYNLLDSGAIYRVLALAAIHHG
KCY_ALIFM       ---------MTTHSPVVTVDGPSGAGKGTLCMLLAEKLGYNLLDSGAIYRVLALAAIHHG
KCY_ALISL       ---------MTIHSPVVTVDGPSGAGKGTLCMLLAEKLGYNLLDSGAIYRVLALAAIHHG
KCY_VIBVU       ---------MSSQTPVVTVDGPSGAGKGTLCMLLSKKLGFQLLDSGAIYRVLALAAIHHG
KCY_VIBVY       ---------MSSQTPVVTVDGPSGAGKGTLCMLLSKKLGFQLLDSGAIYRVLALAAIHHG
KCY_VIBPA       ---------MSSQTPVVTVDGPSGAGKGTLCMLLAKKLGFQLLDSGAIYRVLALAAIHHG
KCY_VIBCB       ---------MSSQTPVVTVDGPSGAGKGTLCMLLAKKLGFHLLDSGAIYRVLALAAIHHG
KCY_VIBTL       ---------MPSQSPVITVDGPSGAGKGTLCMLLADKLGFHLLDSGAIYRVLALAAIHHG
KCY_VIBCH       ---------MSSHTPVVTVDGPSGAGKGTLCMLLAKKLGFQLLDSGAIYRVLALAALHHG
KCY_PHOPR       ---------MSTHAPVITVDGPSGAGKGTLCMLLAEKLGWHLLDSGAIYRVLALAAIHHG
KCY1_HAEIN      --------------MIITVDGPSGAGKGTLCYALAEKLGYALLDSGAIYRVTALAALQRK
KCY2_HAEIN      --------------MIITVDGPSGAGKGTLCYALAEKLGYALLDSGAIYRVTALAALQRK
KCY_ACTSZ       --------------MVITVDGPSGAGKGTLCYALAKKLGFSLLDSGAIYRVTALAALKTQ
KCY_MANSM       ----------MTKNIVITVDGPSGAGKGTLCYALANRLGFALLDSGAIYRVTALAALQCK
KCY_PASMU       ----------MSNKIVITVDGPSGAGKGTLCYALAEKLGFTLLDSGAIYRVTALAALKSA
KCY_HAEDU       -----------MNNFVITVDGPSGVGKGTLSAALANKLGFALLDSGAIYRISALAALRQG
KCY_BLOFL       ------MKFINNIVPIVTVDGPSGSGKGVLSKQLAYILGWNLLDSGIIYRILACEALDNN
KCY_SHESH       ---------MSERAPVVTIDGPSGAGKGTISQLLAERLGWKLLDSGAIYRVLALAAIHHN
KCY_SHEWM       ---------MSERAPVVTIDGPSGAGKGTISQLLAERLGWKLLDSGAIYRVLALAAIHHN
KCY_SHEHH       ---------MSERAPVVTVDGPSGAGKGTISQLLAERLGYKLLDSGAIYRVLALAAIHHN
KCY_SHEPA       ---------MSERAPVVTVDGPSGAGKGTISQLLAERLGYKLLDSGAIYRVLALAAIHHN
KCY_SHEPW       ---------MLERAPVVTVDGPSGAGKGTISQLLAEKLGYKLLDSGAIYRVLALAAIHHN
KCY_SHELP       ---------MSQRAPIVTIDGPSGAGKGTISQILASRLGWKLLDSGAIYRVLALAAIHHN
KCY_SHESM       ---------MSERAPVVTIDGPSGAGKGTISQLLAKHLGWQLLDSGAIYRVLALAAIHHD
KCY_SHESA       ---------MSERAPVVTIDGPSGAGKGTISQLLAKHLGWQLLDSGAIYRVLALAAIHHD
KCY_SHEON       ---------MSERAPVVTIDGPSGAGKGTISQLLAKHLGWQLLDSGAIYRVLALAAIHHD
KCY_SHESR       ---------MSERAPVVTIDGPSGAGKGTISQLLAKHLGWQLLDSGAIYRVLALAAIHHD
KCY_SHEPC       ---------MSERAPVVTIDGPSGAGKGTISQLLAQHLGWQLLDSGAIYRVLALAAIHHD
KCY_SHESW       ---------MSERAPVVTIDGPSGAGKGTISQLLAQHLGWQLLDSGAIYRVLALAAIHHD
KCY_SHEB5       ---------MSERAPVVTIDGPSGAGKGTISQLLAQHLGWQLLDSGAIYRVLALAAIHHN
KCY_SHEB2       ---------MSERAPVVTIDGPSGAGKGTISQLLAQHLGWQLLDSGAIYRVLALAAIHHN
KCY_SHEB9       ---------MSERAPVVTIDGPSGAGKGTISQLLAQHLGWQLLDSGAIYRVLALAAIHHN
KCY_SHEB8       ---------MSERAPVVTIDGPSGAGKGTISQLLAQHLGWQLLDSGAIYRVLALAAIHHN
KCY_SHEAM       ---------MSERAPVVTIDGPSGAGKGTIAHLLAKHYGWQLLDSGAIYRVLALAALHHN
KCY_SHEDO       ---------MSERTPIVTIDGPSGVGKGTISQLLAQHLGWHLLDSGAIYRVLALAAIHHD
KCY_SHEFN       ---------MSERSPVITVDGPSGAGKGTICQLLAQHLGWHLLDSGAIYRVLALAAIHHD
KCY_COLP3       ---------MQESTPVITIDGPSGAGKGTVARIVADQLGWHLLDSGAIYRVLAVAIQHHQ
KCY_MARMS       ---------MINQGPVITIDGPSGAGKGTVSQLIAEKLGWHILDSGALYRLLALAVSHHG
KCY_PSE14       ---------MKIKAPVITIDGPSGSGKGTVAGLLARKLGWCLLDSGALYRLLAFAARNHG
KCY_PSEU2       ---------MKIKAPVITIDGPSGSGKGTVAGLLARKLGWCLLDSGALYRLLAFAARNHG
KCY_PSESM       ---------MKIKAPVITIDGPSGSGKGTVAGLLAKKLGWCLLDSGALYRLLAFAARNHG
KCY_PSEF5       ---------MNIKAPVITIDGPSGSGKGTIAGKLAKHLGWCLLDSGALYRLLAFAARNHG
KCY_PSEFS       ---------MNIKAPVITIDGPSGSGKGTIAGILAKRLGWCLLDSGALYRLLAFAARNHG
KCY_PSEPF       ---------MNNIAPVITIDGPSGSGKGTVAGILAKRLGWNLLDSGALYRLLAFAAHNHG
KCY_PSEPK       ---------MNSMAPVITIDGPSGSGKGTVAGLIARELGWKLLDSGALYRLLAFNASNHG
KCY_PSEPG       ---------MNSLAPVITIDGPSGSGKGTVAGLLARELGWKLLDSGALYRLLAFNASNHG
KCY_PSEPW       ---------MNSQAPVITIDGPSGSGKGTVAGLLARELGWRLLDSGALYRLLAFNASNHG
KCY_PSEE4       ---------MSSQAPVITIDGPSGSGKGTVAGLLARELGWRLLDSGALYRLLAFNASNHG
KCY_AZOVD       ---------MSVRPVVITIDGPSGSGKGTVAGLLAKRLGWNLLDSGALYRLLAFAARNHG
KCY_PSEU5       ---------MIKPVPVITIDGPSGSGKGTVAALLAGKLGWNFLDSGALYRLLAFAARNHG
KCY_PSEAB       ---------MNGAVPMLAIDGPSGAGKGTVAGLLARRLGWNLLDSGALYRLLAFAAVNHG
KCY_PSEAE       ---------MNGAVPMLAIDGPSGAGKGTVAGLLARRLGWNLLDSGALYRLLAFAAVNHG
KCY_PSEA8       ---------MNGAVPMLAIDGPSGAGKGTVAGLLARRLGWNLLDSGALYRLLAFAAVNHG
KCY_PSEA7       ---------MNAAVPMLAIDGPSGAGKGTVAGLLARRLGWNLLDSGALYRLLAFAAVNHG
KCY_METCA       ---------MQDTIPVLTIDGPSGAGKGTAARAVAARLGWNFLDSGAIYRALAVAAVDRG
KCY_NITOC       ---------MSKEIPVITVDGPSGSGKGTLAQQLAQHLEWHYLDSGAMYRVLALAADKHG
KCY_SACD2       ------------MSVVITIDGPSGSGKGTICRLIAEASGFELLDSGALYRLTALATVEQG
KCY_NEIMF       ----------MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTALYAQKQG
KCY_NEIMB       ----------MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTALYAQKQG
KCY_NEIMA       ----------MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTALYAQKQG
KCY_NEIG1       ----------MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTALYAQKQG
KCY_CHRVO       -----------MTVPVITIDGPSASGKGTVAAQVAARLAFHYLDSGSLYRLLALHARRRG
KCY_PARPJ       ----MKPTRPFHQTPVITIDGPSASGKGTVAALVAASLGFHLLDSGALYRLAALASLRYG
KCY_PARXL       ----MKPTRPFHQTPVITIDGPSASGKGTVAALVAASLGFHLLDSGALYRLAALASLRYT
KCY_PARP8       ----MKPTRPFHQTPVITIDGPTASGKGTVAALVAAELGFHLLDSGALYRLAALASVRYD
KCY_BURA4       ----MKSTRPFHPTPVITIDGPTASGKGTVAALLAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURCM       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURCA       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURCH       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURCC       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURCJ       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURL3       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURM1       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASMRYD
KCY_BURVG       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASVRYG
KCY_BURP0       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_BURPS       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_BURP6       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_BURM9       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_BURMA       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_BURMS       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_BURM7       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_BURTA       ----MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALYRLAALASIRYQ
KCY_CUPNH       ----------MTIVNVIAIDGPTASGKGTVAHKVADAVGFHLLDSGALYRLVALASDRAG
KCY_CUPTR       ----------MTIVNVITIDGPTASGKGTVAHKVADAVGFHLLDSGALYRLVALASDRAG
KCY_CUPPJ       ----------MTIVHVITIDGPTASGKGTVAHKVADAVGYHLLDSGALYRLVALASDRIG
KCY_CUPMC       ----------MTIVDVITIDGPTASGKGTVAHKVADALGFHLLDSGALYRLVALASDRAG
KCY_RALPJ       ----MSDTAASMPYPVITIDGPTASGKGTVAHQIADLLGFHLLDSGSLYRLVALASMREN
KCY_RALSO       ----MSDVAAFTAYPVIAIDGPTASGKGTVAHQIADLLGFHYLDSGSLYRLVAFVSIREN
KCY_POLAQ       ----------MSAIPVIAIDGPTASGKGTVASLVAEKLGFHYLDSGALYRLVALASEKHG
KCY_POLNS       ----------MSLPPVIAIDGPTASGKGTVASLVAEKLGFHYLDSGALYRLVALASEKQG
KCY_NITEU       --------MDKQNVPVITLDGPSASGKGTIARLVSQALGFHYLDSGALYRLVALAAMKRN
KCY_NITEC       --------MKNQYVPVITLDGPSASGKGTIARLVSQALGFHYLDSGALYRLVALAAMKRG
KCY_BORBR       ----MAISASAGAAPVITIDGPTASGKGTIAHRVAKQLGWDVLDSGALYRLTALAALRRG
KCY_BORPA       ----MAISASAGAAPVITIDGPTASGKGTIAHRVAKQLGWDVLDSGALYRLTALAALRRG
KCY_BORPE       ----MAIFASAGAAPVITIDGPTASGKGTIAHRVAKQLGWDVLDSGALYRLTALAALRRG
KCY_XANCP       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_XANC8       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_XANCB       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_XANC5       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_XANAC       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_XANOR       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_XANOM       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_XANOP       ---------MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWAD
KCY_STRM5       ---------MNPLAPVLTIDGPSGAGKGTISRIVARRMGWHYLDSGALYRAVGVAASWAD
KCY_STRMK       ---------MNPLAPVLTIDGPSGAGKGTISRIIARRMGWHYLDSGALYRAVGVAASWAD
KCY_XYLF2       ---------MADLVPVLTIDGPSGVGKGTVSKIVAARLGWHYLDSGALYRAVAVAADWAA
KCY_XYLFT       ---------MADLVPVLTIDGPSGVGKGTVSKIVAARLGWHYLDSGALYRAVAVAADWAA
KCY_XYLFA       ---------MADLVPVLTIDGPSGVGKGTVSKIVAARLGWHYLDSGALYRAVAVAADWTA
KCY_XYLFM       ---------MADLVPVLTIDGPSGVGKGTVSKIVAARLGWHYLDSGALYRAVAVAVDWAA
KCY_DICNV       ------------MRKIVTIDGPSGVGKGTVAQALARRHGWAYLDSGAVYRLAALFLKRQN
KCY_ACIBC       -----------MTVQIITIDGPSGSGKGTLAAKLAAYYQFHLLDSGALYRLLGLSLHKHD
KCY_ACIBT       -----------MTVQIITIDGPSGSGKGTLAAKLAAYYQFHLLDSGALYRLLGLSLHKHD
KCY_ACIBS       -----------MTVQIITIDGPSGSGKGTLAAKLAAYYQFHLLDSGALYRLLGLSLHKHD
KCY_ACIBY       -----------MTVQIITIDGPSGSGKGTLAAKLAAYYQFHLLDSGALYRLLGLSLHKHD
KCY_ACIB5       -----------MTVQIITIDGPSGSGKGTLAAKLAAYYQFHLLDSGALYRLLGLSLHKHD
KCY_ACIB3       -----------MTVQIITIDGPSGSGKGTLAAKLAAYYQFHLLDSGALYRLLGLSLHKHD
KCY_ACIAD       -----------MTVQIITIDGPSGSGKGTLAAKLANHYGFHLLDSGALYRLLGLSLHHKN
KCY_COXBU       ------MNARQKPAPVITIDGPSGSGKGTIAFRIAQTLNWYLLDSGIIYRAIAWAMAHYK
KCY_BUCBP       -------MSFKNLVPVITIDGPSGVGKSSVCKVISKKLQWNVLESGWIYRVLAFIIFKNN
KCY_MAGSA       ------------MSTIIAIDGPAAAGKGTLARRLAAELGFDYLDTGLIYRAVGMKLAR--
KCY_RHORT       --------------MIIAIDGPAASGKGTLARRLATQLRFAYLDTGKLYRAVGMAVIK--
KCY_ACICJ       ----------MTRPIVIAIDGPAASGKGTLARRLAAAFNLPYLDTGLLYRAVARRVLD--
KCY_GRABC       ------------MRLIIAVDGPAAAGKGTLARRLASAFGLPHLDTGLLYRAVGRLVLD--
KCY_RHOPA       --------------MIIAIDGPAASGKGTLAKRLAAHYGFRYLDTGVIYRAVAKAMLD--
KCY_RHOPT       --------------MIIAIDGPAASGKGTLAKRLAAHYGFRHLDTGVIYRAVAKAMLD--
KCY_RHOP2       --------------MIIAIDGPAASGKGTLGKRLAAHYGFRHLDTGVIYRAVAKALLD--
KCY_RHOPS       --------------MIIAIDGPAASGKGTLGKRLAAHYGFRHLDTGVIYRAVAKALLD--
KCY_RHOPB       --------------MIIAIDGPAASGKGTLGKRLAAHYGYRHLDTGVIYRAVAKALLD--
KCY_RHOP5       --------------MIIAIDGPAASGKGTLAKRLAAHYGLRHLDTGVIYRAVGMGMLA--
KCY_BRASO       --------------MIIAIDGPAASGKGTMAKRLAAHYGLRHLDTGVIYRAVAHALLT--
KCY_NITHX       --------------MIIAIDGPAASGKGTLGKRLAHHYHFRHLDTGVIYRAVAKALLD--
KCY_NITWN       --------------MIIAIDGPAASGKGTLGKRLAAHYHFRHLDTGVIYRAVAKALLD--
KCY_OLICO       --------------MIIAIDGPAASGKGTLGKRLAAHYGFRHLDTGVIYRAVAKAMLD--
KCY_BRADU       --------------MIIAIDGPAASGKGTLGKRLAHHYGYRHLDTGVIYRAVAYALMQ--
KCY_AZOC5       --------------MIIAIDGPAASGKGTLGKRIAGHLGLAHLDTGLLYRAVGAACL---
KCY_XANP2       --------------MVIAIDGPAASGKGTLARRLAAYYGLPHLDTGLLYRAVGAIVL---
KCY_METS4       --------------MVIAIDGPAASGKGTLARRLAQHYGLPHLDTGLLYRAVALALLD--
KCY_BEII9       --------------MIIAIDGPAASGKGTLARRLAQHFNLPHLDTGLLYRATARALLV--
KCY_METSB       --------------MIIAIDGPAASGKGTLARRLAAHFGLPHLDTGLLYRATARALLD--
KCY_CAUVC       ------------MGFVIAVDGPAASGKGTVAGRLAALYGYPLLDTGLLYRAVGVAILD--
KCY_CAUVN       ------------MGFVIAVDGPAASGKGTVAGRLAALYGYPLLDTGLLYRAVGVAILD--
KCY_CAUSK       ------------MAFIIAVDGPAASGKGTVASRLAKLYDYPMLDTGLLYRAVGVRLLD--
KCY_BRUMB       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUSI       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUO2       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUA2       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUA1       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUAB       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUME       ------MKSFVVAPFIVVIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUC2       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_BRUSU       ------MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRAVAKALLD--
KCY_RHIME       ------------MTFVIAIDGPAAAGKGTLSRRIAEQYGFHHLDTGLTYRATAKALMD--
KCY_SINMW       ------------MSFVVAIDGPAAAGKGTLSRLIAKRYGFHHLDTGLTYRAAAKALID--
KCY_AGRFC       ------------MTFTIAIDGPAAAGKGTLSRKIAETYGFHHLDTGLTYRATAKALLD--
KCY_RHILO       ----------MTHVFTIAIDGPAGAGKGTLARRLADHYRLNLLDTGLTYRAVAYALIQ--
KCY_BARHE       -----------MKPFVIAIDGPAASGKGTLARKIATHYHLHYLDTGLTYRGVAHALLQ--
KCY_BARQU       -----------MKPFVIAIDGPAASGKGTLARKIATHYRLRHLDTGLTYRGVAHALLQ--
KCY_BART1       -----------MKPFVIAIDGPAASGKGTLARKIAAHYHLHHLDTGLTYRGVAYALLQ--
KCY_BARBK       -----------MNPFVIAIDGPAASGKGTLARKIAAHYHFHHLDTGLTYRSVAHALLQ--
KCY_RHOSK       ------------MRFTVAIDGPAAAGKGTISRAVATHFRFAHLDTGLLYRAVGAKVTE--
KCY_RHOS4       ------------MRFTVAIDGPAAAGKGTISRAVAAHFRFAHLDTGLLYRAVGAKVTE--
KCY_DINSH       ------------MNFAIAIDGPAAAGKGTIGRAMAAHFGFPHMDTGLLYRAVGRRVLS--
KCY_MAGMM       ----------MAERLRIAVDGPAGAGKGTVCRAVARRYQWAYLDTGAIYRAVALHALNSE
KCY_CHLFF       --------------MIITIDGPSGTGKSTVAKALAQRLKFNYCNTGAMYRTLAYTHLQEP
KCY_CHLCV       --------------MIITIDGPSGTGKSTIAKALATELNFNYCNTGAMYRTLAYTHLQEP
KCY_CHLAB       --------------MIITIDGPSGTGKSTIAKALAKDLNFNYCNTGAMYRTLAYTYLCEP
KCY_CHLPN       --------------MIITIDGPSGTGKSTTAKALADHLHFNYCNTGKMYRTLAYARLQSP
KCY_CHLTB       --------------MIITIDGPSGTGKSTLAKALAQTLQFLYCNTGAMYRTLAYARLQPD
KCY_CHLT2       --------------MIITIDGPSGTGKSTLAKALAQTLQFLYCNTGAMYRTLAYARLQPD
KCY_CHLTR       --------------MIITIDGPSGTGKSTLAKALAQTLQFLYCNTGAMYRTLAYARLQPD
KCY_CHLTA       --------------MIITIDGPSGTGKSTLAKALAQTLQFLYCNTGAMYRTLAYARLQPD
KCY_CHLMU       --------------MIITIDGPAGTGKSTLAKALAKTLQFNYCNTGAMYRTLAYARLQPD
KCY_DESVH       --MPDTTGGHPAALKVVTLDGPAGVGKTTLARRVADALGIPYLDTGAMFRTMAWRLGPDG
KCY_DESVV       --MPDTTGGHPAALKVVTLDGPAGVGKTTLARRVADALGIPYLDTGAMFRTMAWRLGPDG
KCY_DESAG       ----------MAEHIIVTLDGPAGVGKTTLARNIAEELGIAYMDTGAMFRSIGWKLGNVV
KCY_DESAD       ----------MDTPFIITLDGPAGVGKSTLAKRLADRFEIAYLDTGAMFRGTAWKLGEGA
KCY_LAWIP       ----------MEQHTIITIDGPAGVGKSTLAKKLGTILNLPYLDTGAMFRKLALQLGNKA
KCY_SYNFM       ----------MNNATIIAIDGPAGAGKSTVSRLLAKELGYTYLDSGAMYRALAWALQREG
KCY_GEOSM       ------MSVVRENGVIVAIDGPSGAGKSSLTKLLAKRLGYIHIDTGAMFRAVALSAQRAG
KCY_GEOBB       ------MSAVRENGVIVAIDGPSGAGKSSLTKLLAKRLGYIHIDTGAMFRAVALSAQRAG
KCY_GEOSL       ------MSAAGRRGLIVAIDGPSGAGKSTITKLLADRLGYIHIDTGAMFRTVALAASRAG
KCY_PELCD       ----------MNRQLIIAIDGPSGVGKSTLSRRLAQQLRYVNIDTGAMYRCVALAAHRAG
KCY_DESHD       ----------MKKNLQIAIDGPAGAGKSTIAKAIARQLGFFYVDTGAMYRAIAYKALRLN
KCY_DESHY       ----------MKKNLQIAIDGPAGAGKSTIAKAIARQLGFFYVDTGAMYRAIAYKALRLN
KCY_PELTS       ----------MNSFPNIAIDGPAGAGKSTVARLLSKELGFLYIDTGAMYRAVALKAIRKG
KCY_SYMTH       -------MTDGTRELVIAMDGPAGAGKSTVARIVANRLGYLYIDTGAMYRALALKALRLG
KCY_DESRM       ----------MTEHKCIAIDGPAGAGKSTVAKKVAQKLNLLYIDTGAMYRAVTLKALRER
KCY_CHLTE       -----MESPIEKKPIIVAIDGPAASGKSTTAKILAARLGYTYIDTGAMYRSVTLKVLREG
KCY_PELPB       -----MKQETGKKRIIIAIDGPAASGKSTTARKVAHLLGYTYIDTGAMYRSVTLKALKQG
KCY_CHLT3       -----MPEATLTKKIIIAIDGPAASGKSTTAKQLAQKLSYTYIDTGAMYRAVTLKVLRDA
KCY_FLAJ1       -----------MKKITIAIDGFSSTGKSTLAKQLAKELEYVYVDTGAMYRAVAYFAMQNK
KCY_FLAPJ       -----------MKKITIAIDGFSSTGKSTLAKQLANHLGYIFVDSGAMYRAITYYALQNE
KCY_BACFR       -----------MKKITIAIDGFSSCGKSTMAKDLAKEIGYIYIDSGAMYRAVTLYSIENG
KCY_BACFN       -----------MKKITIAIDGFSSCGKSTMAKDLAKEIGYIYIDSGAMYRAVTLYSIENG
KCY_BACTN       -----------MKKITIAIDGFSSCGKSTMAKDLAREVGYIYIDSGAMYRAVTLYSIENG
KCY_BACV8       -----------MKKITIAIDGYSSCGKSTMAKDLAREIGYIYIDSGAMYRAVTLYSLQKG
KCY_PARD8       -----------MKKIVIAIDGHSSSGKSTMAKDLAKEIGYTYIDTGAMYRAVTLYCIQHG
KCY_PORG3       ----------MTDPIIIAIDGHSSCGKSTMAKDLARAIGYIYVDTGAMYRAVTLYSIRRG
KCY_PORGI       ----------MTDPIIIAIDGHSSCGKSTMAKDLARAIGYIYVDTGAMYRAVTLYSIRRG
KCY_CYTH3       -----------MKKIIVAIDGYSACGKSTTAKILAAKLGYVYIDTGAMYRSVALYFIQHY
KCY_SALRD       --------------MIVTIDGPAGSGKSTTAQRAAARLEYVYLDTGAMYRAVALGFLRAE
KCY_ROSCS       ----------MSAPSVITIDGPAGAGKSTLGELLARRLGYLFFDTGVMYRALAWAVLHGA
KCY_CHLAD       ----------MRVPQTIAIDGQSAAGKSTLGALLAEALGYLYFDTGVMYRALALAALRAG
KCY_HERA2       ------MFFTMTTPHTIAIDGPAASGKSTLGKLLADHFGYIYFDTGVLYRALTYVALEQA
KCY_SOLUE       ------MADTKQKRVVVAIDGPAGAGKSTIAKGLASRLGFIYIDTGAMYRAVALWALRQG
KCY_MYCLB       -----------MTDIVVAIDGPAGTGKSSVSRGLARELGARYLDTGAMYRMMTLAVLRAG
KCY_MYCLE       -----------MTDIVVAIDGPAGTGKSSVSRGLARELGARYLDTGAMYRMMTLAVLRAG
KCY_MYCA1       --------MS--ADVVVAIDGPAGTGKSSVSKGLARALGARYLDTGGMYRMVTLAVLRAG
KCY_MYCPA       --------MS--SDVVVAIDGPAGTGKSSVSKGLARALGARYLDTGGMYRMVTLAVLRAG
KCY_MYCBO       --------MSRLSAAVVAIDGPAGTGKSSVSRRLARELGARFLDTGAMYRIVTLAVLRAG
KCY_MYCBP       --------MSRLSAAVVAIDGPAGTGKSSVSRRLARELGARFLDTGAMYRIVTLAVLRAG
KCY_MYCBT       --------MSRLSAAVVAIDGPAGTGKSSVSRRLARELGARFLDTGAMYRIVTLAVLRAG
KCY_MYCTA       --------MSRLSAAVVAIDGPAGTGKSSVSRRLARELGARFLDTGAMYRIVTLAVLRAG
KCY_MYCTU       --------MSRLSAAVVAIDGPAGTGKSSVSRRLARELGARFLDTGAMYRIVTLAVLRAG
KCY_RHOOB       ---------MSTSSLIVAMDGPSGTGKSSVSRMLARRLGARYLDTGAMYRIATLHVLRKG
KCY_RHOJR       ---------MSTSKLVVAMDGPSGTGKSSVSRMLAQRLDARYLDTGAMYRIATLHALRKG
KCY_NOCFA       --------MSEDTPLVVAMDGPSGTGKSSVSRRLATRLGARYLDTGAMYRVATLRVLRAG
KCY_CORGL       ---------MPAGGLIVAIDGPSGTGKSTTSRALATRLSAKYLDTGAMYRVATLHVLNQG
KCY_COREF       ---------MPDGGLIIAIDGPSGTGKSTTSRALATRLNAKYLDTGAMYRVATLHVLNQG
KCY_CORDI       ---------MPEGGLIVAVDGPSGAGKSTVCRRIASMLGAKYLDTGAMYRVATLHVLRQG
KCY_STRAW       ---MENGAARTVPAVIVAIDGPSGTGKSSTSKAVAAKLGLSYLDTGAQYRAITWWMVSNG
KCY_STRCO       ---MENGAAPTAPAVIVAIDGPSGTGKSSTSKAVAAQLGLSYLDTGAQYRAITWWMVTNG
KCY_STRGG       ---MSTTVETARSSVIVAIDGPSGTGKSSTSKAVAAKLGLSYLDTGAQYRAITWWMLTNG
KCY_CUTAK       ---------MSTSPLVIAIDGPSGSGKSSTSRGVANRLGLARLDTGSMYRAVACRVAHLG
KCY_LEIXX       ------MTEPATPPVVLAVDGPAGSGKSSVSKAAAGRLGWAYLDTGAAYRALGWYVVERG
KCY_THET8       ------------MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAG
KCY_THET2       ------------MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAG
KCY_DEIDV       --------------MIVTIDGVAASGKSSVASGVARALGVPYVSSGLLYRAATLLGQDAG
KCY_DEIRA       --------------MIVTIDGVAASGKSSVSSGVARALGIPYVSSGLLYRAATLLGLEAA
KCY_DEIGD       --------------MIVTIDGVAASGKSSVASGVARALGVPYVSSGLLYRAATLLALEAD
KCY_BDEBA       ------------MGMVITIDGPAASGKSSVSRELARRLGWQWVSTGAFYRGLAFAALQLQ
KCY_MYCH7       ---------MPFKKINIAIDGPSGVGKSTIAKQIANKFNYLFINTGSLYRAIAFFCQ---
KCY_MYCHJ       ---------MPFKKINIAIDGPSGVGKSTIAKQIANKFNYLFINTGSLYRAIAFFCQ---
KCY_MYCH2       ---------MPFKKINIAIDGPSGVGKSTIAKQIANKFNYLFINTGSLYRAIAFFCQ---
KCY_MYCS5       ---------MELK-VNIAIDGPSGVGKSTVSKLIAKKLNYTFINSGSIYRTIAYHVI---
KCY_MYCAP       ---------MSNK-INIAIDGPCGAGKSTVAKEVSKKLKYVFINSGSVYRAIALSAI---
KCY_MYCPU       ----------MTKNINIAIDGPSGVGKSTIAKKLADHLNYVFINTGLFYRAIAFYKD---
KCY_MYCCT       -----------MEKLIIAVDGTSSSGKSVIFKKVARILNYQFVDTGLMYRAFTWYC---L
KCY_MYCMS       -----------MEKLIIAVDGTSSSGKSVIFKKVARILNYQFVDTGLMYRAFTWYC---L
KCY_MESFL       ----------MKRKIVIAVDGTAGSGKTATFNTVAKKIGYEFIDTGLMYRAFTLLC---I
KCY_BORHD       --------------MIIAIDGPSASGKSSIAKALGSRLGFKFISSGYFYRIITLIAQKFT
KCY_BORT9       --------------MVIAIDGPSASGKSSIAKALGMRLGFKFISSGYFYRIITLIAQRFS
KCY_BORRA       --------------MIIAIDGPSASGKSSVSKALSMKLGFKFISSGYLYRIITLIAQRFT
KCY_BORDL       --------------MIIAIDGPSASGKSSVSKALSMKLGFKFISSGYLYRIITLIAQRFT
KCY1_BORBP      --------------MIIAIDGPSASGKSSIARELGVKLGYKFISSGYLYRIITLIAQKFL
KCY1_BORAP      --------------MIIAIDGPSASGKSSIARELSVKLGFKFISSGYLYRIITLIAQRSF
KCY_BORBZ       --------------MIIAIDGPSASGKSSIARELGVRLNYKFISSGHLYRIITLIAQRSL
KCY1_BORBU      --------------MIIAIDGPSASGKSSIARELGVRLNYKFISSGHLYRIITLIAQRSL
                                : :**  . **       .        .:.  :*          

KCY_UREP2       ---------------LDINVNEMDCINAIKNANFIFNGD------NVKINDND--VSLIL
KCY_UREPA       ---------------LDINVNEMDCINAIKNANFIFNGD------NVKINDND--VSLIL
KCY_UREU1       ---------------LDINTNETACIEAIKNARFIFNGD------DVKIDDQD--VSDIL
KCY_MYCGA       ---------------WSID----QLISNFNKYECAFNGD------QVVINKEN--ISQLL
KCY_MYCPN       ---------------LDVN----LLLKVINQINWRFEHE------KVFYNNAD--ISEVI
KCY_MYCGE       ---------------LNID----LFLKIINQINWRFEKD------AVYYNNAD--ITTVI
KCY_AQUAE       -----------------------VPIQDIDKLFSLPVKVVPKIGKTEVYIEGKPVNEEDL
KCY_HYDS0       ------------------------NIDFFDAVEKNRLVFELLIGQTKVIFDHDDITKE-L
KCY_RICPU       -----------------------IDVTDIDAV----------IALSKELKLDNNFDLE--
KCY_RICAE       -----------------------IDVTDIDAV----------IALSKELKLDNNFDLE--
KCY_RICCN       -----------------------IDVTDIDAV----------IALSKELKLDNNFDLE--
KCY_RICRS       -----------------------IDVTDIDAV----------IALSKELKLDNNFDLE--
KCY_RICRO       -----------------------IDVTDIDAV----------IALSKELKLDNNFDLE--
KCY_RICFE       -----------------------IDVTDIDAV----------IALSKELNLDNNFDLE--
KCY_RICCK       -----------------------IDITDIDAV----------IALSKRLKLDNNLDLE--
KCY_RICAH       -----------------------IDVTDMDAV----------IALSKALKLDSHLDLE--
KCY_RICTY       -----------------------IDITDIDAV----------IALSQELKLDNNIDLE--
KCY_RICPR       -----------------------IDITDIDAV----------IALSKELKLDNNIDLE--
KCY_RICB8       -----------------------IDITDINKV----------ISLSKEINITDKFDLE--
KCY_RICBR       -----------------------IDITDINKV----------ISLSKEINITDKFDLE--
KCY_THEM4       VE------------------SDEEIERKLKELKITFS------NGNFFLNGRK--IGNEI
KCY_THEAB       VE------------------NDSDIERELSTIKLEFI------NGDFYINGKR--VGDEI
KCY_FERNB       VEP-----------------KSTSIKDILEKVNIEYI------GKDYYLNGKK--VGDEI
KCY_THEMA       LSS---------------SSAEEEIENVLKDLKIDYV------NGRVYINGED--YTEKI
KCY_THESQ       LSP---------------SSAEEEIENALKNLKIDYV------NGRVYINGKD--YTEKI
KCY_THEP1       FSP---------------FSAEKEIENALKDLKIDYV------NGRVYINGED--YTEKI
KCY_THENN       LNP---------------SSPREELEKALKDVKVDYR------DGRVFINGKD--YTEKI
KCY_PSELT       L------------------SAKDDLKKHLAEIDIEYI------DGELYLNKKK--VSDEI
KCY_LEPBJ       GNSPNTES-------FADWVKTSEAERSLSDIRILCEFSAGK-ENRIFLNGEE--VSLAI
KCY_LEPBL       GNSPNTES-------FADWVKTSEAERSLSDIRILCEFSAGK-ENRIFLNGEE--VSLAI
KCY_LEPIN       QTSPNNR--------FEEWVKTSEAERSLSQIRIVCEFSAGN-ENRILLDGED--VSLAI
KCY_THEYD       NYIDDFS-----------LLTEQEIEEELKNIKIHYK------NGRVFLSGED--VSDFI
KCY_GEOKA       -------------VDIHD---EQALLSLLRDTSIELKPSPHG--QIVLVNGDD--VTDII
KCY_GEOTN       -------------VDIHD---EQALLSLLGDTSIELKPSPQG--QLVFVNGED--VTDII
KCY_GEOSW       -------------VALDD---EQALISLLKNTYIELKSSEQG--QLVFVNGED--VTNII
KCY_ANOFW       -------------VDVHN---EKQLMNVLHDTYIELKPSPSG--QLVFANGEN--VTEAI
KCY_BACC7       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACCZ       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACHK       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACC0       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACCQ       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACC3       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACAH       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACAN       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACAA       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACAC       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACC1       -------------VDIEN---EEQLMEVVKNVKIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACMK       -------------VDIEN---EEKLMEVVKNVNIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACC4       -------------VDIEN---EEQLMEVVKNVNIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACCR       -------------VDIEN---EEQLMEVVKNVNIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACC2       -------------VDIEN---EEQLMEVVRNVNIEFQQGENT--QLVFLNGQD--VSEVI
KCY_BACCN       -------------IDIEN---EEKLMEVLQSIRIEFQQGKDT--QQVFLNGQD--VSEVI
KCY_BACSU       -------------VDLTD---EEKLAELLKRTDIELITTKDG--QKVFVNGTD--VTEAI
KCY_BACVZ       -------------ADLTD---EAALTELLKRTEIELVSVPEG--QIVLVNGED--VTEEI
KCY_BACP2       -------------VDLED---EQALDALLKKTVIELVSTGEG--QKVHLDNTD--VTEEI
KCY_BACLD       -------------VDLND---EAALTALLKESAIDLTVSPEGE-QKVYIAGED--VTEAI
KCY_OCEIH       -------------IDPKN---EDSVLTILMNSNIELRQAENG--QRVFVNNKD--VSEEI
KCY_LISIN       -------------VAYED---EMAIDALLKKTVIRFEPGEVQ---QVFVNEEN--VTDVI
KCY_LISW6       -------------LAYED---ETAIAQLLQKTVIRFEPGEVQ---QVFINDEN--VTEVI
KCY_LISMC       -------------IAYED---EKAIATLLQKTVIRFEPGEVQ---QVFVGEEN--VTEVI
KCY_LISMF       -------------IAYED---EKAIATLLQKTVIRFEPGEVQ---QVFVGEEN--VTEVI
KCY_LISMH       -------------IAYED---EKGIAALLQKTVIRFEPGEIQ---QVFVGNEN--VTEVI
KCY_LISMO       -------------IAYED---EKAIAALLQKTVIRFEPGEVQ---QVFVGSEN--VTEVI
KCY_STRPG       -------------YTDKE---VALILEELEKNPISFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRP8       -------------YTDKE---VALILEELEKNPISFKKAKGGS-QLVFLGDED--VTLAI
KCY_STRP6       -------------YTDKE---VALILEELEKNPISFKKAKDGS-QLVFLGDED--VTLVI
KCY_STRP3       -------------YTGKE---VALILEELEKNPISFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRPQ       -------------YTGKE---VALILEELEKNPISFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRPZ       -------------YTGKE---VALILEELEKNPISFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRPM       -------------YTGKE---VALILEELEKNPISFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRPF       -------------YTGKE---VALILEELEKNPISFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRPC       -------------YTGKE---VALILEELEKNPIFFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRPB       -------------YTGKE---VALILEELEKNPIFFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRP1       -------------YTGKE---VALILEELEKNPIFFKKAKDGS-QLVFLGDED--VTLAI
KCY_STRPD       -------------YTGKE---VALILEELEKNPIFFKKAKDGS-QLVFLGDED--VTLAI
KCY_STREM       -------------YHKED---VNLILQELAERPISFKKAADGS-QLVFLGDQD--VTMAI
KCY_STRE4       -------------YHKED---VNLILQELAKRPISFKKAADGS-QLVFLGDQD--VTMAI
KCY_STRU0       -------------YSEND---ISAILKELSEHPITFKKADDGS-QLVFLGTED--VTLAI
KCY_STRA5       -------------YEAQD---VSKILGLLAERPISFGKAEDGS-QTVFLGTEE--VTLAI
KCY_STRA3       -------------YEAQD---VSKILGLLAERPISFGKAEDGS-QTVFIGTEE--VTLAI
KCY_STRA1       -------------YEAQD---VSKILGLLAERPISFGKAEDGS-QTVFLGTEE--VTLAI
KCY_STRT2       -------------LTEEN---VPEILDQLSQNPISFGKAADGS-PKVYVGDVD--ITHPI
KCY_STRT1       -------------LTEEN---VPEILDQLSQNPISFGKAADGS-PKVYVGDVD--ITHPI
KCY_STRTD       -------------LTEEN---VPEILDQLSQYPISFGKAADGS-PKVYVGDVD--ITHPI
KCY_STRGC       -------------LTAAD---TEDIIRLLDDYSVSFGRSESGQ-QLVFVGDVD--VTNPI
KCY_STRSV       -------------LTEED---ATEIVDLLNNHSVSFGRAEDGE-QLVFVGDVD--VTHPI
KCY_STRS2       -------------IEVTD---QNRIVDLLAQYPIRFGRDENGQ-QLVFVGDED--VTLPI
KCY_STRSY       -------------IEVTD---QNRIVDLLAQYPIRFGRDENGQ-QLVFVGDED--VTLPI
KCY_STRPI       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRP2       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRR6       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRPS       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRZJ       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRZP       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRPJ       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRPN       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRP7       -------------LGVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRP4       -------------LVVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRZT       -------------LVVEE---VEALLALLDQHPISFGRSETGD-QLVFVGDVD--ITHPI
KCY_STRMU       -------------TDLTD---ERAIVKLLKDYPISFGRRKDDSEQLVFVGNVE--VSHPI
KCY_LACLM       -------------T--ED---ASKIIQFIENHPISFANGKNGQ--EVLVGLDN--VTEVI
KCY_LACLS       -------------T--ED---ASKIIQFIENHPISFANGKNGQ--EVLVGLDN--VTEVI
KCY_LACLA       -------------T--DD---AKEIIEFIEKNPISFMNGQKGQ--EVLMGSEN--VTEVI
KCY_ENTFA       -------------IDIQA---EEPLVALCVNHTISFQQAENGQ--RVFIDGHE--VTEAI
KCY_LACS1       -------------ISLDD---DEALKNLLQDFKLEFVPAEPEQ--KVFVNGEE--VTQII
KCY_LACPL       -------------VDLAD---EAAVITAMKSLKISFKPGEPDQ--LVFANQED--ITAAI
KCY_LEUMM       -------------IAYND---EEKIKNLLSQTEIRFEPSTPVQ--RVFLNDTD--VTEEI
KCY_LEUCK       -------------LAYED---EQGVVDLLAKTVIRFEPGVPTQ--RVFLNDSE--VTEAI
KCY_PEDPA       -------------IDLND---ETKISEMLNDTDIRFEPGEPVQ--KVFLDGNE--VTEDI
KCY_LACRD       -------------IDPKD---DKKVAEIARQIKIDFEPGEIEQ--RVFLDGKE--VTHDI
KCY_LACRJ       -------------IDPKD---DKKVAEIARQIKIDFEPGEIEQ--RVFLDGKE--VTHDI
KCY_LACF3       -------------IDLSQ---DDLVSELANQITITFAPGD-PQ--KVFIDGHE--VTQAI
KCY_EXISA       -------------IALED---GPALAQMIENMSLRLVPSEEGQ--RVFDGEEE--VTSVI
KCY_EXIS2       -------------LDLEN---GPVLGELMKSLDIRLTPGEQGQ--RVFIGERE--VTDAI
KCY_LYSSC       -------------IHLDD---EAKLAEMLAASTIDLKPSPQGQ--LVFLDGHN--VSADI
KCY_STAAM       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAA9       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAA1       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAE       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAT       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAS       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAA2       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAN       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAW       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAC       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAR       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAAB       ---------------LNK---TEDFAKLVDQTTLDLTYKADKG-QCVILDNED--VTDFL
KCY_STAEQ       ---------------NGK---PENFDYLINNTKLELTYDEVKG-QRILLDNQD--VTDYL
KCY_STAES       ---------------NGK---PENFDYLINNTKLELTYDEVKG-QRILLDNQD--VTDYL
KCY_STAHJ       ---------------NDK---PEDFKTLVNQTTLELTYDKSKG-QRILLDNQD--VTDFL
KCY_STAS1       ---------------QNK---PEDFDQLIETTELSLTYDKDKG-QRVILDNQD--VTDYL
KCY_STACT       ---------------EDK---NDDFQALIEDVSLKLVYDEDKG-QRVLLNGED--ITDYL
KCY_MACCJ       ---------------QPE---TE-IDKLVDHIDLKLVNRS--G-QRIYLNGSD--VSDRI
KCY_BACSK       -------------IDLHD---GKALGKLLEKSELRLESSNEGT--AVFWNGAD--ITAAI
KCY_BACHD       -------------VSPDD---EASLKSLLDSIEIKLVDEQSKT--RVYVNNTD--VTDQV
KCY_LACJO       -------------VDYGD---EKAILNLIDHSTIDFKQEDGEQ--KVYVNGKD--VSIDI
KCY_LACGA       -------------VDYGD---EKAILDLVDKSTIEFKQEDGEQ--KVYVNGKD--VSIAI
KCY_CARHZ       -------------LSLED---ENGIKRLLEKTDIKIIPGDEGQ--KILLNERD--VTELI
KCY_CALS4       -------------ISLED---EERIVEVARKSDISLD----GE--RVFLDGED--VSEEI
KCY_CLOB1       -------------IEPYD---IESLKALINSMNISFN----GN--NIIVNGKD--LEEDI
KCY_CLOBH       -------------IEPYD---IESLKALINSMNISFN----GN--NIIVNGKD--LEEDI
KCY_CLOBJ       -------------IEPYD---IESLKALINSMNISFN----GN--NIIVNGKD--LEEDI
KCY_CLOBK       -------------IEPYD---IESLKALINSMNISFN----GN--NIIVNGKD--LEEDI
KCY_CLOBL       -------------IEPYD---IESLKALINSMNISFN----GN--NIIVNGKD--LEEDI
KCY_CLOBM       -------------IEPSD---IESLKTLINSMDISFN----GN--NIIVNGKD--LEEAI
KCY_CLOTE       -------------ITPSN---VEGLCNLINSISMYFK----DD--KIIVNGED--LSEEI
KCY_CLOAB       -------------IRAND---VKKLCDLIESLSMHFE----ND--KLIVNGED--VSEEI
KCY_CLOP1       -------------ISAEE---VDKLLVMIDGMDMHFE----ND--ELILNGEN--INSLI
KCY_CLOPE       -------------ISAEE---VDKLLVMIDGMDMHFE----ND--ELILNGEN--INSLI
KCY_CLOPS       -------------ISAEE---VDKLLVMIDGMDMHFE----ND--ELILNGEN--INSLI
KCY_FUSNN       -------------INFDD---LKEIEKALKNINLDMQ----GD--KFYLNDVD--VSTKI
KCY_ALKOO       -------------IDITN---EKTIIELAQNSNIQFL----QE--NIYLDGKM--INEEI
KCY_CLOD6       -------------IDVNN---EKEVIQIAENSDIDFK----DN--NIYLDKEV--INEEI
KCY_ALKMQ       -------------INIHN---VEAIVNLCTSIHITFI----NQ--DIAVNNQI--VNTEI
KCY_CALBD       -------------ISPHD---RKKIVEILNSTDIQIKLVDGRQ--LVFLDGED--VTEKI
KCY_CALS8       -------------IKSNE---VEKILEVLDNTDIQIKIVAGSQ--LVLLDGED--VTEKI
KCY_ONYPE       -------------VSWHH---EKSLNQALDKINLSYSCN------KIFLNQED--VSLKI
KCY_AYWBP       -------------VSWHN---EKSLNQILDKINLSYSCN------KIFLNQED--VSLKI
KCY_PHYAS       -------------IQIQN---EQFLNKALTKVEIVYLDN------KIFLNQED--VSLKI
KCY_PHYMT       -------------VNWAQITEENYLKLLLNNCNIYYEKN------HIYCNYQKMCLEIKL
KCY_ACHLI       -------------IDMND----ESQYRFLEDVQITYRDD------HIYIGDRI--VEKEI
KCY_PARUW       -------------IDLSD---PDTLQNYLDHFQFDIKVIHHDR--HYFVDKED--VSKLI
KCY_RHOBA       -------------IAWDD---VESLVEFADAAQLIWQDD------RIYLDNQD--ISEEI
KCY_ECOL6       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOSM       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_SHIFL       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOUT       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO81       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO55       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO7I       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOSE       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOK1       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOHS       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOLU       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOL5       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOBW       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_SHIF8       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO57       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO24       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOLC       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECOLI       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO5E       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO45       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_SHIB3       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO8A       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECODH       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ECO27       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_SHIDS       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_SHIBS       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_SHISS       -------------VDVASEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ESCF3       -------------VDVASEDAL---VPLASHLDVRFISTNG--NLEVILEGED--VSGEI
KCY_SALNS       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALTI       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALDC       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALPC       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALSV       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALEP       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALG2       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALHS       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALPB       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALA4       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALTY       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALPK       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALPA       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALCH       -------------VDLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_SALAR       -------------VGLASEDAL---VPLASHLDVRFVSTDG--NLEVILEGED--VSGEI
KCY_CITK8       -------------VDVTSEDAL---VPLASHLDVRFVSTNG--NLEVILEGED--VSGEI
KCY_ENT38       -------------VDVASEEAL---VPLAAHLDVRFISTHG--NLEVILEGED--VSGEI
KCY_KLEP7       -------------VDVESEEAL---VPLAAHLDVRFISTDG--NLEVVLEGED--VSSEI
KCY_KLEP3       -------------VDVESEEAL---VPLAAHLDVRFISTDG--TLEVVLEGED--VSGEI
KCY_ERWT9       -------------VDISSEEAL---APIAAHLDVRFISHSG--EIEVILEGEN--VSTEI
KCY_SODGM       -------------VAIDSEEAL---VPLATHLDVRFEVEQG--KLSVVLEGED--VSQAI
KCY_YERPP       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERPE       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERPG       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERPY       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERPB       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERPA       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERPN       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERP3       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERPS       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLQVILEGED--VSNEI
KCY_YERE8       -------------VDISTEEAL---VPLAAHLDVRFVSQNG--QLKVILEGED--VSNEI
KCY_SERP5       -------------VDITSEEAL---VPLAAHLDVRFIAQDG--KLQVILEGED--VSNEI
KCY_PECCP       -------------VDISSEDAL---VPLASHLDVRFVAEGG--QLKVILEGED--VSHEI
KCY_PECAS       -------------VDISSEDAL---VPLASHLDVRFVAEDG--QLKVILEGED--VSHEI
KCY_EDWI9       -------------VNIDSEEAL---VPLAAHLDVRFDAAEG--DLRVILEGED--VSTAI
KCY_PROMH       -------------VDITSEDAL---VPLAANLDVRFIPNEN--GLSVILEGED--VSTEI
KCY_PHOLL       -------------VDIQSEDAL---VPLAANLDVRFVPRKG--KLSVMLEGED--VSNEI
KCY_AERS4       -------------VELDSEAAL---VPLAANLDVQFQVDSE--QVKVVLEGED--VSRTI
KCY_AERHH       -------------VELDAEAAL---VPLAANLDVQFQVDAE--QVKVVLEGED--VSRTI
KCY_ALIF1       -------------VDLNSEDAL---VPLAANLDVQFKAEGE--LVKVILEGED--VSAEL
KCY_ALIFM       -------------VDLNSEDAL---VPLAANLDVQFKAEGE--LVKVILEGED--VSAEL
KCY_ALISL       -------------VDLGSEEGL---VPLAANLDVQFKAEGD--LVKVILEGED--VSSEL
KCY_VIBVU       -------------VDTESEDAL---VPLATHLDVQFVAEGD--LVKVILEGED--VSKEL
KCY_VIBVY       -------------VDTESEDAL---VPLATHLDVQFVAEGD--LVKVILEGED--VSKEL
KCY_VIBPA       -------------VDTESEDAL---VPLATHLDVQFIAEGD--LVKVILEGED--VSGEL
KCY_VIBCB       -------------VDTESEDAL---VPLATHLDVQFIAEGD--LVKVILEGED--VSGEL
KCY_VIBTL       -------------VDTESEDAL---VPLATHLDVQFIAEGE--LVKVILEGED--VSGEL
KCY_VIBCH       -------------VDLESEDAL---VPLATHLDVQFIAEGD--LVKVILEGED--VSREL
KCY_PHOPR       -------------VDLESEDVL---VPLAAHLDVQFKAEGD--LVKVILEGED--VSGEL
KCY1_HAEIN      -------------TDLTNETDL---AELARHLDIQFIPQNG--EVSILLAGMD--VSRLI
KCY2_HAEIN      -------------TDLTNETDL---AELARHLDIQFIPQNG--EVNIFLAGMD--VSRLI
KCY_ACTSZ       EQGQ-------SAVKLDDEFAL---AELARKLDIQFLPQNG--EVQIFLDGEN--VSGQI
KCY_MANSM       -------------ADLTNEAEL---AELAAHLDIEFLPEAG--EVKVMLGGED--VSGLI
KCY_PASMU       -------------VELDDEIAL---AALASALDVQFLPADG--EVKILLNGEN--VSGQI
KCY_HAEDU       -------------IAFDDEDEL---AKLIPTLAIEFISNND--EVTAILNGEN--VTTQI
KCY_BLOFL       -------------IDMCNEDSL---QVLMSKIKVSFINIKN--SFVVYCNDKE--IKKNI
KCY_SHESH       -------------VELDNEDSL---SLLAAHLDVQFITGNGLHGIKVVLEGED--VSIDI
KCY_SHEWM       -------------VELDNEDSL---TLLAAHLDVQFITGNGSKGIKVVLEGED--VSNDI
KCY_SHEHH       -------------VELDNEESL---TLLAAHLDVQFVTGNEGKGIKVVLEGED--VSTTI
KCY_SHEPA       -------------VELDNEEAL---TLLAAHLDVQFVTGNESKGIKVVLEGED--VSITI
KCY_SHEPW       -------------VELDNEESL---TLLAAHLDVQFITGNESKGIKVVLEGED--VSTTI
KCY_SHELP       -------------VELDNEASL---ALLAAHLDVQFITANG-NGIKVVLEGED--VSHAI
KCY_SHESM       -------------VELENEESI---TLLAAHLDVKFLTGNEKDPVQVILEGED--VTTAI
KCY_SHESA       -------------VELENEESI---TLLAAHLDVKFLTGNEKDPVQVILEGED--VTTAI
KCY_SHEON       -------------VELENEESI---TLLASHLDVKFLTGNEKDPVQVILEGED--VTTAI
KCY_SHESR       -------------VELENEESI---TLLAAHLDVKFLTGNEKDPVQVILEGED--VTTAI
KCY_SHEPC       -------------VELENEESI---TLLAAHLDVKFLTGNDKDPVQVILEGED--VTTDI
KCY_SHESW       -------------VELENEESI---TLLAAHLDVKFLTGNDKDPVQVILEGED--VTTDI
KCY_SHEB5       -------------VELENEESI---TLLAAHLDVKFLTGNDTDPVQVILEGED--VTTDI
KCY_SHEB2       -------------VELENEESI---TLLAAHLDVKFLTGNDTDPVQVILEGED--VTTDI
KCY_SHEB9       -------------VELENEESI---TLLAAHLDVKFLTGNDTDPVQVILEGED--VTTDI
KCY_SHEB8       -------------VELENEESI---TLLAAHLDVKFLTGNDTDPVQVILEGED--VTTDI
KCY_SHEAM       -------------VELENEEAI---TLLAAHLDVQFLAGGDKDAIKVVLEGED--VTGAI
KCY_SHEDO       -------------VELENEEAI---TLLAAHLDVQFLSDADGKGIKVILEGED--VTSSI
KCY_SHEFN       -------------VELENEEAL---TLLAAHLDVQFLTGTEADAIKVILEGED--VTTTI
KCY_COLP3       -------------LSLDDEEPL---IPMAAHLDVQFEINSQ-GEAKVILEGEN--VTEII
KCY_MARMS       -------------MSSDDVETL---KVLAEHLDIQFQQSEE-GKVEIILEGEI--VTQAI
KCY_PSE14       -------------VDLTNEEAL---KLLAAHLDVQFEATAAGQGQRIILEGED--VTHAI
KCY_PSEU2       -------------VDLTNEEAL---KLLAAHLDVQFEATAAGQGQRIILEGED--VTHAI
KCY_PSESM       -------------VDLTNEEAL---KLLAAHLDVQFETTAAGQGQRIILEGED--VTQAI
KCY_PSEF5       -------------VDLTNEESL---KLLAAHLDVQFLGATENHPQRIILEGDD--VTDDL
KCY_PSEFS       -------------VDLTNEESL---KLLAAHLDVQFVGATEGHPQRIILEGDD--VTDDL
KCY_PSEPF       -------------VDLTNEELL---KKLAAHLDVQFIAATDGQLQRIILEGDE--VSDVI
KCY_PSEPK       -------------VDLTNEELL---TKLAAHLDVQFIAAEPGKLQQIILEGED--VSNVI
KCY_PSEPG       -------------VDLTNEELL---TKLAAHLDVQFIAAEPGKLQQIILEGED--VSNVI
KCY_PSEPW       -------------VDLTNEELL---KALAAHLDVQFIAAEPGKLQQIILEGED--VSNVI
KCY_PSEE4       -------------VDLTNEELL---KALAAHLDVQFIAAEPGKLQQIILEGED--VSNVI
KCY_AZOVD       -------------VDLTNEEAL---KVLAAHLDVQFVTSTDLHPQQIILEGED--VTDAI
KCY_PSEU5       -------------VDLTNEEAL---KVLAEHLDVQFGAARDGHGMVIILEGED--VTEAI
KCY_PSEAB       -------------VDLTNEEAL---KVLAAHLDVQFVAADGSHGQRIILEGEE--VTDVI
KCY_PSEAE       -------------VDLTNEEAL---KVLAAHLDVQFVAADGSHGQRIILEGEE--VTDVI
KCY_PSEA8       -------------VDLTNEEAL---KVLAAHLDVQFVAADGSHGQRIILEGEE--VTDVI
KCY_PSEA7       -------------VDLTNEEAL---KLLAAHLDVQFVAADDSHGQRIILEGEE--VTDVI
KCY_METCA       -------------VSREDESAL---AALAASLDLVFGAD---STARILLWDAD--ISGRI
KCY_NITOC       -------------IAPNAPKQL---ETLAQNLDVRFISGLEGMPARVFLEGSE--VSDSI
KCY_SACD2       -------------ANSADEQQV---AGIAASLDIKFIPQEG--STQVMLAGKD--VTKAI
KCY_NEIMF       -------------VGWHDEENV---SELAKKLPAVFSGS------RILLGGED--VSDGI
KCY_NEIMB       -------------VGWHDEENV---SELAKKLPAVFSGS------RILLGGED--VSDGI
KCY_NEIMA       -------------VGWHDEENV---SELAKKLPAVFSDS------RILLGGED--VSDGI
KCY_NEIG1       -------------VEWHDEENV---SALAKKLPAVFSGN------RILLDGED--VSDGI
KCY_CHRVO       -------------IAWDDEPAL---ARAAAALPVEFSDG------AVWLEGND--ASQDI
KCY_PARPJ       -------------ISGDDVDAL---VKLIDDLHITFREG------LAQLDGVD--VSAEI
KCY_PARXL       -------------IEAHDVDAL---VKLIDDLHITFREG------LAQLDGVD--VSAEI
KCY_PARP8       -------------IAADDAEAL---AKLVGELHITFREG------IAQLDGAD--VSTDI
KCY_BURA4       -------------IAAEDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURCM       -------------IAAEDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURCA       -------------IAAEDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURCH       -------------IAAEDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURCC       -------------IAAEDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURCJ       -------------IAAEDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURL3       -------------IEAEDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURM1       -------------IAAEDVDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURVG       -------------IDAQDIDAL---VKLIDDLHITFREG------CAQLDGVD--VSNDI
KCY_BURP0       -------------VEPDDADAL---ASLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_BURPS       -------------VEPDDADAL---ASLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_BURP6       -------------VEPDDADAL---ASLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_BURM9       -------------VEPDDADAL---ASLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_BURMA       -------------VEPDDADAL---ASLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_BURMS       -------------VEPDDADAL---ASLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_BURM7       -------------VEPDDADAL---ASLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_BURTA       -------------VEPNDADAL---AKLVDGLHITFREG------CAQLDGVD--VSDEI
KCY_CUPNH       -------------IDLADVDAL---AKIASRLDVKFGPD------RVWLQGEE--VSLAI
KCY_CUPTR       -------------VDLADIDSL---TRIASRLDVKFGPD------RVWLQGEE--VSLAI
KCY_CUPPJ       -------------VDIEDVDGL---AKTASRLDVKFGPD------RVWLSGEE--VSLAI
KCY_CUPMC       -------------VGVQDVDTL---AKMAARLDVKFGPD------RVWLSGEE--VSQTI
KCY_RALPJ       -------------IDDHDVESL---VRIARELDVRFKAD------RIWLKGED--VSLAL
KCY_RALSO       -------------IDDHDVNSL---VRIASELDVRFKAD------HIWLKGED--VSLAL
KCY_POLAQ       -------------IDVKNGPEL---GLLVPKLLISFKNS------QIFLDDDE--VTDAI
KCY_POLNS       -------------IDVKNGQEL---GLLVPKLLISFKNS------QIFLNGEN--VTDAI
KCY_NITEU       -------------TDVSDEHSM---VDIARHLNVSFRDS------SIWLEGKD--VSDEV
KCY_NITEC       -------------VDAGDEQGV---VGIARSLDVSFADS------SIRLDGID--VSDEI
KCY_BORBR       -------------LPATDEPAV---AAVAQALDVRFDGP------HVYLEGRD--AGHEI
KCY_BORPA       -------------LPATDEPAV---AAVAQALDVRFDGP------HVYLEGRD--AGHEI
KCY_BORPE       -------------LPATDEPAV---AAVAQALDVRFDGP------HVYLEGRD--AGHEI
KCY_XANCP       -------------LDVSDPAAL---VRCAFDTKVEFDEAGEAG-LRVLVNGVD--ATSEL
KCY_XANC8       -------------LDVSDPAAL---VRCAFDTKVEFDEAGEAG-LRVLVNGVD--ATSEL
KCY_XANCB       -------------LDVSDPAAL---VRCTFDTKVEFDEAGEAG-LRVLVNGVD--ATGEL
KCY_XANC5       -------------LDVSDPAAL---VRCTFDTRVEFDDAGEAG-LRVLVNGAD--ATSEL
KCY_XANAC       -------------LDVSDPAAL---VRCTFDTKVEFDDAGEAG-LRVLVNGAD--ATGEL
KCY_XANOR       -------------LDVSDPAAL---VRCTFDTKVEFDDAGEAG-LRVLVNGAD--VTSEL
KCY_XANOM       -------------LDVSDPAAL---VRCTFDTKVEFDDAGEAG-LRVLVNGAD--VTSEL
KCY_XANOP       -------------LDVSDPAAL---VRCTFDTKVEFDDAGEAG-LRVLVNGAD--VTSEL
KCY_STRM5       -------------IDTSDASAL---VRCTFDTHVQFVEQGEA--MRVMVNGTD--ATDEL
KCY_STRMK       -------------IDTSDASAL---VRCTFDTHVQFVEQGES--MRVMVNGTD--ATDEL
KCY_XYLF2       -------------VDVSDTTAL---VKCAFDTCVNFAECADGE-MRVLVNSID--ATDVL
KCY_XYLFT       -------------VDVSDTTAL---VKCAFDTCVNFAECADGE-MRVLVNSID--ATDVL
KCY_XYLFA       -------------VDVSDTTAL---VKCAFDTCVNFAKCADGE-MRVLVNAID--ATDVL
KCY_XYLFM       -------------VDVSDTTAL---VKCAFDTCVNFAECADGE-MRVLVNAID--ATDVL
KCY_DICNV       -------------LSLAATATQ---VAALQEMAVDFV-MTETV-VRVFLNGVA--IDDVL
KCY_ACIBC       -------------LLEKLDSHLDECVNYARQLNIKFETSAEG--TLVFLDGED--VTQTI
KCY_ACIBT       -------------LLEKLDSHLDECVNYARQLNIKFETSAEG--TLVFLDGED--VTQTI
KCY_ACIBS       -------------LLEKLDSHLDECVNYARQLNIKFETSAEG--TLVFLDGED--VTQTI
KCY_ACIBY       -------------LLEKLDSHLDMCVNYARQLNIKFETSAEG--TLVFLDGED--VTQTI
KCY_ACIB5       -------------LLEKLDSHLDMCVNYARQLNIKFETSAEG--TLVFLDGED--VTQTI
KCY_ACIB3       -------------LLEKLDSHLDMCVNYARQLNIKFETSAEG--TLVFLDGED--VTQTI
KCY_ACIAD       -------------LLDDLDTCLSECVEAAIQINIKFETKNDS--TIILLDGED--VTQTI
KCY_COXBU       -------------VPLEDSAGLA---RLLKRVQISIENRILGKKAKISCDGHD--ITLAI
KCY_BUCBP       -------------VCFS-SRNLN---ILFK--NINLHDFIQRINFKNYVISQS--LFTNI
KCY_MAGSA       -----------AGLDPADVALA---ERAARQLSPDDLAATD------------------L
KCY_RHORT       -----------GGADPHDAKAA---LAAARALDPATLGDRL------------------L
KCY_ACICJ       -----------RGGDPADPAAS---EEQARSLSRLDLERGD------------------L
KCY_GRABC       -----------AGGDPGSPADA---AWAVSVLVPETVQRSD------------------L
KCY_RHOPA       -----------AGADLTDEARA---AEVARTLDPSRFDDPA------------------L
KCY_RHOPT       -----------AGADLTDEARA---AEVARTLDPSRFDDPA------------------L
KCY_RHOP2       -----------GGADLTDQAQA---IAAAQGLDPGLFGDPA------------------L
KCY_RHOPS       -----------GGADLTDEARA---VAAARKLDPGIFGDPA------------------L
KCY_RHOPB       -----------QGAELTDETRA---VAAAEALDPDTFADPA------------------L
KCY_RHOP5       -----------LGAELTDEARA---AAVAAALDPKTFDDPA------------------L
KCY_BRASO       -----------AGLDLKDEARA---AEVAMTLDPSTFDNPA------------------F
KCY_NITHX       -----------AGADPADEALA---VAAALELDPEKFGHPA------------------L
KCY_NITWN       -----------AGADPADEARA---IAAALELDPERFGHPA------------------L
KCY_OLICO       -----------LGADLQDEARA---VAVARALDPEKFGDPV------------------L
KCY_BRADU       -----------SGHDLRDEAAA---VAAALELDPEKFGDPA------------------L
KCY_AZOC5       -----------AAGKLDDEAAS---VEAARTLDVTTLDPES------------------L
KCY_XANP2       -----------AQGQLQDEAAS---VEAARTLDVATLDPEA------------------L
KCY_METS4       -----------AERDLRDEAAA---EAAARTLRAESLGDAR------------------L
KCY_BEII9       -----------SGGDLQNHAEA---TAAARGLDVASLEAAN------------------L
KCY_METSB       -----------HGHDLSDREAA---ISAARSLALTDFDEAG------------------L
KCY_CAUVC       -----------GAGDLDDPIAA---EAVARALDLSALDRAE------------------V
KCY_CAUVN       -----------GAGDLDDPIAA---EAVARALDLSALDRAE------------------V
KCY_CAUSK       -----------ADGDPDDPVAA---EVSARELDISELERPE------------------V
KCY_BRUMB       -----------KGLPLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUSI       -----------KGLPLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUO2       -----------KGLPLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUA2       -----------KGLPLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUA1       -----------KGLPLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUAB       -----------KGLPLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUME       -----------KGLPLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUC2       -----------KGLSLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_BRUSU       -----------KGLSLDDEALA---TDAALSLDLLAMDKAV------------------L
KCY_RHIME       -----------AGLPLDDEAVA---EKTAREVDLSGLDRAV------------------L
KCY_SINMW       -----------AGLPLDDEAVA---EKTARQVDLSGLDRAV------------------L
KCY_AGRFC       -----------AGLPLDNEAVA---EKMALELDLAGLDRAV------------------L
KCY_RHILO       -----------HALPLDNVSAA---ETAARQVDMAKLDRAV------------------L
KCY_BARHE       -----------QKLALDDEKNA---LVYARELDFNTLNPAL------------------L
KCY_BARQU       -----------QKLALNDEKSA---LAYAKKLDFNTLKPAL------------------L
KCY_BART1       -----------HNLALDDEKNA---ITYAKELDFNTLNLAF------------------L
KCY_BARBK       -----------QGLTCDDETSA---IAHAKKLDLNILNPNL------------------L
KCY_RHOSK       -----------GADPV----------AAAEGLDLADLARDD------------------L
KCY_RHOS4       -----------GADPV----------AAAEGLDLADLARGD------------------L
KCY_DINSH       -----------GMPAL----------EAARALTPEDLQADG------------------L
KCY_MAGMM       NFEETSLAQWAAQMDFRFEVDA---QGDAHAFLEGTEVTNK------------------L
KCY_CHLFF       ------------WNCLSIQELID-----NPPFSFSFISEQP---LEAFLDGHR--LSEEL
KCY_CHLCV       ------------WQALPIKELID-----NPPFSFSFISGQP---LEAFLEGQL--LSAEL
KCY_CHLAB       ------------WKHLAIQELID-----NPPFSFSFVSGQP---LEAFLEGNL--LSVEL
KCY_CHLPN       ------------WATLPLTKFLE-----EPPFSFTFATGQP---LESFFNGHL--LTSEL
KCY_CHLTB       ------------WQEVPLEDFLA-----SPPFSFSFSKDSP---LQAFYGDRL--LTSEL
KCY_CHLT2       ------------WQEVPLEDFLA-----SPPFSFSFSKDSP---LQAFYGDRL--LTSEL
KCY_CHLTR       ------------WQEVPLEDFLA-----SPPFSFSFSKDSP---LQAFYGDRL--LTSEL
KCY_CHLTA       ------------WQEVPLEDFLA-----SPPFSFSFSKDSP---LQAFYGDHL--LTSEL
KCY_CHLMU       ------------WQEVPLEDFLA-----SPPFSFSFSKDAP---LQAFYENRP--LTSEL
KCY_DESVH       -------------PDLD-EALLR---DRLAGFVFTLRGRGG--ASVLSCNGED--IGNEI
KCY_DESVV       -------------PDLD-EALLR---DRLAGFIFTLRGRGG--ASVLSCNGED--IGNEI
KCY_DESAG       -------------ESVP-PAEIE---KKLAGFRFSLSGAGA--ATQLSLNGTP--VGDEI
KCY_DESAD       -------------WDWD-ADKLD---QALKGLEFTLSGSGS--NSTLSLNGTH--LTDEI
KCY_LAWIP       -------------ETLP-DSILQ---EQCKKVTFQLQGVGK--NSLLMCNGES--IGHEI
KCY_SYNFM       -------------VDLEAEAHVA---RALPELPLEFSTRGG--SLLIHCGGKA--LEDEL
KCY_GEOSM       -------------IASDDDAGL---AELCRGLDITFARDGE--ACRVLANGED--VSREI
KCY_GEOBB       -------------IKSDDDAGL---AELCRGLEIAFARDGE--TCRVLANGED--VSTKI
KCY_GEOSL       -------------IAPDNDASL---AGLCADLEIAFVRNNG--CCRVTANGED--VTDAI
KCY_PELCD       -------------LAADDEKSL---QALCADMEIRFVRKDG--TEKVLLNGED--VSEAI
KCY_DESHD       -------------IALTQ---EEEIAGMARQTEITLEHSAA---RRVFCDGLD--VTEAI
KCY_DESHY       -------------IALTQ---EEEIAGMARQTEITLEHSAA---RRVFCDGLD--VTEAI
KCY_PELTS       -------------VDLAD---QPGLSRLAAVTSVNLKTDAEGN-LRVFLDGED--VTEEI
KCY_SYMTH       -------------IPETD---AAALADLADATEVELQRAPDGG-NRVLLDGED--VTAEI
KCY_DESRM       -------------INLWD---DIALIELAKRTIITLLAGQK---QSVLLDGLD--VTREI
KCY_CHLTE       -------------LLDEIRKDETRIAELLQTITIGFQGQ------RVFLDGED--VSEAI
KCY_PELPB       -------------VLDSLHHSPESVSGLLHDIVIHFEGD------HVFLDGED--VTAEI
KCY_CHLT3       -------------FFEKIFSDELFLKKLLSETEVILKGE------KVFLDGEE--VTKDI
KCY_FLAJ1       -------------FIGADFFNKEALIEALPKIQLEFKFNSDLGFAEMYLNGEN--VEKQI
KCY_FLAPJ       -------------YINQDLFNKEKLIKNLPQIKLEFQFNPKLGFAEMYLNDAN--VEKEI
KCY_BACFR       -------------IFHGDTIDTDELKRRIGDIHISFRIDPETGRPNTYLNGVN--VENKI
KCY_BACFN       -------------IFHGDTIDTDELKRRIGDIHISFRIDPETGRPNTYLNGVN--VENKI
KCY_BACTN       -------------IFNGDVIDTEKLKEAIRDIRITFRPNPETGRPDTYLNGVN--VENKI
KCY_BACV8       -------------FFTERGIDTEALKTAMPDIHISFRLNPETQRPMTFLNDTN--VEDAI
KCY_PARD8       -------------FFEGEKIKEEELKASIHDIDISFRLNAETGRPDTYLNGVN--VEKEI
KCY_PORG3       -------------LWKDGVLDTETLRDEMSDVRITFRLNAETGLPETYLNGEN--VEQDI
KCY_PORGI       -------------LWKDGVLDTETLRNEMSDVRITFRLNAETGLPETYLNGEN--VEQDI
KCY_CYTH3       -------------INST---NPKAVAEALNQIHISFVHNNKTETCETYLNGLN--VESEI
KCY_SALRD       -------------APATRSGAEAVLPSL--TVDVEYRGDTM----QVFLGDDA--VTDRI
KCY_ROSCS       -------------IDPEDGEAVTALARDLDIQVLPPGDAMDGRLYTVLVNGVD--VTWEL
KCY_CHLAD       -------------IDPDDEAALSELAHQLVIDVTQP-TVADGRQYTVLVNGED--VTWAI
KCY_HERA2       -------------VDLADAAALAKLAQTSNFEVLPP-TIADGRQYTVLANGED--ITWPL
KCY_SOLUE       -------------VDSGD---MHRMEQLAMAAQIELGPG------TISLNGED--VTQAI
KCY_MYCLB       ----------------IDPAD--AAAIGESVWKVQMLSDH----DRYFLGGED--VSSEI
KCY_MYCLE       ----------------IDPAD--AAAIGESVWKVQMLSDH----DRYFLGGED--VSSEI
KCY_MYCA1       ----------------IDPAD--ADAVGRAAQAVRMSVDYHPDGDRYFLGGED--VSTEI
KCY_MYCPA       ----------------IDPAD--AEAVGRAAQAVRMSVDYHPDGDRYFLGGED--VSTEI
KCY_MYCBO       ----------------ADPSD--IAAVETIASTVQMSLGYDPDGDSCYLAGED--VSVEI
KCY_MYCBP       ----------------ADPSD--IAAVETIASTVQMSLGYDPDGDSCYLAGED--VSVEI
KCY_MYCBT       ----------------ADPSD--IAAVETIASTVQMSLGYDPDGDSCYLAGED--VSVEI
KCY_MYCTA       ----------------ADPSD--IAAVETIASTVQMSLGYDPDGDSCYLAGED--VSVEI
KCY_MYCTU       ----------------ADPSD--IAAVETIASTVQMSLGYDPDGDSCYLAGED--VSVEI
KCY_RHOOB       ----------------VDLAD--PDAIADATVGLPWSIGTDPAGEQVLLDGED--VGEEI
KCY_RHOJR       ----------------VDLTD--PAAIADATAGLPWSIGTDPAGEQVLLDGED--VGEEI
KCY_NOCFA       ----------------VELTD--PAAIAAAVKELPLTIGTDPSREVIELDGED--VSAEI
KCY_CORGL       ----------------IDPAD--SAAVIAATAVLPLSISDDPASTEVLLAGVD--VQKDI
KCY_COREF       ----------------IDPAD--TDAVITATAALPLAISDDPSSTEVLLAGVD--VQTEI
KCY_CORDI       ----------------INPSD--TTAVVQATRELPLSVNDDPASREVILDGED--VSNEI
KCY_STRAW       ----------------IDITD--PTAIAAVAGKPEIISGTDPSAPTITVDGTD--VAAPI
KCY_STRCO       ----------------IDTDD--PHAVAAAAGKPEIVSGTDPAGPTITVDGVD--VAGPI
KCY_STRGG       ----------------VDVGN--PEEIATAAAKPVIVSGTDPAAPTITVDGED--ASGPI
KCY_CUTAK       ----------------IDPTTN-PRDAIKVAQSCHLEIDTSAIDDRVVIDGED--VTKEI
KCY_LEIXX       ----------------LDPAD--PAVVIDSLPDFDYRIGTDPDTYRVFVGERD--VTEAI
KCY_THET8       ----------------VDPGD--EEGLLALLEGLGVRLLAQAEGNRVLADGED--LTSFL
KCY_THET2       ----------------VDPGD--EEGLLALLEGLGVRLLAQAEGNRVLADGED--LTPFL
KCY_DEIDV       ----------------LDLTD--QASLLAYLRDHPLRLEPLAEGNRVWQGQRD--LTPEL
KCY_DEIRA       ----------------LDLSD--APRLLAHLRALPLRLEPLAEGNRVWSGERD--LTPGL
KCY_DEIGD       ----------------LPLDD--PTTLLPQLHAHPLRLEALPEGNRVWAGERE--LTAEL
KCY_BDEBA       ----------------IDLDD--VSTLASLTHDPVWSVKMDDERTRVFFKDQD--VTDQI
KCY_MYCH7       -------------KNQISITSERKMIKHLPPNFLSLDF-----EGNVWLQNQN--VSNLL
KCY_MYCHJ       -------------KNQISITSERKMIKHLPPNFLSLDF-----EGNVWLQNQN--VSNLL
KCY_MYCH2       -------------KNQISITSERKMIKHLPPNFLSLDF-----EGNVWLQNQN--VSNLL
KCY_MYCS5       -------------KNDIDINNEKDVISSLDSLEFSLSK-----NEELFYKGEN--ITLIL
KCY_MYCAP       -------------QMGVDFEVENEVFKMLSEIEIDLDE-----HENIFLNGEN--VSETI
KCY_MYCPU       -------------KFNLTQDL---LVKELKNIKINYVN-----EDQIFLNNQD--IAPYL
KCY_MYCCT       -------------SKNIDINNQNQIIKLLDSFDYKIS------NDQVFVNNTN--VTNKL
KCY_MYCMS       -------------FKNIDINNQDQIIKLLDSFDYKIS------DEQIFVNNIN--VTNKL
KCY_MESFL       -------------ESEIDFNNKEEIIESLKKFDFSVK------NNKPHLNGKE--VEKRI
KCY_BORHD       -------------LNEYDLLSESKILELVLQNDIKFN------GVDFLLNGVN--VTSHI
KCY_BORT9       -------------LNEYDLLSESKILELVSQNDIKFN------GFDFLLNGTN--VISHI
KCY_BORRA       -------------LNEYDLLNESKLVDLISQNDIKYN------DNSFLLNGVD--VISHI
KCY_BORDL       -------------LNEYDLLNESKLVDLISQNDIKYN------DNSFLLNGVD--VISHI
KCY1_BORBP      -------------MSSCDFISEDRLLNLILENDISFN------DSSFFLNGEN--VESQI
KCY1_BORAP      -------------ISGCDFISENRLLNLVLENDISFN------DSSFLLNGEN--VENQI
KCY_BORBZ       -------------MNSCDFISEDSLLNLILENDISFN------NSTFLLNGEN--VENQI
KCY1_BORBU      -------------MNSCDFISEDSLLNLILENDISFN------NFAFLLNGEN--VENQI
                                                                            

KCY_UREP2       RSNDVAMIASVVSANEKIRDLATNEQRRIASEN-----NVVMDGRDIGSIVLTNADLKFY
KCY_UREPA       RSNDVAMIASVVSANEKIRDLATNEQRRIASEN-----NVVMDGRDIGSIVLTNADLKFY
KCY_UREU1       RSNDVAMLASVVAANAKIRNLATNEQRKIASEN-----NVVMDGRDIGSIVLVDADLKFY
KCY_MYCGA       NDPTISKGASEIAQDPKIRAYALSLQQDYANKK-----PVVMDGRDITSVVLPNAILKVF
KCY_MYCPN       LNQEIAQLASNLATNPEVRKMAVLRQQALAKNT-----NIVMDGRDIGTVVLKDAQLKYF
KCY_MYCGE       TTQSVANIASKIAVDPNIRKIAVIKQQKLAENK-----NIVMDGRDIGTVVLKNAQLKFF
KCY_AQUAE       RSEEVGKRASELGSIPEFRERINKLFKEIINNKQ-----MVVEGRDAGTHIIPEAPVKVF
KCY_HYDS0       TKEYVGALASEVAKEPSLREKIIVFQRSLVKDN------AVVEGRDVGTHIFKDATIKFF
KCY_RICPU       -NENIGNIASQIAVISEIRNNLNKYLINLVKTTP----RMIMEGRDIGTVVAPDADLKIF
KCY_RICAE       -NENIGNIASQIAVISEIRNNLNKYLINLVKTTP----RMIMEGRDIGTVVAPDADLKIF
KCY_RICCN       -NENIGNIASQIAVISEIRNNLNKYLISLVKTTP----RMIMEGRDIGTVVAPDADLKIF
KCY_RICRS       -NENIGNIASQIAVISEIRNNLNKYLINLVKTTP----RMIMEGRDIGTVVAPDADLKIF
KCY_RICRO       -NENIGNIASQIAVISEIRNNLNKYLINLVKTTP----RMIMEGRDIGTVVAPDADLKIF
KCY_RICFE       -NEDIGNIASQIAVISEVRNNLNKYLINLVKTTL----RIIMEGRDIGTVIAPDADLKVF
KCY_RICCK       -NENIGDIASQIAVISEVRNNLNKYLINLVKTTP----RIIMEGRDIGTVVAPDADLKIF
KCY_RICAH       -HESIGDMASQIAVISEVRNNLNKYLINLVKTTP----RIIMEGRDIGTVVVPEADLKIF
KCY_RICTY       -NEDIGDIASKIAVISEVRNNLNHNLINLVKTTP----RIIMEGRDIGTVVAPDADLKIF
KCY_RICPR       -NEDIGDIASQIAVISDVRNNLNENLINLVKTTP----RIIMEGRDIGTVVAPDADLKIF
KCY_RICB8       -DENIGGVASQIAVIAEVRDNLNKHLVKLINTTP----RILMEGRDIGTIVAPNADFKIF
KCY_RICBR       -DENIGGVASQIAVIAEVRDNLNKHLVKLINTTP----RILMEGRDIGTIVAPNADFKIF
KCY_THEM4       RTPEIGIYASKYAKRLPVRNYLTKIQREIAKNQ-----SIVVEGRDIGTVVLPDAEVKIF
KCY_THEAB       RTPYAGICASKYAKKAIVREFLTRIQQKISKNE-----NIVVEGRDIGTVVIPDAEVKIF
KCY_FERNB       RTPEAGMFASQYAANPEVREFLTKIQKQICSNR-----SIVAEGRDIGTVVMPDATVKIF
KCY_THEMA       QSPEAGVLASNFARLEVVRRHLVRIQREICDDK-----NIVVEGRDIGTVVLPNAHLKIF
KCY_THESQ       QSPEAGVLASNFARLEVVRRHLVRIQREICDDK-----NIVVEGRDIGTVVLPNAHLKIF
KCY_THEP1       QSPEAGVLASNFARLEVVRRHLVRIQREICDDK-----NIVVEGRDIGTVVLPNAHLKIF
KCY_THENN       QSPEAGILASDFAKLDLVREHLVRIQREICDDK-----NIVVEGRDIGTVVLPDAQLKIF
KCY_PSELT       RSSEAGKLASDFATIPAVRERLTQIQRHICQNG-----KFVVEGRDIGTVVLPEADVKIF
KCY_LEPBJ       RTPEITREIKHIANRRIYRNFVNQELHSLAKLH-----KLIIDGRDIGTEVFPDAKFKFY
KCY_LEPBL       RTPEITREIKHIAKRRIYRNFVNQELHSLAKLH-----KLIIDGRDIGTEVFPDAKFKFY
KCY_LEPIN       RTPEITREIKHIANRRIYRDFVNKELHSLAKLH-----KLIMDGRDIGTEVFPDAKFKFY
KCY_THEYD       RDPKIGEITSQLSTQKVVRDFLMPLQRSFAEKV-----DIVAEGRDMTTVVFPDAWKKFY
KCY_GEOKA       RGEAVTNAVSLVAKHPLVREEMVARQRALAEGG-----GVVMDGRDIGTHVLPNAEVKIF
KCY_GEOTN       RGEAVTNAVSFVAKHPLVREEMVARQRALAEGG-----GVVMDGRDIGTNVLPNAEVKIF
KCY_GEOSW       RSEEVTNAVSLVAKHPSVREEMVARQRALAKNG-----GVVMDGRDIGTYVLPNAEVKIF
KCY_ANOFW       RTNDVTNNVSYVAKHPAVREEMVKRQRELGQHG-----GVVMDGRDIGTHVLPHAEVKIF
KCY_BACC7       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACCZ       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACHK       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACC0       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACCQ       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACC3       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACAH       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACAN       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACAA       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACAC       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACC1       RTPEVTNRVSIVAKHRLVREEMVRRQQELAEKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACMK       RTPDVTNRVSIVAKHRLVREEMVRRQQGLAKKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACC4       RTPDVTNRVSIVAKHRLVREEMVRRQQELAKKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACCR       RTPDVTNRVSIVAKHRLVREEMVRRQQELAKKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACC2       RTPDVTNRVSIVAKHRLVREEMVRRQQDLAKKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACCN       RTPDVTNRVSIVAKHRLVREEMVRRQQELAAQG-----GVVMDGRDIGTHVLPNAEVKIF
KCY_BACSU       RTDEISNQVSIAAKHRSVREEMVKRQQQLGEKG-----GVVMDGRDIGTHVLPNAEVKIF
KCY_BACVZ       RKDEVSNQVSIAAKHKGVREEMVKRQQQLGQKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACP2       RTDRVSNQVSVVAKHRAVREEMVRRQQELGKKG-----GVVMDGRDIGTHVLPDAEVKIF
KCY_BACLD       RTDSVSNQVSIVAKYAGIREEMTKRQQQLAEKG-----GVVMDGRDIGTHVLPNAEVKIF
KCY_OCEIH       RYPDVTSKVSFVAEHPSIRKEMVSRQQKLANNR-----SVVMDGRDIGTHVLPDAEVKIF
KCY_LISIN       RSLEVTNHVSIVAAHPAIREALQERQQVFATEG-----GIVMDGRDIGTAVLPNAELKIF
KCY_LISW6       RSLEVTNHVSIVAAHPAIREALQERQQIFATEG-----GIVMDGRDIGTAVLPNAELKIF
KCY_LISMC       RSLEVTNHVSIVAAHPSIREALQERQQVFATEG-----GIVMDGRDIGTAVLPNAELKIF
KCY_LISMF       RSLEVTNHVSIVAAHPSIREALQERQQVFATEG-----GIVMDGRDIGTAVLPNAELKIF
KCY_LISMH       RSLEITNHVSIVAAHPSIREALQERQQVFATEG-----GIVMDGRDIGTAVLPNAELKIF
KCY_LISMO       RSIEVTNHVSIVAAHPSIREALQERQQVFATEG-----GIVMDGRDIGTAVLPNAELKIF
KCY_STRPG       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRP8       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRP6       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRP3       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRPQ       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRPZ       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRPM       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRPF       RQNDVTNNVSWVSALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRPC       RQNDVTNNVSWISALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRPB       RQNDVTNNVSWISALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRP1       RQNDVTNNVSWISALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRPD       RQNDVTNNVSWISALPEIREELVHQQRRIAQAG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STREM       RQNDVTNNVSWVSALPEIREELVKQQRRIARTG-----AIIMDGRDIGTVVLPDAELKIF
KCY_STRE4       RQNDVTNNVSWVSALPEIREELVNQQRRIARTG-----AIIMDGRDIGTVVLPDAELKIF
KCY_STRU0       RQNDVTNNVSWVSAIAEIREELVAQQRRIAQDG-----AIIMDGRDIGTVVLPDAELKIF
KCY_STRA5       RQNDVTNNVSWVSAIPEIREELVNQQRRIAKDG-----AIIMDGRDIGTVVLPDAELKIF
KCY_STRA3       RQNDVTNNVSWVSAIPEIREELVNQQRRIAKDG-----AIIMDGRDIGTVVLPDAELKIF
KCY_STRA1       RQNDVTNNVSWVSAIPEIREELVNQQRRIAKDG-----AIIMDGRDIGTVVLPDAELKIF
KCY_STRT2       RDNQVTNNVSWVAAIPEVRQELVSQQQRIAQEG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRT1       RDNQVTNNVSWVAAIPEVRQELVSQQQRIAQEG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRTD       RDNQVTNNVSWVAAIPEVRQELVSQQQRIAQEG-----GIIMDGRDIGTVVLPDAELKIF
KCY_STRGC       RENDVTNNVSWVSAIPEVREKLVSLQQQIASQG-----GIVMDGRDIGTVVLPDAELKIF
KCY_STRSV       RENEVTNNVSWVSAIPQVREKLVALQQQIAAQG-----GIVMDGRDIGTVVLPQAELKIY
KCY_STRS2       RDNQVTNNVSAVAALPLVREELVRLQQDIAQAG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRSY       RDNQVTNNVSAVAALPLVREELVRLQQDIAQAG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRPI       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRP2       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRR6       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRPS       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRZJ       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRZP       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRPJ       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRPN       RENEVTNHVSAIAAIPQVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRP7       RENEVTNHVSAIAAIPQVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRP4       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRZT       RENEVTNHVSAIAAIPEVREKLVSLQQEIAQQG-----GIVMDGRDIGTVVLPQAELKIF
KCY_STRMU       RENEVTNNVSTVAALPLVRKTLVDLQQQLAKKG-----GIVMDGRDIGTVVLPDAELKIF
KCY_LACLM       RTNEVTNAVSKISAMMEIREFMVAEQQRIAQKG-----GIIMDGRDIGTVVLPQANLKIF
KCY_LACLS       RTNEVTNAVSKISAMVEIREFMVAEQQRIAQKG-----GIIMDGRDIGTVVLPQANLKIF
KCY_LACLA       RTNEVTNTVSKISAMTEIREFMVAEQQRIAKNG-----GIIMDGRDIGTVVLPKADLKIF
KCY_ENTFA       RQPDVTNAVSAVSKHAKVREEMVALQQKIGQAG-----GVVMDGRDIGTAVLPKAEVKIF
KCY_LACS1       RTPDITNNVSLVSAQPSVRQDLTHRQQEIADNG-----GIVMDGRDIGTTVLPNAEVKIF
KCY_LACPL       RQPDVTNNVSTIAALPQVRTILTEQQREMANAG-----GIVMDGRDIGTTVLPNAEVKIF
KCY_LEUMM       RSAEVTNNVSVVASFADVRSNLVNRQREIANNN-----SVIMDGRDIGTTVLPEADVKIF
KCY_LEUCK       RSTEVTNNVSLIASYKAVRADLVRRQRDIANSQ-----NVIMDGRDIGTTVLPNAQVKIF
KCY_PEDPA       RQANVTNSVSTIAAQKAVREVLTNWQRDLAKNG-----GIVMDGRDIGSAVLPNAEVKIF
KCY_LACRD       RLPKVAANVSAVAAVPAVREEMTKQQRQIAENG-----GIVMDGRDIGTTVLPQAPVKIF
KCY_LACRJ       RLPKVAANVSAVAAVPAVREEMTKQQRQIAENG-----GIVMDGRDIGTTVLPQAPVKIF
KCY_LACF3       RSTEVAQHVSTVAAIPAVRSRMVELQRQIAQEG-----GIVMDGRDIGTTVLPDAPVKIF
KCY_EXISA       RSSEVTNNVSFVARQPEVRDALMDLQRDLAKKG-----GVVMDGRDIGTHVLPNADLKVF
KCY_EXIS2       RTNEVTNNVSFVARQAEVRSALVIAQRKLAERG-----GIVMDGRDIGTVVLPEAELKVF
KCY_LYSSC       RSNEVTSSVSQVAAHAKVRELLVAQQQKLAANG-----GVVMDGRDIATHVLKNAELKIF
KCY_STAAM       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAA9       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAA1       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAE       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAT       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAS       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAA2       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAN       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAW       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAC       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAR       RNNDVTQHVSYVASKEPVRSFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAAB       RNNDVTQHVSYVASKEPVRLFAVKKQKELAAEK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STAEQ       RENDVTHHVSYVASKEPVRSFAVKIQKELAAKK-----GIVMDGRDIGTVVLPDAELKVY
KCY_STAES       RENDVTHHVSYVASKEPVRSFAVKIQKELAAKK-----GIVMDGRDIGTVVLPDAELKVY
KCY_STAHJ       RENDVTQNVSYVASKEPVRTFAVEKQKDLAAKK-----GIVMDGRDIGTVVLPDAELKVF
KCY_STAS1       RENDVTNHVSYVASKEAVRTFSVNKQQELAAKK-----GIVMDGRDIGTVVLPDADLKVY
KCY_STACT       RSNEVTQNVSYVASKEPVRTFAVKVQQQLAAEK-----GIVMDGRDIGTVVLPDAELKIY
KCY_MACCJ       REHDVTLNVSRIASIESVRTKLVNLQQNMTANK-----GVVMDGRDIGTKVIPEAELKVY
KCY_BACSK       RTNEVNSNVSLVASHREVREGMTAMQQELAKSK-----NAVLDGRDIGTHVLPDANVKVF
KCY_BACHD       RTEEVTKTVSLVSSHGQVRKEMVRQQRLLAEGT-----NCVLDGRDIGTYVLPNAELKFF
KCY_LACJO       RTPEITENVSQVSALRSIREKMVELQREMAGKH-----DVIMDGRDIGTTVLPDAEVKIF
KCY_LACGA       RTPEITENVSQVSALKSIREKMVELQREMAGKH-----DVIMDGRDIGTTVLPDAEVKIF
KCY_CARHZ       RTPQVSELVAKVSALPEVRKYLTELQRKIIAKG-----NVVADGRDIGTVVMPEAEVKIF
KCY_CALS4       RKPIISQKVSVVSQIPEVREILVKKQRKIAEGK-----NVVMDGRDIGTVVLPDAQFKFF
KCY_CLOB1       RMPIINNNVSKYAAVEEVRELLVSMQQNISKKY-----NVVMDGRDIGTVVLKDAPYKFF
KCY_CLOBH       RMPIINNNVSKYAAVEEVRELLVSMQQNISKKY-----NVVMDGRDIGTVVLKDAPYKFF
KCY_CLOBJ       RMPIINNNVSKYAAVEEVRELLVSMQQNISKKY-----NVVMDGRDIGTVVLKDAPYKFF
KCY_CLOBK       RMPIINNNVSKYAAVEEVRELLVSMQQNISKKY-----NVVMDGRDIGTVVLKDAPYKFF
KCY_CLOBL       RMPIINNNVSKYAAVEEVRELLVSMQQNISKKY-----NVVMDGRDIGTVVLKDAPYKFF
KCY_CLOBM       RMPIINNNVSKYAAVEEVRELLVSMQQNISQKY-----NVVMDGRDIGTVVLKDAPYKFF
KCY_CLOTE       RKPNVSSNVSLYASVLEVRTLLVDIQKDLACKY-----EVVMDGRDIGTVVMPHAPFKFF
KCY_CLOAB       LLPKTSQNVSDYASVLEVREKLVYLQKKMAGRY-----DVVMDGRDIGTVVLNDAPFKFY
KCY_CLOP1       TMPNISKNVSAYASIREVRERLVNLMRKMALKY-----SVIMDGRDIGTVVLKDANFKFF
KCY_CLOPE       TMPNISKNVSAYASIREVRERLVNLMRKMALKY-----SVIMDGRDIGTVVLKDANFKFF
KCY_CLOPS       TMPNISKNVSAYASIREVRERLVNLMRKMALKY-----SVIMDGRDIGTVVLKDANFKFF
KCY_FUSNN       REKRINENVSKVASIKIVRDNLVNLQRKISNNK-----NVILDGRDIGTVVFPNAKVKIF
KCY_ALKOO       RSIEINKKVSHVAKIKEVREILVDAQRKIALGQ-----DVIMDGRDIGTHVLPNATLKIF
KCY_CLOD6       RTIEVSNNVSNVAKIKEVRQLMVEVQRKIGMKN-----SVILDGRDIGSYVFPDADYKFF
KCY_ALKMQ       RSPEVNNNVSHIAKIPEVRKHLVSLQKCIALSQ-----NVIMDGRDIGTHVLPDADIKVF
KCY_CALBD       RQPEVSMYASDVSKIREVRERLVKMQQELAKQK-----GVIMDGRDIGTHVLPNAELKIF
KCY_CALS8       RQPSVSMYASDVSKIKEVREKLVKIQQDLAKQK-----GVIMDGRDIGTYVLPDAELKIF
KCY_ONYPE       KSLDVEKHVSSVALIPAVRTKLLKLQKEICGNTP----NLIMDGRDIGTVVMPDANLKIF
KCY_AYWBP       KSLDVEKHVSSVALIPGVRTKLLKLQKEICANTP----NLIMDGRDIGTVVMPDANLKIF
KCY_PHYAS       KNYIVEKDVSVIASLPAVRKKLLTLQKGICKKIP----YLIMDGRDIGTVVIPDADLKIF
KCY_PHYMT       KRIEIDNKVSLVASLPFIRQKLLLLQQEIIKNNP----YLIMDGRDIGTIVMPNADLKIF
KCY_ACHLI       RSKAVTDHVSLVSSFPYVRKKLVEIQQKLGETN-----NIIMDGRDIGTVVLPDADLKIF
KCY_PARUW       RGKEVTSSVSKVSAIKAVREKLMAIQRELAEGV-----NAVFEGRDMGTVVFPNANIKIF
KCY_RHOBA       RTPQVTSHIRYLADPPRIRERITAQQRRIATGR-----DIVTEGRDQGTEVFPDAHCKIF
KCY_ECOL6       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOSM       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SHIFL       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOUT       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO81       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO55       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO7I       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOSE       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOK1       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOHS       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOLU       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOL5       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOBW       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SHIF8       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO57       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO24       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOLC       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECOLI       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO5E       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO45       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SHIB3       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO8A       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECODH       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ECO27       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SHIDS       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SHIBS       RTQEVANAASQVATFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SHISS       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ESCF3       RTQEVANAASQVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALNS       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALTI       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALDC       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALPC       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALSV       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALEP       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALG2       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALHS       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALPB       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALA4       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALTY       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALPK       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALPA       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALCH       RTQEVANAASQVAAFPRVREALLRRQRAFRKA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SALAR       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_CITK8       RTQEVANAASQVAAFPRVREALLRRQRAFRDA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ENT38       RTQEVANAASQVAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_KLEP7       RTQEVANAASKVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_KLEP3       RTQEVANAASKVAAFPRVREALLRRQRAFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_ERWT9       RTQDVSNTASRVAAFPRVREALLRRQRGFREL-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SODGM       RNETVGNTASQIAAFPRVREALLRRQRAFRAA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_YERPP       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERPE       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERPG       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERPY       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERPB       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERPA       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERPN       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERP3       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERPS       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTIVFPDAPVKIF
KCY_YERE8       RTETVGNTASQAAAFPRVREALLRRQRAFREP-----PGLIADGRDMGTVVFPDAPVKIF
KCY_SERP5       RTETVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_PECCP       RTEAVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_PECAS       RTEAVGNTASQAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_EDWI9       RTETVGNTASRAAAFPRVREALLRRQRAFREA-----PGLIADGRDMGTVVFPDAPVKIF
KCY_PROMH       RTETVGNTASQAATFPRVREALLRRQRAFRTA-----PGLIADGRDMGTIVFPDAQVKIF
KCY_PHOLL       RTEAVGNTASQAAAFPRVREALLRRQRAFRVA-----PGLIADGRDMGTVVFSDAPVKIF
KCY_AERS4       RTEEVGNAASKIAAFPRVREALLRRQRAFRQT-----PGLIADGRDMGTVVFPDAEVKIF
KCY_AERHH       RTEEVGNAASKIAAFPRVREALLRRQRAFRQA-----PGLIADGRDMGTVVFPEAEVKIF
KCY_ALIF1       RKEETGMAASKVAALPQVREALLRRQRAFSAQ-----PGLIADGRDMGTVVFPNAEVKIF
KCY_ALIFM       RKEETGMAASKVAALPQVREALLRRQRAFSAQ-----PGLIADGRDMGTVVFPNAEVKIF
KCY_ALISL       RKEETGMAASKVAALPQVREALLRRQRAFASA-----PGLVADGRDMGTVVFTGAEVKIF
KCY_VIBVU       RKEETGMAASKVAALPRVREALLRRQRAFEAA-----PGLVADGRDMGTVVFPNAKAKIF
KCY_VIBVY       RKEETGMAASKVAALPRVREALLRRQRAFEAA-----PGLVADGRDMGTVVFPNAKAKIF
KCY_VIBPA       RKEETGMAASKVAALPRVREALLRRQRAFEAA-----PGLVADGRDMGTVVFPSAQAKIF
KCY_VIBCB       RKEETGMAASKVAALPRVREALLRRQRAFETA-----PGLVADGRDMGTVVFTGAQAKIF
KCY_VIBTL       RKEETGMAASKVAALPRVREALLRRQRAFSAA-----PGLVADGRDMGTVVFVEAEAKIF
KCY_VIBCH       RKEETGMAASKVAALPRVREALLRRQRAFASG-----IGLVADGRDMGTVVFPAAEAKIF
KCY_PHOPR       RKEETGMTASKVAALPRVREALLRRQRAFSNA-----PGLVADGRDMGTVVFPNAIVKIF
KCY1_HAEIN      RTQEVADAASKVAVFQKVRSALLQLQQDFAKN-----DGLIADGRDMGTVVFPNAQVKLF
KCY2_HAEIN      RTQEVADAASKVAVFQKVRSALLQLQQDFAKN-----DGLIADGRDMGTVVFPNAQVKLF
KCY_ACTSZ       RTQDVADAASKVAVFPAVRSALLQLQQDFAKQG----KGLIADGRDMGTVVFPNAQVKLF
KCY_MANSM       RTQEVADAASKVAVFPQVRSALLQLQKDFATP-----KGLIADGRDMGTVVFPTAQVKLF
KCY_PASMU       RTQEVAEAASKVAVFPEVRKALLQRQQDFSTE-----NGLIADGRDMGTVVFPNAQVKLF
KCY_HAEDU       RSAEAGQNASKIAIFPKVRAALLQRQRDFSSP-----MGLIADGRDMGTIVFPDAQVKFF
KCY_BLOFL       HTEFVGNLASKIALFPKVRDVLLKYQRTFCVF-----PGLVADGRDMGTIVFPNAIVKIF
KCY_SHESH       RSQECSNAASKVAAYPRVREALLRRQRAFNEA-----PGLIADGRDMGTVVFPNTPAKIY
KCY_SHEWM       RSQECSNAASKVAAFPRVREALLRRQRAFSEA-----PGLIADGRDMGTVVFSKAPVKLY
KCY_SHEHH       RSQECSNAASKVAAFPRVREALLRRQRAFAEA-----PGLIADGRDMGTVVFPATPAKLY
KCY_SHEPA       RSQECSNAASKVAAFPRVREALLRRQRAFAEA-----PGLIADGRDMGTIVFPTTPAKLY
KCY_SHEPW       RSQECSNAASKVAAFPRVREALLRRQRAFAEA-----PGLIADGRDMGTVVFPATPAKLF
KCY_SHELP       RSQECSNAASKVAAFPRVREALLRRQRAFAEA-----PGLIADGRDMGTVVFPTSPAKLY
KCY_SHESM       RTQECSNAASKVAAFPRVREALLRRQRAFRTA-----PGLIADGRDMGTVVFPTASAKLY
KCY_SHESA       RTQECSNAASKVAAFPRVREALLRRQRAFRTA-----PGLIADGRDMGTVVFPTASAKLY
KCY_SHEON       RTQECSNAASKVAAFPRVREALLRRQRAFRTA-----PGLIADGRDMGTVVFPTASAKLY
KCY_SHESR       RTQECSNAASKVAAFPRVREALLRRQRAFRAA-----PGLIADGRDMGTVVFPTASAKLY
KCY_SHEPC       RTQECSNAASKVAAFPRVREALLRRQRAFRTA-----PGLIADGRDMGTVVFPTAPAKLY
KCY_SHESW       RTQECSNAASKVAAFPRVREALLRRQRAFRTA-----PGLIADGRDMGTVVFPTAPAKLY
KCY_SHEB5       RTQECSNAASKVAAFPRVREALLRRQRAFKTA-----PGLIADGRDMGTVVFPSAPAKLY
KCY_SHEB2       RTQECSNAASKVAAFPRVREALLRRQRAFKTA-----PGLIADGRDMGTVVFPSAPAKLY
KCY_SHEB9       RTQECSNAASKVAAFPRVREALLRRQRAFKTA-----PGLIADGRDMGTVVFPSAPAKLY
KCY_SHEB8       RTQECSNAASKVAAFPRVREALLRRQRAFKTA-----PGLIADGRDMGTVVFPSAPAKLY
KCY_SHEAM       RTQECSNAASKVAAFPRVREALLRRQRAFCQA-----PGLIADGRDMGTVVFPTAPAKLY
KCY_SHEDO       RSQECSNAASKVAALPRVREALLRRQRAFSTA-----PGLIADGRDMGTVVFPKAAAKIF
KCY_SHEFN       RTQECSNAASKVAALPRVREALLRRQRAFSAA-----PGLVADGRDMGTVVFSKAPVKIF
KCY_COLP3       RTEEVGGLASKVAAFPRVREALLRRQRAFSVS-----PGLIADGRDMGTVVFPKAPVKIF
KCY_MARMS       RTEEVGNCASKLAAIPEVREGLLLRQRAFSQS-----PGLVADGRDMGTVVFPSAQIKIF
KCY_PSE14       RNEQVGSGASQVASLPAVRDALLLRQRAFQEE-----PGLVADGRDMGTVVFPDAPLKIF
KCY_PSEU2       RNEQVGSGASQVASLPAVRDALLLRQRAFQEE-----PGLVADGRDMGTVVFPDAPLKIF
KCY_PSESM       RNEQIGSGASQVASLPAVRDALLMRQRAFQEE-----PGLVADGRDMGTVVFPDAPLKVF
KCY_PSEF5       RNEQVGAWASQVAALPAVRDALLQRQRAFQEP-----PGLVADGRDMGTVVFPDAPLKIF
KCY_PSEFS       RNEQVGSWASQVAALPAVRDALLQRQRAFQEP-----PGLVADGRDMGTVVFPEAPLKIF
KCY_PSEPF       RTESVGSGASQVAALPAVREALLQRQRAFQEA-----PGLVADGRDMGTVVFPNAPLKIF
KCY_PSEPK       RTETVGAGASMVASLPAVRDALLVRQREFREV-----PGLIADGRDMGTVVFPDAPLKVF
KCY_PSEPG       RTETVGAGASMVASLPAVRDALLVRQREFRDV-----PGLIADGRDMGTVVFPDAPLKVF
KCY_PSEPW       RTETVGAGASMVASLPAVREALLQRQRAFRET-----PGLIADGRDMGTVVFPDAPLKVF
KCY_PSEE4       RTETVGAGASMVASLPAVREALLQRQRAFREA-----PGLIADGRDMGTVVFPDAPLKVF
KCY_AZOVD       RNEQVGAGASQVASLPAVREALLQRQHAFLEP-----PGLVADGRDMGTVVFPDAPLKVF
KCY_PSEU5       RNETVGAGASQVAALPVVRTALLQRQKAFREA-----PGLVADGRDMGTVVFPDAPLKIF
KCY_PSEAB       RTEQVGAGASQVAALPAVRDALLQRQRAFREA-----PGLVADGRDMGTVVFPDAPLKIF
KCY_PSEAE       RTEQVGAGASQVAALPAVRDALLQRQRAFREA-----PGLVADGRDMGTVVFPDAPLKIF
KCY_PSEA8       RTEQVGAGASQVAALPAVRDALLQRQRAFLEA-----PGLVADGRDMGTVVFPDAPLKIF
KCY_PSEA7       RTEQVGAGASQVAALPAVRDALLQRQRAFREA-----PGLVADGRDMGTVVFPDAPLKIF
KCY_METCA       VTEECGNLASKLAAFPAVRQALLDKQRGFRRP-----PGLVADGRDMGTVVFPDAPYKVF
KCY_NITOC       RREECGNAASKIAALAEVRGALLMRQRAFRKA-----PGLVTDGRDMGTVVFPEADLKIF
KCY_SACD2       RAEEIGMLASTVAAYPAVRQALLDRQRAFLTA-----KGLVADGRDMGTVVFPAAPLKIF
KCY_NEIMF       RTEAIGMGASAVAQLPKVRAALLQRQRDFLTE-----KGLVADGRDTGSVVFPQAELKIF
KCY_NEIMB       RTEAIGMGASAVAQLPKVRAALLQRQRDFLTE-----KGLVADGRDTGSVVFPQAELKIF
KCY_NEIMA       RTEAIGMGASAVAQLPKVRASLLQRQRDFLTE-----KGLVADGRDTGSVVFPQAELKIF
KCY_NEIG1       RTEAIGMGASAVAQWPKVRAALLQRQRDFLTE-----KGLVADGRDTGSVVFPQAELKIF
KCY_CHRVO       RAEEIGIGASKVGALPAVRAALLQRQRDFCEA-----PGLVTDGRDMGSVVFPDATLKIF
KCY_PARPJ       RAEEVGGRASAIAVHAPVRAALVARQRAFRKE-----PGLVADGRDMGTVIFQDAVLKVF
KCY_PARXL       RAEEVGSRASAIAVHAPVRAALVARQRAFRKE-----PGLVADGRDMGTVIFQDAVLKVF
KCY_PARP8       RAEEIGNRASAIAIHAPVRAALVARQRAFRKQ-----PGLVADGRDMGTVIFPDAALKVF
KCY_BURA4       RAEAVGNRASAIAVHGPVRSALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURCM       RAEAVGNRASAIAVHGPVRSALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURCA       RAEAVGNRASAIAVHGPVRTALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURCH       RAEAVGNRASAIAVHGPVRTALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURCC       RAEAVGNRASAIAVHGPVRTALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURCJ       RAEAVGNRASAIAVHGPVRAALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURL3       RAEVVGNRASAIAVHGPVRTALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURM1       RAEAVGNRASAIAVHGPVRTALVARQRAFRKT-----PGLVADGRDMGTVIFPDAMLKVF
KCY_BURVG       RAEAVGNRASAIAVHGPVRVALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURP0       RAEAVGNRASAIAVHASVRAALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURPS       RAEAVGNRASAIAVHASVRAALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURP6       RAEAVGNRASAIAVHASVRAALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_BURM9       RAEAVGNRASAIAVHASVRAALVARQRAFRKT-----PGLVADGRDMGTLIFPDAVLKVF
KCY_BURMA       RAEAVGNRASAIAVHASVRAALVARQRAFRKT-----PGLVADGRDMGTLIFPDAVLKVF
KCY_BURMS       RAEAVGNRASAIAVHASVRAALVARQRAFRKT-----PGLVADGRDMGTLIFPDAVLKVF
KCY_BURM7       RAEAVGNRASAIAVHASVRAALVARQRAFRKT-----PGLVADGRDMGTLIFPDAVLKVF
KCY_BURTA       RAEAVGNRASAIAVHAPVRAALVARQRAFRKT-----PGLVADGRDMGTVIFPDAVLKVF
KCY_CUPNH       RAEAIGNRASAIAVHQPVRDALTQLQRSFRKL-----PGLVADGRDMGTVIFPDAPLKVF
KCY_CUPTR       RAEAIGNRASAIAVHQPVRDALTQLQRSFRKL-----PGLVADGRDMGTVIFPDAQLKVF
KCY_CUPPJ       RAEAIGNRASAIAVHQPVRDALTKLQRDFRKL-----PGLVADGRDMGTVIFPDAQLKVF
KCY_CUPMC       RLEAIGNRASAIAVHQPVRDALTALQRGFRKL-----PGLVADGRDMGTVIFPDAPLKVF
KCY_RALPJ       RHESVGNQASAIAVHGAVREALHARQRAFLEA-----PGLVADGRDMGTVVFPEAVLKVF
KCY_RALSO       RHESVGNQASAIAVHGPVREALRARQRAFLEA-----PGLVADGRDMGTVIFPEAVLKVF
KCY_POLAQ       RTESIGLRASALAVHPEVRSALVGLQRSFRQF-----PGLVADGRDMASVIFPDAVLKVF
KCY_POLNS       RVESIGLRASALAVHPEIRSALVGLQRSFRQS-----PGLVADGRDTASVIFPDAILKVF
KCY_NITEU       RAEACGEYASRIAQYSALRVELLGYQRDFRKS-----PGLVTDGRDMGSVIFPDATLKIY
KCY_NITEC       RAEACGEYASKIAQYSALRVELLERQRDLRKL-----PGLVADGRDMGSVIFPDATLKIY
KCY_BORBR       RQEEVGNYASRIAAYPGVRQALLERQRAFRQP-----PGLVADGRDMGTVVFPDASLKIF
KCY_BORPA       RQEEVGNYASCIAAYPGVRQALLERQRAFRQP-----PGLVADGRDMGTVVFPDASLKIF
KCY_BORPE       RQEEVGNYASRIAAYPGVRQALLERQRAFRQP-----PGLVADGRDMGAVVFPDASLKIF
KCY_XANCP       RLETTGALASAIAAIPEVRSALKERQRAFRQP-----PGLVADGRDMGTVIFPDAAFKVF
KCY_XANC8       RLETTGALASAIAAIPEVRSALKERQRAFRQP-----PGLVADGRDMGTVIFPDAAFKVF
KCY_XANCB       RLETTGALASAIAAIPEVRSALKERQRAFRQP-----PGLVADGRDMGTVIFPDAAFKVF
KCY_XANC5       RLETTGALASAIAAIPEVRSALKERQRAFRRA-----PGLVADGRDMGTVIFPDAAYKVF
KCY_XANAC       RLETTGALASAIAAIPEVRSALKERQRAFRRA-----PGLVADGRDMGTVIFPDAAYKVF
KCY_XANOR       RLETTGALASAIAAIPEVRSALKERQRAFRRA-----PGLVADGRDMGTVIFPDAAFKVF
KCY_XANOM       RLETTGALASAIAAIPEVRSALKERQRAFRRA-----PGLVADGRDMGTVIFPDAAFKVF
KCY_XANOP       RLETTGALASAIAAIPEVRSALKERQRAFRRA-----PGLVADGRDMGTVIFPDAAFKVF
KCY_STRM5       RLETTGALASAIAAIPEVRAALKERQRAFREL-----PGLVADGRDMGTVIFPDASYKVF
KCY_STRMK       RLETTGALASAIAAIPEVRAALKERQRAFREL-----PGLVADGRDMGTVIFKDAPYKVF
KCY_XYLF2       RMETTGVLASTIASISEVRATLKKRQQMFRRT-----PGLVADGRDMGTVIFPDAKYKVF
KCY_XYLFT       RMETTGVLASTIASISEVRATLKKRQQMFRRT-----PGLVADGRDMGTVIFPDAKYKVF
KCY_XYLFA       RMETTGVLASTIAAISEVRAALKERQQMFRRT-----PGLVADGRDMGTVIFPDAQYKVF
KCY_XYLFM       RMETTGVLASTIAAISEVRAALKERQQMFRRT-----PGLVADGRDMGTVIFPDAQYKVF
KCY_DICNV       RREETGALASQLAVKPEIRAALLDFQRNFAGD-----APLIADGRDMGTVVFPEAPLKIF
KCY_ACIBC       RTERVGEYASKVAAIPELRQALFERQRAFAQT-----PGLVADGRDMATSIFPEANAKIY
KCY_ACIBT       RTERVGEYASKVAAIPELRQALFERQRAFAQT-----PGLVADGRDMATSIFPEANAKIY
KCY_ACIBS       RTERVGEYASKVAAIPELRQALFERQRAFAQT-----PGLVADGRDMATSIFPEANAKIY
KCY_ACIBY       RTERVGEYASKVAAIPELRQALFERQRAFAQT-----PGLVADGRDMATSIFPEANAKIY
KCY_ACIB5       RTERVGEYASKVAAIPELRQALFERQRAFAQT-----PGLVADGRDMATSIFPEANAKIY
KCY_ACIB3       RTERVGEYASKVAAIPELRQALFERQRAFAQT-----PGLVADGRDMATSIFPEANAKIY
KCY_ACIAD       RTERVGEFASKVAAVPELRTALFERQRAFIQL-----PGLVADGRDMATAIFPEAQAKIY
KCY_COXBU       RSEECGALASRASALPIVREAVLQYQRDFRQR-----PGLVADGRDMGTVVFPDAVLKFY
KCY_BUCBP       SQEYIGNLASRLACIPYIRHFLLFQQRSFRKF-----PGLIANGRDMGTVVFPDAIIKFF
KCY_MAGSA       RIDEAAQAASKVASIPGVRAALLDFQRRFAATPP-GGKGAVLDGRDIGTVVCPEAQVKLF
KCY_RHORT       STDTAGKAASVVGAIPEVRAALLDLQRDFATHPPQGAPGAVLDGRDIGTVVCPEAEVKIF
KCY_ACICJ       RTPEVDRAASAVASIKPVRAALLDFQRRFA-----DASGAVLDGRDIGTIVFPEADVKLF
KCY_GRABC       RVPEVDRAASLVAADPAVRAALLDFQRDFA-----AREGAVLDGRDIGTVVCPDAPVKLF
KCY_RHOPA       KSHAVGEAASVVSAHPQVRAALVEFQKTFAA----APPGAVLDGRDIGTVICPDAEVKIF
KCY_RHOPT       KSHAVGEAASVVSAHPQVRAALVEFQKTFAA----APPGAVLDGRDIGTVICPDAEVKIF
KCY_RHOP2       KSQTVGDAASVISAYPKVREVLVGFQRQFAA----EPPGAVLDGRDIGTVICPDADVKIF
KCY_RHOPS       KSQTVGDAASVISAYAPLREALVSFQRQFAA----DPPGAVLDGRDIGTVICPDADVKIF
KCY_RHOPB       KSQTVGEAASVVSALPRVRAALLNFQRQFAA----HPPGAVLDGRDIGTVICPEADVKIF
KCY_RHOP5       KSQAVGEAASVVSALPKVRAALVDFQRRFAD----TPPGAVLDGRDIGTVICPQAEVKIF
KCY_BRASO       RSHEVGSAASVVSALPKVREALLAFQRQFAS----QPPGAVLDGRDIGTVICPDAEVKIY
KCY_NITHX       KTQTVGEVASVVSAFPRVREALLTFQRQFAA----EPPGAVLDGRDIGTVICPEADVKIF
KCY_NITWN       KARAIGEAASVVSTFPKVREALLTFQRQFAA----EPPGAVLDGRDIGTVICPNADVKIF
KCY_OLICO       KTQAIGDAASVVSAIPAVREALINFQRQFAA----DPPGAVLDGRDIGTVICPDADVKIF
KCY_BRADU       KTQKVGEGASIVSAIPRVREVLVNFQRQFAA----DPPGAVLDGRDIGTVICPHADVKIF
KCY_AZOC5       RTGAIGEAASVVAARPGVRAALVDLQRRFAA----RPEGAVLDGRDIGSVICPDATVKLF
KCY_XANP2       RTAELGEAASVVAARGGVRAALLDLQHRFAA----QPGGAVLDGRDIGTVICPKAQAKLF
KCY_METS4       RERAMGEAASLVSALPAVRAALLDWQRRFAA----APGGAVLDGRDIGTVVCPDAPVKLF
KCY_BEII9       RSDEIGQAASIVAAIPDVRAALKDLQRRFAG----TPGGAVLDGRDIGTVICPDADVKIF
KCY_METSB       RSRDMAEAASVVAAIPEVRAALVDMQRRFAG----RPGGALLDGRDIGTVICPDADCKIF
KCY_CAUVC       RTRAAGEAASRCAVHPGVRAALLDLQQTFAA----REPGSVIDGRDIGTVIAPHAPAKLY
KCY_CAUVN       RTRAAGEAASRCAVHPGVRAALLDLQQTFAA----REPGSVIDGRDIGTVIAPHAPAKLY
KCY_CAUSK       RTRAAGEAASRVAVHPGVRAALFDLQRDFAL----REPGCVIDGRDIGTVIAPEAPAKLY
KCY_BRUMB       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUSI       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUO2       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUA2       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUA1       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUAB       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUME       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUC2       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_BRUSU       SAHAIGEAASKVAVMPAVRRALVEAQRHFAN----ALPSSVLDGRDIGTVVCPDAAIKLF
KCY_RHIME       SEHSIGEAASKIAVMPAVRRALVEAQRAFAR----KEPGTVLDGRDIGTVVCPDAAVKLY
KCY_SINMW       SAHAIGEAASKIAVMPAVRRALVEAQRAFAL----KEPGTVLDGRDIGTVVCPDAAVKLY
KCY_AGRFC       SRHEIGEAASKIAVMTPVRRALVKAQKLFAM----REPGTVLDGRDIGTVVCPDAPVKLY
KCY_RHILO       SAHAIGEAASKVAVYPTVRRILVEKQRAFAR----TPPGAVLDGRDIGTVVCPDADIKLY
KCY_BARHE       SSHELGNAASKIAIIPTVRETLVAKQRNFAK----ILPGSVLDGRDIGTIVCPDADVKLY
KCY_BARQU       SSHELGEAASKIALIPALRDILVAKQRDFAR----IFPGSVLDGRDIGTVVCPDADIKFY
KCY_BART1       SSHELGEAASKIALNPTIRKILVEKQRNFAK----TLPGSVLDGRDIGTIVCPDADIKFY
KCY_BARBK       NAHEIGEAASKIATIPAVRKILVAKQRDFIK----IPPGSVLDGRDIGTVVCPDADIKFY
KCY_RHOSK       RSAEAGQAASRVAALPEVRAALVAFQRSFAR----REGGAVLDGRDIGTVICPEAEVKLF
KCY_RHOS4       RSAEAGQAASRVAALPEVRAALVAFQRSFAR----REGGAVLDGRDIGTVICPEAEVKLF
KCY_DINSH       RTAEVGQAASQVAALPQVRAALLDFQRAFAQ----RAGGAILDGRDIGTVICPDAAVKLF
KCY_MAGMM       RDEQVGETASQVAAMPAVRTALLDFQRNYGS-----PQSVILDGRDVGTVVLPDADLKIY
KCY_CHLFF       GTQEVANAASRLSQLPEVRSFMHKLQRKYAEL-----GNCVFEGRDMGSKVFPDADVKIF
KCY_CHLCV       GTQEVANAASKLSQLPEVRSFMHKLQRKYAEL-----GNCVFEGRDMGSKVFPDADVKIF
KCY_CHLAB       GTPEVANMASKLSQLPEVRFFMQQLQRKYAEL-----GNCVFEGRDMGSKVFPDADVKIF
KCY_CHLPN       TTQEVANAASELSQLPEVRAFMQDLQRRYAQL-----GNCVFEGRDMGSKVFPNADLKIF
KCY_CHLTB       SSQEVANFASLFSKEPLVRAYMQTLQKQYATV-----GNCVFEGRDMGSKVFPHAEVKIF
KCY_CHLT2       SSQEVANFASLFSKEPLVRAYMQTLQKQYATV-----GNCVFEGRDMGSKVFPHAEVKIF
KCY_CHLTR       SSQEVANFASLFSKEPLVRAYMQTLQKQYATV-----GNCVFEGRDMGSKVFPHAEVKIF
KCY_CHLTA       SSQEVANFASLFSKEPLVRAYMQTLQKQYATV-----GNCVFEGRDMGSKVFPHAEVKIF
KCY_CHLMU       ISQEVANFASIFSKEPKVRAYMQTLQKRYASV-----GSCVFEGRDMGSKVFPHAEVKIF
KCY_DESVH       RTEEVGAMASRIAALPVVRECLKAAQQRMGAA-----QPLVVEGRDMGTVVFPGARHKFF
KCY_DESVV       RTEDVGAMASRIAALPVVRECLKAAQQRMGAA-----QPLVVEGRDMGTVVFPGARHKFF
KCY_DESAG       RTEEVALLASAVATLPVVRTFLKKTQQKLGSE-----VSLVAEGRDMGTVIFPAARYKFF
KCY_DESAD       RTETVGMWASNMAKIPAVREYQKIAQRAIGET-----TSLIAEGRDMGTVIFPQAPCKFF
KCY_LAWIP       RSETAGILAAQLGERTIIREYLKNIEQQIGNT-----MSIIAEGRDLGTEVFPKAQFKFF
KCY_SYNFM       RNPEMAAYASRISQMRAVRTFLTEWQRKLAEA-----GKVVAEGRDTATVVFPHAGVKVF
KCY_GEOSM       RTEEIGLLTSTVSARQPVRQALLEMQRKMGAK-----GGVILEGRDIGTVVFPDAEVKFF
KCY_GEOBB       RTEEIGLLTSTISARKPVRQALLEMQRKMGAK-----GGVILEGRDIGTVVFPDAEVKFF
KCY_GEOSL       RTPAISALTSAISARKVVRDVLLRLQRHMARE-----GGVILEGRDIGTVVFPDADVKFF
KCY_PELCD       RTPEISLLSSRVSAQPTVRQCMLGLQRQMGEQ-----GGVVLEGRDIGTVVFPSAEVKFF
KCY_DESHD       RSPEVSRSVSIIAAYPEVRERLVELQRQEAGQG-----GVVMDGRDIGTYVLPDADLKIF
KCY_DESHY       RSPEVSRSVSIIAAYPEVRERLVELQRQEAGQG-----GVVMDGRDIGTYVLPDADLKIF
KCY_PELTS       RSPAVSKAVSLVARVPAVRERLVELQRAMASGG-----GVVMEGRDIGTVVLPDAEIKIF
KCY_SYMTH       RSPAVSAVVSQVSAVPRLRQRLIEVQRSMARAG-----GVVMDGRDIGSYVLPHADRKFY
KCY_DESRM       RTPEVTNNVSIVAKIAGVREVLVQRQREMAEEA-----GVVMDGRDIGTVVLPKAKAKFF
KCY_CHLTE       RENRVSREVSFISSLKPVRDKLRELQQEMGRKR-----GIVMDGRDIGTVIFPDAELKIF
KCY_PELPB       RSNQVSREVSFISSLKPVRDRLREMQQHLGRQR-----GVVMDGRDIGTVVFPDAELKIY
KCY_CHLT3       RTNEVSSKVSKVSSLPLVREKLVEYQRNMGKAR-----GVVMDGRDIGTIVFPDAELKVF
KCY_FLAJ1       RTIEVSNFVSKVAEVSEVRSKLVEQQQEMGTNK-----AIVMDGRDIGTVVFPNAELKIF
KCY_FLAPJ       RTIKVSNYVSQVAAISQVRAKLVEQQQQMGKNK-----GIVMDGRDIGTVVFPTAELKIF
KCY_BACFR       RTMEVSSKVSPISALGFVREAMVAQQQEMGKAK-----GIVMDGRDIGTTVFPDAELKIF
KCY_BACFN       RTMEVSSKVSPISALGFVREAMVAQQQEMGKAK-----GIVMDGRDIGTTVFPDAELKIF
KCY_BACTN       RTMGVSSKVSPISALDFVREAMVAQQQAMGKEK-----GIVMDGRDIGTTVFPDAELKIF
KCY_BACV8       RSMEVSSHVSPIAALGFVREALVKQQQEMGKAK-----GIVMDGRDIGTVVFPDAELKIF
KCY_PARD8       RGMEVADKVSPVATLGFVRRALVAKQQEMGKAK-----GIVMDGRDIGTVVFPDAELKLF
KCY_PORG3       RSMEVSAKVSPIATLDFVREAMVREQQAMGKSK-----GIVMDGRDIGTTVFPEAEMKIF
KCY_PORGI       RSMEVSAKVSPIATLDFVREAMVREQQAMGKSK-----GIVMDGRDIGTTVFPEAEMKIF
KCY_CYTH3       RKMYVSEKVSEVSAIPEVRKRMVELQQKMARKR-----GVVMDGRDIGTHVFPDAELKIF
KCY_SALRD       RSAEVGRVVSDISTLAPVREYMVEQQRRIGRAQADRHGGVVLDGRDTGTVVFPKAPVKIF
KCY_ROSCS       RHPDVERIVSITARHPAVRTVMRERQRAIGSRG-----RVVMVGRDIGSIVMPDAPLKIY
KCY_CHLAD       RSPEVERIVSRAARFPSVRREMVRQQQLIGQRG-----RVVMVGRDIGTVVMPNADLKIY
KCY_HERA2       RAANVERNVSQVAAQSAVREALRDIQRQIGKAG-----HVVMAGRDIGAVILPDAQLKIY
KCY_SOLUE       RTPEVSNGASKIGVIPGVRRAMVAKQREIGERT-----SVVMEGRDIGTVVFPQADVKIF
KCY_MYCLB       RTEEVTQAVSAVSAIPAVRVRLVDLQRQMAEGRGS----VVVEGRDIGTVVLPDAPVKIF
KCY_MYCLE       RTEEVTQAVSAVSAIPAVRVRLVDLQRQMAEGRGS----VVVEGRDIGTVVLPDAPVKIF
KCY_MYCA1       RGDKVTAAVSAVSSIPAVRTRLVGLQREMASGPGS----IVVEGRDIGTVVLPDAPVKIF
KCY_MYCPA       RGDKVTAAVSAVSSVPAVRTRLVGLQREMASGPGS----IVVEGRDIGTVVLPDAPVKIF
KCY_MYCBO       RGDAVTRAVSAVSSVPAVRTRLVELQRTMAEGPGS----IVVEGRDIGTVVFPDAPVKIF
KCY_MYCBP       RGDAVTRAVSAVSSVPAVRTRLVELQRTMAEGPGS----IVVEGRDIGTVVFPDAPVKIF
KCY_MYCBT       RGDAVTRAVSAVSSVPAVRTRLVELQRTMAEGPGS----IVVEGRDIGTVVFPDAPVKIF
KCY_MYCTA       RGDAVTRAVSAVSSVPAVRTRLVELQRTMAEGPGS----IVVEGRDIGTVVFPDAPVKIF
KCY_MYCTU       RGDAVTRAVSAVSSVPAVRTRLVELQRTMAEGPGS----IVVEGRDIGTVVFPDAPVKIF
KCY_RHOOB       RGDAVTKAVSAVSAVPAVRELLVAAQRRLACEAGR----IVVEGRDIGTVVLPDADVKIY
KCY_RHOJR       RGDAVTKAVSAVSAVPAVRELLVAAQRRLAGEAER----IVVEGRDIGTVVIPDADVKIY
KCY_NOCFA       RGDAVTKAVSAVSAVPEVRDLLVAAQRDIAADARR----IVVEGRDIGTVVLPAADAKIY
KCY_CORGL       RGPEVTQNVSAVSAIPEVRENLVALQRALAAKAHR----CVVEGRDIGTAVLVDAPIKAF
KCY_COREF       RGPEVTSHVSAVSAIPEVRDNLVNLQRALADRAHR----CVVEGRDIGTVVLVDAPVKAY
KCY_CORDI       RGRLVTQNVSAVAAILEVRENLVALQRELAATAHR----CVVDGRDIGSTVLVDAPVKIF
KCY_STRAW       RTQEVTSKVSAVSAVPEVRTRITELQRSLAT-SAEN--GIVVEGRDIGTTVLPDADLKIF
KCY_STRCO       RTQEVTSKVSAVSAVPEVRARITELQRTIAA-AAPL--GIVVEGRDIGTTVLPDADLKIF
KCY_STRGG       RTQEVTSKVSAVSAVPEVRTLITALQRSIAA-AATG--GIVVEGRDIGTTVLPDADLKIF
KCY_CUTAK       RDPQTSAKVSAVATIQPVRDALTARMRQVAADRGR----IVMEGRDITTVVCPDAQVRVL
KCY_LEIXX       REPRVTAVVSAIARVPQVRASLTRLFREIIAGSGKA--GIVVEGRDITTVVCPDALVRIL
KCY_THET8       HTPEVDRVVSAVARLPGVR-AWVNRRLKEVPPP------FVAEGRDMGTAVFPEAAHKFY
KCY_THET2       HTPEVDRVVSAVARLPGVR-AWVNRRLKEVPPP------FVAEGRDMGTAVFPEAAHKFY
KCY_DEIDV       HSSAVDQGVSQVAAHPEVR-AWVDDQLRALTPP------FVAEGRDMGTNVFPHAPAKFY
KCY_DEIRA       HQSAVDAGVSTVAAHPELR-AWVDEQLRQLPPP------FVAEGRDMGTNVFPDAPAKFY
KCY_DEIGD       HSTRVDQGVSAVAALPEVR-AWVDAQLRALPAP------FVAEGRDMGTHVFPHADAKFY
KCY_BDEBA       AHEDVGNFASKVSHYPEVRKALLDAQRNCSAGPQG----LVAEGRDCGTVVFPTAEAKVY
KCY_MYCH7       RNDLISKNAAIIAQYPQIRKIVTEILQNFQKNHK----GIIMEGRDTTYNVMPDADLKIF
KCY_MYCHJ       RNDLISKNAAIIAQYPQIRKIVTEILQNFQKNHK----GIIMEGRDTTYNVMPDADLKIF
KCY_MYCH2       RNDLISKNAAIIAQYPQIRKIVTEILQSFQKNHK----GIIMEGRDTTYNVMPDADLKIF
KCY_MYCS5       RSEQISISTPVVSKIPEVREFVTSYIQKMTKGKK----GFIIDGRDTTFKVMPHADVKIF
KCY_MYCAP       RDDKVAKAASKVAQYPLIRHYVVDFIHKITKKSK----GYIMDGRDTTFKLMPHAELKIF
KCY_MYCPU       RDEKISEQASEISTILDIRNFINQIIIDTMKVKK----GYVIEGRDTTFKLAPDAEVRIF
KCY_MYCCT       TSSEILNAINKITIIPQIRNYMVKAQQQMVKNK-----GYILVGRDITSVVLPNADLKIY
KCY_MYCMS       ISSEILNVINKITIIPQIRNYMVKAQQQMVKNK-----GYILVGRDITSVVLPNADLKIY
KCY_MESFL       QENDIVKFINYVTPIPEVRKFMVEAQRAMVKGG-----GYIEIGRDITTVVLPNADLKIF
KCY_BORHD       LNERIDLQVSLYSSYIGVRNIVNKKLREIVKLKDD---NYIIEGRDITTVVFPEAKVKIY
KCY_BORT9       LNERIDFQVSLYSSYIGVRNIVNKKLREIVKLKDD---NYIIEGRDITTVVFPEAEVKIY
KCY_BORRA       LTEKIDFQVSLYSSYVNIRKIVNKKLREIVKIQDD---DYIIEGRDITTVVFPEAKIKIY
KCY_BORDL       LTEKIDFQVSLYSSYVNIRKIVNKKLREIVKIQDD---DYIIEGRDITTVVFPEAKIKIY
KCY1_BORBP      LNDKIDFQVSFYSSYVGIRNIVNKKLREVVKFSND---NYIIEGRDITTIVFPESEFKIY
KCY1_BORAP      LNDKIDFQVSFYSSYIGIRNIVNKKLREVVKFSDD---NYIIEGRDITTIVFPESEFKIY
KCY_BORBZ       LNDKIDFQVSFYSSYVGIRNIVNKKLREVVKFSDD---NYIIEGRDITTVVFPESEFKIY
KCY1_BORBU      LNDKIDFQVSFYSSYVGIRNIVNKKLREVVKFSDD---NYIIEGRDITTVVFPESEFKIY
                                  *                     :  ***    :   :  :  

KCY_UREP2       LNTSIQTRAKRRLFQ-NKDIEN-----LDYESIYNDIKERDHRDMTRKIAPLKKANDAVE
KCY_UREPA       LNTSIQTRAKRRLFQ-NKDIEN-----LDYESIYNDIKERDHRDMTRKIAPLKKANDAVE
KCY_UREU1       LNTSIQTRAKRRLAQ-NKDIEK-----LDYESIYNDIKERDYRDMTRDIAPLKKAIDAIE
KCY_MYCGA       LTASAQQRAIRRIKQLNLELNK-----ATLEQFTNEIQQRDDNDTNRKLAPLMIVKDAIV
KCY_MYCPN       LDAKPEIRAQRRAQDLGIAYDSD----KAFQELVAEIKHRDAVDTSRTADPLVQAPDAIY
KCY_MYCGE       LDAKVEIRAQRRLQDMGISLSNE----KKLKELIQELKQRDQIDSSRTADPLKKAQDAIY
KCY_AQUAE       ITASPEERAKRRYEQLKELGY-----EVSFEEILQKILERDKRDMERPKYPFKPAEDAVI
KCY_HYDS0       IDADPKERALRRY--LEEGG--------SYEDILNKILKRDETDKNRKDYPFRKAEDAIQ
KCY_RICPU       ITANPQIRAERRYKQLQAKGK-----TCILDEILRQIILRDKRDKERKAAPLLPASDALI
KCY_RICAE       ITANPQIRAERRYKQLQAKGK-----TCILDEILRQIILRDKRDKERKAAPLLPASDALI
KCY_RICCN       ITANPQIRAERRYKQLQAKGK-----TCILDEILRQIILRDKRDKERKAAPLLPASDALI
KCY_RICRS       ITANPQIRAERRYKQLQAKGK-----TCILAEILQQIILRDKRDKERKAAPLLPASDALI
KCY_RICRO       ITANPQIRAERRYKQLQAKGK-----TCILAEILQQIILRDKRDKERKAAPLLPASDALI
KCY_RICFE       ITANPQIRAERRYKQLQAKGK-----TCILDEILRQIILRDKRDKERKAAPLLPASDALI
KCY_RICCK       ITANPDIRAERRYKQLQAKGK-----ACILDEILQQIILRDKRDKERKVAPLLPASDALI
KCY_RICAH       ITANPQIRAERRYKQLQAKGK-----KCILDEILRQIILRDKRDKERKAAPLLPASDALI
KCY_RICTY       ITASPYVRAVRRYNQLQAKGK-----TCILDEIIQQIILRDKRDKERKVGPLLPALGAFI
KCY_RICPR       ITASPYVRAIRRYNQLQAKGK-----TCILDEIIQQIILRDKRDKERKAGPLLPALGAFI
KCY_RICB8       ITANPEVRAERRYKQLQAKGK-----ACILDEILQQIILRDKRDKEREVAPLLPALDALI
KCY_RICBR       ITANPEVRAERRYKQLQAKGK-----ACILDEILQQIILRDKRDKEREVAPLLPALDALI
KCY_THEM4       LVASQEARAKRRYKELMEKGV-----EVTFEEVLSEIVLRDKQDSERDVAPLKKAKDAIL
KCY_THEAB       LVASAEERAKRRYKELLDKGV-----KVSYEEVLNEIILRDKQDTEREIAPLRQPDDAVL
KCY_FERNB       LVASPEVRARRRYEELKSKNM-----EVSYEELLRQIEERDKNDSNRDVAPLVKAPDAIE
KCY_THEMA       LTASLEARVERKLKEYQKRGL-----KVTKEEVERELISRDEQDSKRNVAPLKPAEDAVI
KCY_THESQ       LTASLEARVERKLKEYQKRGL-----KVTKEEVERELISRDEQDSKRNVAPLKPAEDAVI
KCY_THEP1       LTASLEARVERKLKEYQKRGL-----KVTKEEVERELISRDEQDSKRNVAPLKPAEDAVI
KCY_THENN       LTASLEARIERKLREYQKKGL-----NVSREEVERELISRDTQDSSRKIAPLKPAEDAVV
KCY_PSELT       LTASFKERVRRRFEELKAKNM-----NLTMEDIADQIKIRDRQDSSRSIAPLKPAEDAIV
KCY_LEPBJ       LTASSKVRAERRFLQLQEQGI-----EADRDEIEKEIILRDKSDMEREIAPLYQANDAIL
KCY_LEPBL       LTASSKVRAERRFLQLQEQGI-----EADRDEIEKEIILRDKSDMEREIAPLYQANDAIL
KCY_LEPIN       LTASSKVRAERRFLQLQEQGI-----FADRNEIEKEIILRDKSDMEREIAPLYQAKDAIL
KCY_THEYD       LDASPQVRAKRRFEQLIQSGK-----KISFEEALRDVIERDKRDCSRENAPLRLSKDAFY
KCY_GEOKA       LKASVEERARRRHEENLAR----GFPS-DLEKLKEEIARRDRLDSERETAPLRKAPDAVE
KCY_GEOTN       LKASVEERARRRHEENIAR----GFPS-DLEKLKEEIAHRDRIDSERETAPLRKAPDAVE
KCY_GEOSW       LKASVEERAKRRHAENIAR----GFPS-DLETLKKEIARRDQIDSEREVAPLKKAEDAIE
KCY_ANOFW       LLASVEERAKRRHEENVLR----GIPS-DFEQLKEEIARRDQIDSERAVAPLKKAEDAIE
KCY_BACC7       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACCZ       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACHK       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACC0       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACCQ       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACC3       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACAH       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACAN       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACAA       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACAC       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACC1       MLASVEERAERRHLENMNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACMK       MLASVEERAERRHLENMNK----GFDS-NLEQLREEIARRDKLDSEREVSPLKKADDALE
KCY_BACC4       MLASVEERAERRHLENLNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACCR       MLASVEERAERRHLENLNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACC2       MLASVEERAERRHLENLNK----GFDS-NLEQLKEEIAQRDKLDSEREVSPLKKADDALE
KCY_BACCN       MLASVEERAERRHLENMRK----GFSS-NLEQLKKEIAQRDKLDSEREVSPLKKAEDAFE
KCY_BACSU       LLASVEERAKRRYEENVKK----GFDV-NYETLIEEIARRDKLDSEREVSPLRKAEDALE
KCY_BACVZ       LLASVEERAKRRYEENKKK----GYDV-NYETLIEEIARRDKLDSEREVSPLRKAEDAIE
KCY_BACP2       LLASVEERAKRRFEENQKK----GYDV-NYDQLIEEIARRDKLDSEREVSPLKKADDAIE
KCY_BACLD       LLASVEERAKRRFEENVKK----GYNV-NYETLAEEIRRRDKLDSEREISPLKKADDALE
KCY_OCEIH       LIASVEERAKRRHEENIKK----GIPS-DIKLLKKEISDRDEIDSNREVSPLIKAEDAIE
KCY_LISIN       LLASVEERAERRYKENMAK----GFAG-DLNQLKKEIEERDHLDYTREHSPLKKANDAIE
KCY_LISW6       LLASVEERAERRFKENVAK----GFAG-DLNQLKKEIEERDHLDYTREHSPLKKAEDAIE
KCY_LISMC       LLASVEERAERRYKENMAK----GFAG-DLGQLKKEIEERDHLDYTRTHSPLKKADDAIE
KCY_LISMF       LLASVEERAERRYKENMAK----GFAG-DLGQLKKEIEERDHLDYTRTHSPLKKADDAIE
KCY_LISMH       LLASVEERAERRYKENMAK----GFAG-DLDQLKKEIEERDHLDYTRTHSPLKKADDAIE
KCY_LISMO       LLASVEERAERRYKENMAK----GFTG-DLDQLKKEIEERDHLDYTRTHSPLKKADDAIE
KCY_STRPG       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRP8       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRP6       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRP3       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRPQ       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRPZ       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRPM       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRPF       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKSAEDALI
KCY_STRPC       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRPB       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRP1       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STRPD       LVASVEERAERRYKENLEK----GIES-DFETLKEEIAARDYKDSHRKVSPLKAAEDALI
KCY_STREM       LIASVEERAQRRYQENIEK----GIAT-DFDTLKTEIAARDYKDSHRQVSPLKAADDAII
KCY_STRE4       LIASVEERAQRRYQENIEK----GIAA-DFDTLKAEIAARDYKDSHRQVSPLKAADDAII
KCY_STRU0       LIASVDERAERRYRENLEK----GIDS-DFETLKEEIAARDFKDSHREVSPLKAADDAIV
KCY_STRA5       LVASVDERAERRFKENQEK----GIES-DFETLKSEIAARDYKDSHREVSPLKAAEDAIE
KCY_STRA3       LVASVDERAERRFKENQEK----GIES-DFETLKSEIAARDYKDSHREVSPLKAAEDAIE
KCY_STRA1       LVASVDERAERRFKENQEK----GIES-DFETLKSEIAARDYKDSHREVSPLEAAEDAIE
KCY_STRT2       MIASVDERAERRYKENIEK----GIPA-DLETLKKEIAERDYKDSHREVSPLRPAEDAIT
KCY_STRT1       MIASVDERAERRYKENIEK----GIPA-DLETLKKEIAERDYKDSHREVSPLRPAEDAIT
KCY_STRTD       MIASVDERAERRYKENIEK----GIPA-DLETLKKEIAERDYKDSHREVSPLRPAEDAIT
KCY_STRGC       LVASVDERAERRYKENLER----GISA-DLEVLKKEIADRDYKDSHRSVSPLRPADDSIT
KCY_STRSV       LVASVEERAERRYKENLSK----GIPA-DLEKLKEEIAERDYKDSHREVSPLRPADDAIH
KCY_STRS2       LVASVEERALRRFKENTER----GIET-DLESLKEEIAARDYKDSNREVSPLKAADDAIT
KCY_STRSY       LVASVEERALRRFKENTER----GIET-DLESLKEEIAARDYKDSNREVSPLKAADDAIT
KCY_STRPI       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRP2       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRR6       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRPS       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRZJ       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRZP       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRPJ       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRPN       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRP7       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRP4       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRZT       LVASVDERAERRYKENIAK----GIET-DLETLKKEIAARDYKDSHRETSPLKQAEDAVY
KCY_STRMU       LIASVEERAERRYRENLEK----GIQT-DFNTLKKEIAERDYKDSHRKISPLKPAADAIT
KCY_LACLM       LVASVDERAERRYKENLSK----GIPT-DLDRLKVEIAERDRKDSTRAVSPLKQAEDAIL
KCY_LACLS       LVASVDERAERRYKENLSK----GIPT-DLERLKVEIAERDRKDSIRVVSPLKQAEDAIL
KCY_LACLA       LVASVDERAERRYKENLSK----GIPT-DLERLKIEISERDRKDSTRAISPLKQAEDAIL
KCY_ENTFA       LVASVEERAERRFKENQEK----GIET-DFETLKAEIERRDYLDSTREVSPLVQASDAVK
KCY_LACS1       LVASVEQRALRRYKENIAK----GIDT-PLEVLEKEIAERDYKDSHRKISPLVQAKDAVK
KCY_LACPL       LVASAAERAKRRYAENVKK----GIDT-PLAQLQAEIELRDHKDSTRKVSPLTQATDATL
KCY_LEUMM       LVASVDERAQRRYKENVAK----GMTT-DLETLKREIEARDYKDSHRQISPLTQAKDAIL
KCY_LEUCK       LVASVLERAERRYKENKAK----GMTV-DLETLKSDIETRDYKDSHRAISPLIQAKDAIL
KCY_PEDPA       LIASVQERAERRYKENIAK----GMET-DLEQLKKEIEIRDHKDSTRKISPLTKASDAIE
KCY_LACRD       MVASAYERARRRYAENQAK----GINTTSLEELQKAIELRDKKDSTRKVSPLTQAPDAIK
KCY_LACRJ       MVASAYERARRRYAENQAK----GINTTSLEELQKAIELRDKKDSTRKVSPLTQAPDAIK
KCY_LACF3       MVASAHERARRRFLDNQER----GIDGGSIEELQRAIELRDQKDSTRAVSPLVKAADAYQ
KCY_EXISA       MTASVEERARRRHEENVSK----GIPS-DYEQLIEEIALRDKRDSEREVAPLRQAEDAHF
KCY_EXIS2       LTASVEERASRRHRENIAR----GMDS-DLKGLQDEIALRDKRDSERTVSPLKQADDAIY
KCY_LYSSC       MSATVEERARRRFIDNQKR----GIDS-SLEKLQEEIALRDKKDSEREASPLIQAEDAIF
KCY_STAAM       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAA9       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAA1       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAE       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAT       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAS       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAA2       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAN       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAW       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAC       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAR       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAAB       MIASVEERAERRYKDNQLR----GIES-NFEDLKRDIEARDQYDMNREISPLRKADDAVT
KCY_STAEQ       MIASVAERAERRQKENEQR----GIES-NLEQLKEEIEARDHYDMNREISPLQKAEDAIT
KCY_STAES       MIASVAERAERRQKENEQR----GIES-NLEQLKEEIEARDHYDMNREISPLQKAEDAIT
KCY_STAHJ       MIASVEERAERRQKENEQR----GIPS-TLSQLKKEIEERDHYDMNRDISPLKKADDAVT
KCY_STAS1       MIASVEERAVRRQKDNEER----GIVS-NVEQLKQEIADRDQYDMNRDISPLKKADDAIT
KCY_STACT       MIASVEERAERRQKENEEN----GIPS-SLNELKKEIEARDHYDMNREISPLRKADDAIT
KCY_MACCJ       MVASVEERAERRLIDNRNR----GIAS-TFEELKRDIERRDHLDMTREISPLTKAEDAIE
KCY_BACSK       LTASVEERARRRHLEQLEK----GLPS-DFEQLKKDIAKRDELDSTRAIAPLKQAADAQV
KCY_BACHD       LTATVEERARRRYEENIQK----GFKQ-SLEQLIKDIASRDEFDSNRSFAPLRKAEDAIE
KCY_LACJO       LIASVASRAKRRFLDFQEK----GIHQ-DLKDIEHDIEVRDYKDSHREISPLKKADDAIE
KCY_LACGA       LIASVASRAKRRFLDFQEK----GIHQ-DLKDIEHDIEVRDYKDSHREISPLKKAADAIE
KCY_CARHZ       LTASAEERARRRHRELLAK----GYEV-SYEEVFREVLKRDELDTTREISPLRKAEDAIL
KCY_CALS4       LTASLEERARRRYEELKNK----GTEV-KYEEVLEEIKKRDSLDSGRKTSPLTIPEGAIL
KCY_CLOB1       ITASAEVRAKRRLKELKEK----GINI-NFRDVLKEIKERDYIDSNRKVNPLKQSKDAIL
KCY_CLOBH       ITASAEVRAKRRLKELKEK----GINI-NFRDVLKEIKERDYIDSNRKVNPLKQSKDAIL
KCY_CLOBJ       ITASAEVRAKRRLKELKEK----GINI-NFRDVLKEIKERDYIDSNRKVNPLKQSKDAIL
KCY_CLOBK       ITASAEVRAKRRLKELKEK----GINI-NFRDVLKEIKERDYIDSNRKVNPLKQSKDAIL
KCY_CLOBL       ITASAEVRAKRRLKELEEK----GINI-SFQDVLKEIKERDYIDSNRKVNPLKQSKDAIL
KCY_CLOBM       ITASAEVRAKRRLKELKEK----KINI-SFQDVLKEIKERDYIDSNRKVNPLKQSKDAIL
KCY_CLOTE       LTATPEIRADRRYKELKEK----SQKV-EYKNILEEIIKRDYIDSNRKVSPLKKAKDAIE
KCY_CLOAB       LTATPEERAKRRYKELSAK----NIKV-CYDDILNDIIRRDYIDSNREVNPLTKAYDAVE
KCY_CLOP1       LTASPEERADRRYKELMGK----GVEV-NYDEILQDIIKRDYLDSNREVDPLRKAEDAIE
KCY_CLOPE       LTASPEERADRRYKELMGK----GVEV-NYDEILQDIIKRDYLDSNREVDPLRKAEDAIE
KCY_CLOPS       LTASPEERADRRYKELMEK----GIEV-NYNEILQDIIKRDYLDSNREVDPLRKAEDAIE
KCY_FUSNN       LVAAAEERARRRYNEFLEK----KVEI-TYDEVLKSLKERDYIDSTRKESPLKKADEAIE
KCY_ALKOO       LTASVQERALRRYLELKKK----GIEV-DIDELEKDIMNRDNIDSQRAFAPLVKAQDAII
KCY_CLOD6       LVATPEERGNRRYKELCNK----GYNT-TLEEVIEDIIRRDEIDSNREFAPLVKANDALE
KCY_ALKMQ       LTASTQERAQRRYIELVEK----GIQT-SLMEVEQGIIQRDQMDSKRQYAPLTQADDAVV
KCY_CALBD       LTATAEERAKRRFLELKQK----GYDV-DYYQLLDEIKKRDQNDMTREFAPLRVAEDAIV
KCY_CALS8       LTATAEERAKRRFLELKEK----GYEV-DYYQLLDEIKQRDLNDMTRELAPLRVAEDAIV
KCY_ONYPE       LTANITKRALRKQQEDAQK----GKIT-DIAQIMKQLKERDHKDYHRQLAPLSKALDAIL
KCY_AYWBP       LTANITKRALRKQQEDAQN----GKIT-DITQIMKQLKERDHKDYHRHLAPLSKALDAIL
KCY_PHYAS       LTANITQRALRKQEELKKK----GTQM-EIHDIIEQLKKRDYQDYHRKLSPLQRSSEALL
KCY_PHYMT       LTANIEQRILRRVNEFKSN----KSVN-ELQKITNNIKLRDHKDFNRLISPLKKAEDAIL
KCY_ACHLI       LIADVRERAKRRQQDKQNQ----GYEV-DIEKLIEEITRRDQLDSQRKISPLKKAEDAIV
KCY_PARUW       LTGRNDVRAKRRYDELTSKFP-EETKELTLEKCLEEITKRDNYDSTREYSPLCQAEDAFV
KCY_RHOBA       LTASPEERARRRQRQLAEN----GRVM-SVEEILAAQNQRDLEDRMRPVGRLRAASDAIV
KCY_ECOL6       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOSM       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SHIFL       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOUT       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO81       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO55       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO7I       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOSE       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOK1       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOHS       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOLU       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOL5       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOBW       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SHIF8       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO57       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO24       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOLC       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECOLI       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO5E       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO45       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SHIB3       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO8A       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECODH       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ECO27       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SHIDS       LDASSEERAHRRMLQLQEKGS-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SHIBS       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SHISS       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPASDALV
KCY_ESCF3       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALNS       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALTI       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALDC       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALPC       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALSV       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALEP       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALG2       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALHS       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALPB       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALA4       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALTY       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRHRAVAPLVPAADALV
KCY_SALPK       LDASSEERAHRRMLQLQENGF-----SVNFEHLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALPA       LDASSEERAHRRMLQLQENGF-----SVNFEHLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALCH       LDASSEERAHRRMLQLQENGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_SALAR       LDASSEERANRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_CITK8       LDASSEERAHRRMLQLQEKGF-----SVNFERLLAEIKERDDRDRNRAVAPLVPAADALV
KCY_ENT38       LDASSEERAQRRMLQLQEKGF-----SVNFDRLLSEIKERDDRDRNRAVAPLVPAEDALV
KCY_KLEP7       LDASADERAHRRMRQLQEKGF-----DVNFERLLSEIKERDDRDRNRAVAPLVPAADALV
KCY_KLEP3       LDASADERAHRRMRQLQEKGF-----DVNFERLLSEIKERDDRDRNRAVAPLVPAADALV
KCY_ERWT9       LDASSEERASRRMLQLQEKGF-----SVNFERLLSEIKERDDRDRNRAIAPLVPAADALV
KCY_SODGM       LDASSDERAYRRMRQLQEKGF-----SVNFERLLSEIKERDDRDRNRAVAPLVPAADALV
KCY_YERPP       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERPE       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERPG       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERPY       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERPB       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERPA       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERPN       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERP3       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERPS       LDASSQERAHRRMLQLQERGF-----NVNFERLLAEIQERDNRDRNRSVAPLVPAADALV
KCY_YERE8       LDASSQERAHRRMLQLQEKGF-----NVNFERLLSEIQERDSRDRNRAIAPLVPATDALV
KCY_SERP5       LDASSEERAHRRMLQLQEKGF-----NVNFERLLAEIKERDDRDRNRPIAPLVPASDALV
KCY_PECCP       LDASAEERAQRRMLQLQGKGF-----NVNFERLLSEIKERDERDRNRPVAPLVPAADALV
KCY_PECAS       LDASAEERAQRRMLQLQGKGF-----NVNFERLLSEIKERDDRDRSRPVAPLVPAADALV
KCY_EDWI9       LDASAEERAHRRMLQLQGKGF-----DVNFESLLAEIKERDFRDRNRAVAPLVPAVGALQ
KCY_PROMH       LDASAQERARRRMLQLQEKGF-----NVNFERLLSEIKERDYRDRNRAVAPLVAAKDALI
KCY_PHOLL       LDASAEERARRRMLQLQEKGF-----SVNFECLLSEIQERDYRDRNRAVAPLAPAKDALI
KCY_AERS4       LDASAEERAQRRYKQLQDKGF-----DVNFERLLTEIRERDDRDRNRAVAPLKAAEDALV
KCY_AERHH       LDASAEERAARRYKQLQDKGF-----DVNFERLLTEIRERDDRDRNRAVAPLKPAEDALV
KCY_ALIF1       LDASAEERANRRMKQLQQKGL-----DVKFDRLLSEIQERDDRDRNRAVAPLRPAEDALV
KCY_ALIFM       LDASAEERANRRMKQLQQKGL-----DVKFDRLLSEIQERDDRDRNRAVAPLRPAEDALV
KCY_ALISL       LDASAEERANRRMKQLQQKGL-----NVRFDRLLSEIQERDDRDRNRAVAPLRPAEDALV
KCY_VIBVU       LDASAEERAHRRLKQLQDKGL-----DVRFDDLLSEIQERDDRDRNRPVAPLRPAEDALV
KCY_VIBVY       LDASAEERAHRRLKQLQDKGL-----DVRFDDLLSEIQERDDRDRNRPVAPLCPAEDALV
KCY_VIBPA       LDASAEERANRRLKQLQDKGL-----DVRFADLLSEIQERDDRDRNRPVAPLRPAEDALV
KCY_VIBCB       LDASAEERANRRLKQLQDKGL-----DVRFADLLSEIQERDDRDRNRPVAPLRPAEDALV
KCY_VIBTL       LDASAEERASRRLKQLQQKGL-----DVKFDDLLSEIQERDDRDRNRPVAPLRPAEDALV
KCY_VIBCH       LDASAEERARRRFKQLQLKGL-----DVKFDALLSEIQERDDRDRNRAVAPLRPAEDALV
KCY_PHOPR       LDASAEERANRRMNQLQQKGL-----DVNFGSLLSEIQERDDRDRNRSVAPLRPAEDALV
KCY1_HAEIN      LDASAEERAKRRYKQLQNKGI-----NGNFAQILAEIKERDFRDRNREVAPLKPADDALL
KCY2_HAEIN      LDASAEERAKRRYKQLQNKGI-----NGNFAQILAEIKERDFRDRNREVAPLKPADDAFY
KCY_ACTSZ       LDASAEERAKRRYKQLQSKGI-----DGNFAQILAEIKERDFRDRNRLVAPLKPADDALL
KCY_MANSM       LDASAEERAKRRFKQLQNKGI-----SGNFDQILAEIKDRDFRDRNRPVAPLKPADDALL
KCY_PASMU       LDASAEERAKRRYKQLQNKGI-----SGNFDQILAEIKARDFRDRNRAVAPLKPAEDALI
KCY_HAEDU       LEASAEERTKRRVKQLQEKGF-----NANFGEILAEIKTRDLRDRTRAVVPLVPAKDALL
KCY_BLOFL       LNAAVKVRAQRRLDQLQKVNF-----SVNFKCLSSQIKERDDRDCNRQLAPLVPAVDAFV
KCY_SHESH       LTASAEERAQRRYNQLQDKGF-----DVNIDRLLSEIIERDDRDTNRSVAPLVPAEDALI
KCY_SHEWM       LTASAEERAQRRYNQLQDKGF-----DVNIDQLLTEIKERDDRDMNRSVAPLVPAEDALV
KCY_SHEHH       LTATAEERAQRRYNQLQDKGF-----DVNIDQLLSEIKERDDRDMNRSVAPLVPAEDALI
KCY_SHEPA       LTASAEERAQRRYNQLQDKGF-----DVNIDQLLSEIKERDDRDMNRSVAPLVPAEDALI
KCY_SHEPW       LTASAEERAQRRYNQLQDNGF-----DVKIDQLLSEIKERDDRDMNRSVAPLVPAEDALV
KCY_SHELP       LTASAEERAQRRYNQLQDKGF-----DVNIDRLLAEVVERDERDMNRPVAPLVPAEDALV
KCY_SHESM       LTASAEERAQRRYNQLQDKGF-----DVNIERLLAEIIERDDRDMNRPVAPLVPAEDALV
KCY_SHESA       LTASAEERAQRRYNQLQDKGF-----DVNIERLLAEIIERDDRDMNRPVAPLVPAEDALV
KCY_SHEON       LTASAQERAQRRYNQLQDKGF-----DVNIERLLAEIIERDDRDMNRPVAPLVPAENALV
KCY_SHESR       LTASAEERAQRRYNQLQDKGF-----DVNIERLLAEIIERDDRDMNRPVAPLVPAEDALV
KCY_SHEPC       LTASAEERAQRRYNQLQDKGF-----DVNIERLLSEIIERDERDMNRPVAPLVPAEDAFV
KCY_SHESW       LTASAEERAQRRYNQLQDKGF-----DVNIERLLSEIIERDERDMNRPVAPLVPAEDAFV
KCY_SHEB5       LTASAEERAQRRYNQLQDKGF-----DVNIERLLSEIIERDDRDMNRPVAPLVPAEDALI
KCY_SHEB2       LTASAEERAQRRYNQLQDKGF-----DVNIERLLSEIIERDDRDMNRPVAPLVPAEDALI
KCY_SHEB9       LTASAEERAQRRYNQLQDKGF-----DVNIERLLSEIIERDDRDMNRPVAPLVPAEDALI
KCY_SHEB8       LTASAEERAQRRYNQLQDKGF-----DVNIERLLSEIIERDDRDMNRPVAPLVPAEDALI
KCY_SHEAM       LTASAEERAQRRYNQLQDKGF-----DVKIDRLLAEIQERDDRDMNRPVAPLVPADDALV
KCY_SHEDO       LIASAQERAQRRYNQLQDKGF-----DVNIDRLLAEIIERDERDTNRAASPLKPADDALV
KCY_SHEFN       LTASAEERAQRRYNQLQDKGF-----DVKIDRLLAEIIERDDRDTNRAASPLVPADDALV
KCY_COLP3       LTASAEERADRRFNQLKEKGI-----DVNIGRLLDDIRQRDERDQNRKVAPLIPAEGALT
KCY_MARMS       LTASAEERAQRRLQQLQQKGE-----AVNLGGLVKKIKERDERDANRAIAPLVPAAGALV
KCY_PSE14       LTASAEERARRRYLQLKAKGD-----DVSLSSLLDEICARDERDTQRAVAPLKPAHDAIQ
KCY_PSEU2       LTASAEERARRRYLQLKAKGD-----DVSLSSLLDEICARDERDTQRAVAPLKPAHDAIQ
KCY_PSESM       LTASAEERARRRYLQLKAKGD-----DVSLSSLLDEICARDERDTQRAVAPLKPAHDAIQ
KCY_PSEF5       LTASAEERARRRYLQLKGKVD-----GVSLSSLLDEIRARDERDTQRAVAPLKPAADAIQ
KCY_PSEFS       LTASAEERARRRYLQLKGKVD-----GVSLSSLLDEIRARDERDTQRAVAPLKPAADAIQ
KCY_PSEPF       LTASAEERARRRYLQLKGKVE-----GVSLSSLLDEIRARDERDTQRAVAPLKPAADAIQ
KCY_PSEPK       LTASAEERARRRYLQLKGKGE-----DVSLSSLLDEIRARDERDTQRAVAPLKPAADAIQ
KCY_PSEPG       LTASAEERARRRYLQLKGKGE-----DVSLSSLLDEIRARDERDTQRAVAPLKPAADAIQ
KCY_PSEPW       LTASAEERARRRYLQLKGKGE-----DVSLSSLLDEIRARDERDTQRAVAPLKPAADAIQ
KCY_PSEE4       LTASAEERARRRYLQLKGKGE-----DVSLSSLLDEIRARDERDTQRAVAPLKPAADAIQ
KCY_AZOVD       LTARAEERARRRYQQLKESGV-----DANLSSLLGEISKRDERDSQRAVAPLKAAPDAIQ
KCY_PSEU5       LTASAEERARRRYLQLKARGD-----DVNLASLLEEIRERDERDTQRAVAPLKPAEDAIQ
KCY_PSEAB       LTASAEERARRRYLQLKAKGA-----DVDQSALLEEIRERDERDSQRAVAPLKPADDAIL
KCY_PSEAE       LTASAEERARRRYLQLKAKGA-----DVDQSALLEEIRERDERDSQRAVAPLKPADDAIL
KCY_PSEA8       LTASAEERARRRYLQLKAKGA-----DVDQSALLEEIRERDERDSQRAVAPLKPADDAIL
KCY_PSEA7       LTASAEERARRRYLQLKAKGA-----DVDQSALLEEIRERDERDSQRAVAPLKPADDAIL
KCY_METCA       LTASAEVRARRRYNQLKEKGM-----DVSLAHLTEEIEERDRRDRERQIAPLRAAADAVV
KCY_NITOC       LTASPYERARRRYKQLKEKGI-----GANLKNLEKEIAERDRRDCERNIAPLKSADDAII
KCY_SACD2       LTASAQERANRRVKQLEQAGV----ASINYEQILSDIEKRDEQDRNRATAPLLPADDAVM
KCY_NEIMF       LTAESKIRAERRAKQIGIPCE-----GLAFERILSDIEARDEADRNRKVAPLKQQPDALL
KCY_NEIMB       LTAESKIRAERRAKQIGIPCE-----GLAFERILSDIEARDEADRNRKVAPLKQQPDALL
KCY_NEIMA       LTAESKIRAERRAKQIGIPCE-----GLAFERILSDIEARDEADRNRKVAPLKQQPDALL
KCY_NEIG1       LTAESKIRAERRAKQIGIPCE-----GFTFERILSDIETRDEADRNRKVAPLKQQPDALL
KCY_CHRVO       LTASAEERASRRHKQLIGKGE-----SANLAQIMQDIIDRDARDAARPVAPLRQEPDAFL
KCY_PARPJ       MTASVEARAARRHKQLIQKGF-----SANIDDLLRDLRERDERDSQRVAAPLKPAADAKL
KCY_PARXL       MTASVEARAARRHKQLIQKGF-----SANIDDLLRDLRERDERDSQRVAAPLKPAADAKL
KCY_PARP8       LTASVEARATRRHKQLIQKGF-----SANMDDLLRDLRERDERDSQRAAAPLKPAADAQL
KCY_BURA4       LTASAEARAARRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADARL
KCY_BURCM       LTASAEARAARRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADAEL
KCY_BURCA       LTASAEARATRRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADAKL
KCY_BURCH       LTASAEARATRRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADAKL
KCY_BURCC       LTASAEARATRRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADAKL
KCY_BURCJ       LTASAEARATRRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADAKL
KCY_BURL3       LTASAEARATRRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADAKL
KCY_BURM1       LTASAEARAARRHKQLMQKGF-----SANIDDLLRDLRERDARDSNRAAAPLKPAADAKL
KCY_BURVG       LTASAEARAARRHKQLMQKGF-----SANIENLLRDLRERDARDSNRAAAPLKPAADAKL
KCY_BURP0       LTASVEARAARRHKQLMQKGF-----SANMDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_BURPS       LTASVEARAARRHKQLMQKGF-----SANMDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_BURP6       LTASVEARAARRHKQLMQKGF-----SANMDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_BURM9       LTASVEARAARRHKQLMQKGF-----SANIDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_BURMA       LTASVEARAARRHKQLMQKGF-----SANIDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_BURMS       LTASVEARAARRHKQLMQKGF-----SANIDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_BURM7       LTASVEARAARRHKQLMQKGF-----SANIDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_BURTA       LTASVEARAARRHKQLMQKGF-----SANMDNLLQDLRERDARDSNRAAAPLKPAADAKP
KCY_CUPNH       LTASVEARARRRYKQLIDKGI-----SANIEDLLRDLEARDVRDRTRTAAPLRPAEDAKL
KCY_CUPTR       LTASVEARARRRYKQLIDKGI-----SANIEDLLRDLEARDARDRTRAAAPLRPAEDAKL
KCY_CUPPJ       LTASVEARARRRYKQLIDKGI-----SANIEDLLRDLEARDARDRNRAAAPLRPAEDAKL
KCY_CUPMC       LTASVEARARRRYKQLIDKGI-----SANIEDLLRDLEERDARDRTRAAAPLRPAEGAYR
KCY_RALPJ       LTASVQARAERRYKQLIAKGF-----SATVESLSQDLEARDLRDRTRSVAPLRPAQDARQ
KCY_RALSO       LTASVQARAERRYKQLIAKGF-----SATVESLSRDLEARDLRDRTRSVAPLRPAEAARL
KCY_POLAQ       LTATAAARAERRYKQLIAKGI-----SAKLSDLLQDLQERDARDSSRGTAPLLVADGAKV
KCY_POLNS       LTATAAARAGRRYKQLIAKGI-----SAKLEDLLQDLQERDARDSSRGVAPLLVADGAKV
KCY_NITEU       LTASEEERALRRHKQLMEKGI-----NASIADLIQALRARDERDSSRSTSPLQQCEDACL
KCY_NITEC       LTANEEERARRRHKQLMEKGI-----NASIAHLVLALRERDERDSKRVASPLQQCEDTRL
KCY_BORBR       LVADVEARAQRRCKQLIEKGI-----SANLDDLLRDMRERDARDTQRAVAPLAPAADAHV
KCY_BORPA       LVADVEARAQRRCKQLIKKGI-----SANLDDLLRDMRERDARDTQRAVAPLAPAADAHV
KCY_BORPE       LVADVEARAQRRCKQLIEKGI-----SANLDDLLRDMRERDARDTQRAVAPLAPAADAHV
KCY_XANCP       LTASAEERAGRRHKQLMEKGV-----SVIFDDLLREIMARDARDAQRVVAPLRPAEDAVL
KCY_XANC8       LTASAEERAGRRHKQLMEKGV-----SVIFDDLLREIMARDARDAQRVVAPLRPAEDAVL
KCY_XANCB       LTASAEERAGRRHKQLMEKGV-----SVIFDDLLREIMARDARDAQRVVAPLRPAEDAVL
KCY_XANC5       LTASAEERAGRRHKQLMEKGV-----SVIFDDLLREIMARDARDAQRVVAPLRPAEDAVL
KCY_XANAC       LTASAEERAGRRHKQLMEKGV-----PVIFDDLLREIMARDARDAQRVVAPLRPAEDAVL
KCY_XANOR       LTASAEERAGRRHKQLMEKGV-----SVTFADLLREIMARDARDAQRVVAPLRSAKDAVL
KCY_XANOM       LTASAEERAGRRHKQLMEKGV-----SVTFADLLREIMARDARDAQRVVAPLRSAKDAVL
KCY_XANOP       LTASAEERAGRRHKQLMEKGV-----SVTFADLLREIMARDARDAQRVVAPLRSAKDAVL
KCY_STRM5       LTASAEERAERRHKQLKDKGV-----SVNFDDLLREIMARDARDAQRTVAPLKPADDAVL
KCY_STRMK       LTASAEERAERRHKQLKDKGV-----SVNFDDLLREIMARDARDAQRTVAPLKPADDAVL
KCY_XYLF2       LTAKAEERAQRRYKQLMKKGV-----SVMFGALLEEIRARDARDACRSVAPLKPADDALL
KCY_XYLFT       LTAKAEERAQRRYKQLMKKGV-----SVMFGALLEEIRARDARDACRSVAPLKPADDALL
KCY_XYLFA       LTAKAEERAQRRYKQLMKKGV-----SVMLGALLEEIRARDARDACRSVAPLKPADDALL
KCY_XYLFM       LTAKAEERAQRRYKQLMKKGV-----SVMLGALLEEIRARDARDVCRSVAPLKPADDALL
KCY_DICNV       LDATAEIRAERRYKQLIEKGE-----DVTLAALKKEIAARDARDRNRLVAPLKPASDAVL
KCY_ACIBC       LTASAESRAERRVKQLQGMGL-----DAKINDILANIQARDKRDMEREVAPLKPAADAYI
KCY_ACIBT       LTASAESRAERRVKQLQGMGL-----DAKINDILANIQARDKRDMEREVAPLKPAADAYI
KCY_ACIBS       LTASAESRAERRVKQLQGMGL-----DAKINDILANIQARDKRDMEREVAPLKPAGDAYI
KCY_ACIBY       LTASAESRAERRVKQLQGMGL-----DAKINDILANIQARDKRDMEREVAPLKPAADAYI
KCY_ACIB5       LTASAESRAERRVKQLQGMGL-----DAKINDILANIQARDKRDMEREVAPLKPAADAYI
KCY_ACIB3       LTASAESRAERRVKQLQGMGL-----DAKINDILANIQARDKRDMEREVAPLKPAADAYI
KCY_ACIAD       LTASAESRAERRVKQLQGMGL-----DVKISDILANIQSRDKRDMERTVAPLRPAVDAYQ
KCY_COXBU       FDADSQQRAYRRYKELQDRGI----N-VSLPDIQEDLEERDRRDITRSISPTKPAEDAVI
KCY_BUCBP       LISDFKTRVARRCLEYEKKGI----NSCNYKKIFYDMKTRDQRDHNRKISPLIPAKNAIL
KCY_MAGSA       VTASVEKRAERRLKELQEKGL-----GAIYGTVLADMRERDERDTNRAVAPLVPAQDAAV
KCY_RHORT       VTASVEVRAHRRLQELRSGGH-----DVKEDDVLRDMRERDARDSGRAVAPMAIAADAVV
KCY_ACICJ       VTASLDVRAKRRHLERLAHGI-----DPGFDSVRAELAARDEADRTRAAAPLVQAKDALL
KCY_GRABC       VTASAEARLQRRLLELRNRGV-----AVEEQALRAEMQARDERDAARDVAPLRPAEDAEV
KCY_RHOPA       VVASPEVRAHRRFLEAQSRGE-----PADEAVILSDIVKRDERDKNRSAAPLKQAPDAVL
KCY_RHOPT       VVASPEVRAHRRFLEAQSRGE-----PADEAVILSDIVKRDERDKNRSAAPLKQAPDAVL
KCY_RHOP2       VVADPGVRARRRALEAQARGE-----PADEAVILADILRRDERDKGRSAAPLKQAPDAVL
KCY_RHOPS       VIADPVVRARRRTLEALARGE-----AADEARVLADILKRDERDRNRSAAPLTQAPDAVL
KCY_RHOPB       VVADASVRAHRRTLEALARGE-----PADEAQVLADILKRDERDKSRAAAPLKAADDAHL
KCY_RHOP5       VVADPVVRARRRTLEAQSRGE-----PADEAVILADILKRDERDRSRAAAPLKQADDAHL
KCY_BRASO       VVADPKIRAHRRTLEARSRGE-----PADEAAILADILARDERDQNRAVAPLKQAADAYL
KCY_NITHX       VVADPVVRARRRTLEARSRGE-----EADEAVVLADILKRDERDRNRPIAPLKAAADAHV
KCY_NITWN       VEADPVVRARRRTLEARARGE-----EVDEAVVLADILKRDERDRNRPVAPLKAAADAHV
KCY_OLICO       VVADPKVRAHRRTLEARGRGE-----AADEALVLADILKRDERDKNRAAAPLKCAADAHV
KCY_BRADU       VVADPKVRARRRTMEAKARGE-----AADEAAVLADIIQRDERDKNRPIAPLKPAPDAYL
KCY_AZOC5       VTASPEVRAERRFKELAARDP-----LASYEAVLADIHKRDERDSNRAAAPLVMASDAVL
KCY_XANP2       VTASPEVRAERRHRELIGRGE-----DVAYETVLADIRKRDERDSARAAAPLVQADDAVL
KCY_METS4       ITASPEERAHRRHRELGGRGE-----PVAFEAVLADIVRRDARDADRAAAPLRVADDAVV
KCY_BEII9       VTASLQARAARRAAELQGRGE-----PGDLAVVQEEIRQRDERDANRPVAPFRAAADATF
KCY_METSB       VTASDEARATRRALELRGRGE-----KVDYAAVLEDIRKRDLRDSSRAAAPLKPADDAVV
KCY_CAUVC       VTARPEVRAERRWKQLVGQGE-----DVAFEDILADIHKRDARDGGRKDAPMTQAPDAVL
KCY_CAUVN       VTARPEVRAERRWKQLVGQGE-----DVAFEDILADIHKRDARDGGRKDAPMTQAPDAVL
KCY_CAUSK       VSASPEVRADRRWKQLLGQGE-----SVTLDEVLADIRKRDERDGGRASAPMTQAPDAVL
KCY_BRUMB       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUSI       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUO2       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUA2       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUA1       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUAB       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUME       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUC2       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_BRUSU       VTASPEVRARRRFDEVLARGD-----TADFAEILADLKKRDERDMNRTDSPLRPAEDAHL
KCY_RHIME       VTASPEVRAKRRHDEIVAGGG-----KADYTAIFEDVKKRDGRDMGRADSPLRPAEDAHL
KCY_SINMW       VTASPEVRAKRRYDEIVTGGG-----TADYTTIFEDVKKRDTRDMGRADSPLRPAEDAHL
KCY_AGRFC       VTASADVRARRRYDEILANGG-----NGDYDAIFAEVKKRDERDMGRADSPLRPAEDAHL
KCY_RHILO       VTASAEVRAMRRLAEIESIGG-----TANFTEILADIVRRDERDMGRADSPLKPAADAHL
KCY_BARHE       VLANVQIRAKRRYQEILKKGA-----QADYHEILVNLEQRDSRDITRKQSPLKQAKDAYL
KCY_BARQU       LLANIQTRAKRRYQEILKKGA-----QADYHEILAHLEQRDSRDITRTQSPLKSAQNAHL
KCY_BART1       ILANVQTRAKRRYQEILKKGG-----QANYHEILNDLEQRDSRDITRKESPLKPAENAHL
KCY_BARBK       IVANIQTRAKRRYQEILKRGR-----HADYQKILADLKQRDERDMTRQQSPLKSAENAHL
KCY_RHOSK       VTASDEERARRRWLELAAKGG-----TQSEAEILADLRERDRRDREREAAPLRPAPDALL
KCY_RHOS4       VTASDEERARRRWLELAAKGG-----AQSEAEILADLRERDRRDREREAAPLRPAPDALL
KCY_DINSH       VTASDDVRAQRRHAELISKGA-----DLTLEAVLADLQARDARDMQRADAPLKPAEDAMV
KCY_MAGMM       LTASLQARAQRRTLELQGKGE-----SVSMDRIKSRIEERDARDQSRATAPLAAAPDAQT
KCY_CHLFF       LTASAEVRALRRLKDLPKGSL-------SQEALHAELVKRDEADSRRIHDPLVIPEGAIV
KCY_CHLCV       LTASAEVRASRRLKDLPENSL-------SKEALHAELVKRDEADSQRLHDPLIIPEGAII
KCY_CHLAB       LTASAEVRALRRLKDLPHNSL-------SKEAVYAQLIKRDETDSQRSLDPLVIPEGAVV
KCY_CHLPN       LTSSPEVRAQRRLKDLPEGTL-------SPEQLQAELVKRDAADAQRAHDPLVIPENGIV
KCY_CHLTB       LTAKPEIRAERRLKDLPQGSL-------PKEALMAELIARDQADQQRECDPLVIPQDAIV
KCY_CHLT2       LTAKPEIRAERRLKDLPQGSL-------PKEALMAELIARDQADQQRECDPLVIPQDAIV
KCY_CHLTR       LTAKPEIRAERRLKDLPQGSL-------SKEALMAELIARDQADQQRECDPLVIPQDATV
KCY_CHLTA       LTAKPEIRAERRLKDLPQGSL-------SKEALMAELIARDQADQQRECDPLVIPQDATV
KCY_CHLMU       LTAEPEIRAKRRLKDLPEGSL-------SQEALTAELIARDQADQQRELDPLVIPADALV
KCY_DESVH       LDAAPEIRAMRRYTQLQTMGE-----AHDLALLTEQIRSRDEQDRNRAVAPLRPAADAII
KCY_DESVV       LDAAPEIRAMRRYTQLQTMGE-----AHDLALLTEQIRSRDEQDRNRAVAPLRPAADAII
KCY_DESAG       LDATPEERARRRYEQLTAAGE-----TPDLKALTDQIRKRDHQDRSRVVAPLRPADDAII
KCY_DESAD       LDADLEERAHRRFEQLKDMGK-----PADMAELIEQIAARDDQDRNRKVAPLKPAEDSII
KCY_LAWIP       IDANPIIRAQRRFNQLKKEGI-----FQDYNDILHSINYRDKLDKNRTIAPLEPAKDAIL
KCY_SYNFM       LTADPAARAGRRHAEYLAKGI-----RVDYAVLERQIRERDEADSTRCLAPLRPADGAVI
KCY_GEOSM       LSASAEERGRRRYLELAARGE-----SATLEETIAKVVQRDRQDEGREHAPLKQAEDAVP
KCY_GEOBB       LSASAEERGRRRYLELAARGE-----SATLEETIAKVIQRDRQDEGREHAPLKQAQDAVP
KCY_GEOSL       LSASVEERGRRRYLELKAKGQ-----EVSLDETIAAVARRDEQDSGREHAPLRRADDAVD
KCY_PELCD       LAATARERGKRRYLELKAKGM-----DVDLDQTIAEVEARDAADSGRLHAPLRQAEDAVL
KCY_DESHD       LTASSEERARRRWLELQRA---GKE-LS-LAEVQRDMDARDHYDQQRAVSPLIPAADAIL
KCY_DESHY       LTASSEERARRRWLELQRA---GKE-LS-LAEVQRDMDARDHYDQQRAVSPLIPAADAIL
KCY_PELTS       LTASPEERARRRREELAAR---GYI-VD-QHQMVNEITERDRIDTTRAAGPLVPAADAEI
KCY_SYMTH       ITASLQERARRRVAQLRAE---GHE-AD-LAAVEAEIARRDEQDMNKGVHSLVQLPESIV
KCY_DESRM       LTASAEERARRRAKEMMNF---GYD-VD-LEQLIKEIEERDFMDSNRAVSPLVPAEDAVL
KCY_CHLTE       LIADPAERAKRRHAELLLK-AGGAA-VPSVEALEEEIKQRDRDDEQRTHAPLKRHPDAVL
KCY_PELPB       LVADARERAKRRHAELTAKSAEGVE-LPDLDSLEQEITKRDRDDAEREHAPLKKHPEAYE
KCY_CHLT3       MIADAKERAKRRYAELKAKSPSGDP-GVTLETLEQEILQRDEDDRTRAIAPLRKPDDARE
KCY_FLAJ1       MTASAETRAQRRFDELQQK---GDN-VS-YEDVLKNVVERDYIDTHREDSPLVIADDAIE
KCY_FLAPJ       MTASAQTRAQRRYDEMSSN---SEN-VS-YDEVLKNVQERDFIDTHREDSPLVKANDAIE
KCY_BACFR       VTASAEIRAQRRYDELKAK---GQE-TG-FEEILENVKQRDHIDQTREVSPLKKADDALL
KCY_BACFN       VTASAEIRAQRRYDELKAK---GQE-TG-FEEILENVKQRDHIDQTREVSPLKKADDALL
KCY_BACTN       VTATPEIRAQRRFDELKAK---GQE-GS-FEEILENVKQRDYIDQHREVSPLRKADDALL
KCY_BACV8       VTASAAIRAQRRYDELRSK---GQE-AS-YEKILENVEERDRIDQTREVSPLRQADDAIL
KCY_PARD8       VTASPEVRAKRRVDELEAK---GIP-AS-YEEVLENVKKRDYIDSTREESPLRQADDALV
KCY_PORG3       VTALPHVRAQRRLDELRAK---GDA-TTTFDDVLANIEERDRIDSTRAVSPLRQAEDALV
KCY_PORGI       VTALPHVRAQRRLDELRAK---GDA-TTTFDDVLANIEERDRIDSTRAVSPLRQAEDALV
KCY_CYTH3       MVADMHVRAFRRQQELFER---KQI-ID-LDDIIKNIESRDLMDTTREESPLRKASDAYE
KCY_SALRD       MVADIDERARRRLQEYEAA---GEE-VT-FEEVRAEIEQRDQQDRTRDIAPLRRADDAIV
KCY_ROSCS       LDASIDERARRRTDEILRR----GG-DADLQRIRNDMIRRDSLDRYVSA----PAADACT
KCY_CHLAD       LQASLAERARRRAAELRSR----NI-DMPLEQIAAALAERDALDAHVSQ----PAADAII
KCY_HERA2       LDASVEERAQRRAQELNAR----GR-SISYREVLDDLTRRDAKDAANTF----LAADAIT
KCY_SOLUE       LDANPDERVRRRYQEIRTK--EDPP-PISQGQLAAEMKERDMRDSTRADAPLAQAPDAVY
KCY_MYCLB       LTASPETRARRRNDQNVASGS-----ADDYDRVLAEVRRRDHLDSTRAVSPLYVAQDAMI
KCY_MYCLE       LTASPETRARRRNDQNVASGS-----ADDYDRVLAEVRRRDHLDSTRAVSPLYVAQDAMI
KCY_MYCA1       LTASAETRARRRNDQNVAAGL-----ADDYEAVLAEVRRRDHLDSTRRVSPLRAAPDAVV
KCY_MYCPA       LTASAETRARRRNDQNVAAGL-----ADDYEAVLADVRRRDHLDSTRRVSPLRAAPDAVV
KCY_MYCBO       LTASAETRARRRNAQNVAAGL-----ADDYDGVLADVRRRDHLDSTRAVSPLQAAGDAVI
KCY_MYCBP       LTASAETRARRRNAQNVAAGL-----ADDYDGVLADVRRRDHLDSTRAVSPLQAAGDAVI
KCY_MYCBT       LTASAETRARRRNAQNVAAGL-----ADDYDGVLADVRRRDHLDSTRAVSPLQAAGDAVI
KCY_MYCTA       LTASAETRARRRNAQNVAAGL-----ADDYDGVLADVRRRDHLDSTRAVSPLQAAGDAVI
KCY_MYCTU       LTASAETRARRRNAQNVAAGL-----ADDYDGVLADVRRRDHLDSTRAVSPLQAAGDAVI
KCY_RHOOB       LTASAEARAQRRNAQNLAEGR-----GDDFAAVLADVQRRDHLDSTRAVSPLRPADDSVL
KCY_RHOJR       LTASAEARAQRRNAQNLAEGR-----GDDYAAVLADVQRRDHLDSTRAVSPLRPADDSVL
KCY_NOCFA       LTASAEARAERRNQQNIREGR-----GDDYAAVLADVQRRDTLDSTRAVSPLRPAADAVL
KCY_CORGL       LTASAEVRAQRRFDQDTAAGR-----DVDFDAVLADVVRRDELDSTRAASPLKPADDAHI
KCY_COREF       LTASPEVRAQRRYDQDTAAGR-----AADFDEVLAAVVKRDELDSTRAASPLKPAEDAHI
KCY_CORDI       LTASAEVRAQRRYDQDVAAGR-----LTDLATVLADVKRRDELDSNRSVSPLAPASDATV
KCY_STRAW       LTASPEARAARRSGELKGA---------DVNSTREALLKRDAADSSRKTSPLAKADDAVE
KCY_STRCO       LTASAEARAARRSGELKGA---------DVHATREALIKRDAADSSRKTSPLAKAGDAVE
KCY_STRGG       LTASPEARAARRSGEVKGS---------DLSATREALIKRDAADSGRKTSPLAKADDAVE
KCY_CUTAK       LVADPAIRVARRQAELGEKV--------DMAQVIDSIVRRDRDDS-TVSTFEEPAEGVTV
KCY_LEIXX       LTADEAVRMNRRSAELTGH---------SAARVGEALRKRDAADS-RVVDFMNAAEGVIT
KCY_THET8       LTASPEVRAWRRARERPQA----------YEEVLRDLLRRDERDK----AQSAPAPDALV
KCY_THET2       LTASPEVRAWRRARERPQA----------YEEVLRDLLRRDERDK----AQSAPAPDALV
KCY_DEIDV       LTASPRVRAERRSRERPEA----------VEAIEAALIQRDALDT----TQSAPAPDARV
KCY_DEIRA       LTASPRIRAERRSAERPED----------VDAIEAALIARDRKDA----AQSAPAPDARV
KCY_DEIGD       LTASPRVRAERRAQERPED----------VPTIEAALIERDRRDR----LQSAPAPDAHV
KCY_BDEBA       LTANSEHRAARRAAELGLD----------HEDMVKAQQQRDLQDSTRKVAPMAVPEDALV
KCY_MYCH7       LWADAETRAKRRLKQNTFLN-----LETDFQEILKAIEHRDYLDMTRKTNPLKKTVDSIF
KCY_MYCHJ       LWADAETRAKRRLKQNTFLN-----LETDFQEILKAIEHRDYLDMTRKTNPLKKTVDSIF
KCY_MYCH2       LWADAETRAKRRLKQNTFLN-----LETDFQEILKAIEHRDYLDMTRKTNPLKKTVDSIF
KCY_MYCS5       LWATAEERAQRRVDQNHQLG-----YNSNYDEVLYEIKKRDHQDMNREHDPLHKTEDSIL
KCY_MYCAP       LTGTPEVRARRRALENKDKG-----FETNYDVVLAEVKARDYADQHRETDPLHITDDAIV
KCY_MYCPU       LDASSPIRARRRVLQNSQLN-----TESNYEKILDNINKRDYSDRNREVDPLHVAQGVIA
KCY_MYCCT       LDCDIEIRAKRRFEQNVENKI----LDKSFKQIYQDLIKRDQVDKTRKIGPLVLVSDAWY
KCY_MYCMS       LDCDIEIRAKRRFEQNVENKI----LGKSFKQIYQDLIKRDQVDKTRKIGPLVLVSDAWY
KCY_MESFL       LDSSVEARAERRFKQNERLGI----KNNNLNEIKNSIINRDEQD---FKNGLRKAEDAWL
KCY_BORHD       LDASVKVRALRRYNQRD--------DDITLNELEQALERRDEIDQNKEYGKLKLAKEVFY
KCY_BORT9       LDASVKVRALRRYNQRS--------DNVTLNELEQALERRDEIDQNKEYGKLKLDKEVFY
KCY_BORRA       LDASVEVRTLRRYNQRD--------DDMALIELEQALEKRDEIDQNKEYGKLKLGKGVFY
KCY_BORDL       LDASVEVRTLRRYNQRD--------DDMALIELEQALEKRDEIDQNKEYGKLKLGKGVFY
KCY1_BORBP      LDASVKVRALRRYKQRN--------GNETLEELERTLKIRDDVDKRKQYGKLKLSKGVFY
KCY1_BORAP      LDASIKVRALRRYKQRN--------GNETLEELERTLKIRDDVDKNKQYGKLELSKGVFY
KCY_BORBZ       LDASVKVRALRRYKQRN--------GNETLEELERTLKRRDDVDKKKQYGKLKLSKGVFY
KCY1_BORBU      LDASVKVRALRRYKQRN--------GNETLEELERTLKRRDDVDKKKQYGKLKLSKGVFY
                .      *  *:                           **  *                

KCY_UREP2       IFNDNMKLDECVQHLYEIYLKKIKKLNF---------
KCY_UREPA       IFNDNMKLDECVQHLYEIYLKKIKKLNF---------
KCY_UREU1       IFNDNMNLDQCVAHLYEIYLNKIKKS-----------
KCY_MYCGA       IDSDQLSIEQVVDKIISLYKQRLGVNYA---------
KCY_MYCPN       IDSSNLTFQQVVELMVQQARTVFKL------------
KCY_MYCGE       LDTSELSFDAVVKQTLKEAKKVFKL------------
KCY_AQUAE       IDTTRKSVEEVVEEVLKIIHERSQSAELI--------
KCY_HYDS0       IDTTCMTKEEVINLCMEYIKKVL--------------
KCY_RICPU       IDTSKLSAMEVVEEVTNYIKNKIT-------------
KCY_RICAE       IDTSKLSAMEVVEEVTNYIKNKIT-------------
KCY_RICCN       IDTSKLSAMEVVEEVTNYIKNKIT-------------
KCY_RICRS       IDTSKLSAMEVVEEVTNYIKNKIT-------------
KCY_RICRO       IDTSKLSAMEVVEEVTNYIKNKIT-------------
KCY_RICFE       IDTSELSAIEVVEEITNYIKNKLT-------------
KCY_RICCK       IDTSKLSAIEVVEEITHYMQIIK--------------
KCY_RICAH       IDTSELSAMEVVEEVTNYIKNKIA-------------
KCY_RICTY       IDTSKLSAIEVVEEVTNYIKNKIT-------------
KCY_RICPR       IDTSKLSAIEIVEEVTNYIKNKIT-------------
KCY_RICB8       IDTSKLSPLSVVEQIMQFILKE---------------
KCY_RICBR       IDTSKLSPLSVVEQIMQFILKE---------------
KCY_THEM4       IDTTNLSIEEVIERILKVVKEKCKL------------
KCY_THEAB       IDSTKYTIEEVINKILEVVLEKCKLKLQKE-------
KCY_FERNB       IDTSNLSIEEVVEKILDIVKERCRIK-----------
KCY_THEMA       IDTTSMSVEEVLDRILKLVRERMNT------------
KCY_THESQ       IDTTSMSVEEVLDRILKLVRERMNT------------
KCY_THEP1       IDTTSMSVEEVLDRILKLVRERMNT------------
KCY_THENN       IDTTSMSVNEVLQKILKLVEERMKA------------
KCY_PSELT       IDTTSKDINEVADEICQIAFRRIKVEDNCC-------
KCY_LEPBJ       IDTDILSKNSVISKILKILDR----------------
KCY_LEPBL       IDTDILSKNSVISKILKILDR----------------
KCY_LEPIN       IDTDILSKNSVISKILEILDQ----------------
KCY_THEYD       IDTSELTLQEVISIVLKKVAEDA--------------
KCY_GEOKA       IDTTSLSVEEVVERIMEIVNERIG-------------
KCY_GEOTN       IDTTSLTVEEVAARIMEIVNERIG-------------
KCY_GEOSW       IDTTSLSIEEVVDRIMEIVNERIG-------------
KCY_ANOFW       IDTTSLSIDEVVDRIMCIVQERVEG------------
KCY_BACC7       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACCZ       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACHK       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACC0       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACCQ       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACC3       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACAH       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACAN       LDTTSLSIEEVVQKIMGIVLGVFAK------------
KCY_BACAA       LDTTSLSIEEVVQKIMGIVLGVFAK------------
KCY_BACAC       LDTTSLSIEEVVQKIMGIVLGVFAK------------
KCY_BACC1       LDTTSLSIEEVVQKIMSIVSGVFAK------------
KCY_BACMK       LDTTSLSIEEVVQKIMGIVSGVFAK------------
KCY_BACC4       LDTTSLSIEEVVQKIMSIVSGVFAK------------
KCY_BACCR       LDTTSLSIEEVVQKIMSIVSGVFAK------------
KCY_BACC2       LDTTSLSIEEVVQKIMSIVSGVFAK------------
KCY_BACCN       LDTTSLSIEEVVRNIMAIVSEALQK------------
KCY_BACSU       IDTTSLSIQEVADKILEAVEQKSR-------------
KCY_BACVZ       IDTTSLSIAEVAGKILEIVEQKSR-------------
KCY_BACP2       IDTTSLSIQEVAGKILDAADRVEKQ------------
KCY_BACLD       IDTTSLTIDEVAEKILQIVDKKAQK------------
KCY_OCEIH       VDTTSLSIAEVKDQILNEIFKYNTQNNKGV-------
KCY_LISIN       VDTTSMSIDEVANKILSLAEQKIQN------------
KCY_LISW6       VDTTSMSIEEVANKILSLAEQKINN------------
KCY_LISMC       VDTTSMSIDEVANKILSLAELKINN------------
KCY_LISMF       VDTTSMSIDEVANKILSLAELKINN------------
KCY_LISMH       VDTTSMSIDEVANKILSLAELKINN------------
KCY_LISMO       VDTTSMSIDQVANKILSLAELKINN------------
KCY_STRPG       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRP8       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRP6       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRP3       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRPQ       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRPZ       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRPM       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRPF       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRPC       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRPB       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRP1       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STRPD       FDTTGVSIDGVVQFIQEKAEKIVDMS-----------
KCY_STREM       FDTTGITISAVVQFIQEKAEKIIDMA-----------
KCY_STRE4       FDTTGITISAVVQFIQEKAEKIIDMA-----------
KCY_STRU0       FDTTGVTIQGVVQFIQEKAEKIIDMS-----------
KCY_STRA5       FDTTGVSIEGVVTFIQEKAEKIIDMKN----------
KCY_STRA3       FDTTGVSIEGVVTFIQEKAEKIIDMKN----------
KCY_STRA1       FDTTGVSIEGVVTFIQEKAEKIIDMKN----------
KCY_STRT2       FDTTGVSIDGVVEFIQEKAKKIIDKG-----------
KCY_STRT1       FDTTGVSIDGVVEFIQEKAKKIIDKG-----------
KCY_STRTD       FDTTGVSIDGVVEFIQEKAKKIIDKG-----------
KCY_STRGC       FDTTGVSISDVVAFIEEKAKKILDK------------
KCY_STRSV       FDTTGIGISEVVAFIEEKAKKIIDK------------
KCY_STRS2       FDTTGVSIEGVVKFISEKAKEILDR------------
KCY_STRSY       FDTTGVSIEGVVKFISEKAKEILDR------------
KCY_STRPI       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRP2       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRR6       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRPS       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRZJ       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRZP       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRPJ       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRPN       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRP7       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRP4       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRZT       LDTTGLNIQEVVEKIKAEAEKRM--------------
KCY_STRMU       FDTTGIDIAGVVNFIEKKAQNIIDRS-----------
KCY_LACLM       LDSTGKTIKEIVQFIEEKAKKLM--------------
KCY_LACLS       LDSTGKTIKEIVQFIEEKAKKLM--------------
KCY_LACLA       LDSTGKTINEIVQFIEDKAKELM--------------
KCY_ENTFA       IDTTGLTIEEVVAAIQNVIKQKGFELF----------
KCY_LACS1       VDTTPLTIDEVVNEIMNIIEERNH-------------
KCY_LACPL       VDTTPMSIDEVVAAIAKIITKKQSSTI----------
KCY_LEUMM       VDTTGQSIDDVVAKIANIIENNISF------------
KCY_LEUCK       VDTTGQSIQAVVSEITKIIEKKQKP------------
KCY_PEDPA       VDTTSMSIQDVVNEILRIVENASKRK-----------
KCY_LACRD       LDTTNMTIDEVVSEISKIIKKTQDELA----------
KCY_LACRJ       LDTTNMTIDEVVSEISKIIKKTQDELA----------
KCY_LACF3       LDTTHLTIEQVVDQIAGRIEKTLKQK-----------
KCY_EXISA       LDTTTLSIDGVVQAIERLIEEVKA-------------
KCY_EXIS2       LDTTELNIDQVVARLTELAEGALK-------------
KCY_LYSSC       LDTTALSIDDAAQAILKLAEEKML-------------
KCY_STAAM       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAA9       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAA1       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAAE       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAAT       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAAS       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAA2       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAAN       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAAW       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAAC       LDTTGKSIEEVTDEILAMVSQIK--------------
KCY_STAAR       LDTTGKTIEEVTDEILAMVSQIK--------------
KCY_STAAB       LDTTGKTIEEVTDEILAMVSQIK--------------
KCY_STAEQ       LDTTGKSIEEVTNEILSLL------------------
KCY_STAES       LDTTGKSIEEVTNEILSLL------------------
KCY_STAHJ       VDTTGKTIEEVTEEIMTLVNNI---------------
KCY_STAS1       VDTTGKSIEIVTQEILALVHKIS--------------
KCY_STACT       VNTTGKSIEQVTDIISDLIDKVEA-------------
KCY_MACCJ       IDTTGKSIEEVTAQIIELAKSAM--------------
KCY_BACSK       VDTTSMGIDEVVETILDLVKEHSRQ------------
KCY_BACHD       IDTTSLSISEVTQTIIGYVKERV--------------
KCY_LACJO       LDTTNLTIDEVVAKITEIIQKKQKN------------
KCY_LACGA       LDTTNLTIDEVVAKISEIIQKKQKN------------
KCY_CARHZ       VDTTGLKIEEVVAKLLEIIGRKNDVL-----------
KCY_CALS4       IDTTDLTEEEVVERVYEAIRKNTKGEI----------
KCY_CLOB1       IDTSNFTIEEVVDKICTIIKKD---------------
KCY_CLOBH       IDTSNFTIEEVVDKICTIIKKD---------------
KCY_CLOBJ       IDTSNFTIEEVVDKICTIIKKD---------------
KCY_CLOBK       IDTSNFTIEEVVDKICNIIKKD---------------
KCY_CLOBL       IDTSNFTIEEVVDKICNIIKRD---------------
KCY_CLOBM       IDTSNFTIEEVVDKICSIIKRD---------------
KCY_CLOTE       IDTTNYHIEEVVDKISKLIESTIIKEKGRITK-----
KCY_CLOAB       IDSSNMCIEEVVDYIVQYISKKI--------------
KCY_CLOP1       IDTTGIGIMGVVEKISSYMEK----------------
KCY_CLOPE       IDTTGIGIMGVVEKISSYMEK----------------
KCY_CLOPS       IDTTGIGIMGVVEKISSYMEK----------------
KCY_FUSNN       LDTTNLTIEDVINFISKKIEKVK--------------
KCY_ALKOO       IDTTGLTIEDVVERIINLLKGV---------------
KCY_CLOD6       IDTTGKTIEEVVEEVVSKINL----------------
KCY_ALKMQ       IDSTGKSIDAIVEEVLRIFNGKERG------------
KCY_CALBD       IDSTSLSIEEVLQKVLELFYKVVKNEV----------
KCY_CALS8       IDSTNLTIEEVLQKVLELFYKVIGNEV----------
KCY_ONYPE       LDTTELSIDEVIAKIIALIDKKRRT------------
KCY_AYWBP       LDTTELSIDELIAKITTLIEKKRRA------------
KCY_PHYAS       LDTTKLSIDEVVMQIQDLINKKTSPCLK---------
KCY_PHYMT       LDTTDINIIETVNQIHNLILHKKKLLNQNEF------
KCY_ACHLI       VDSTHMSLQQTVKKIIELIQSAKGVINE---------
KCY_PARUW       IDTSDLSIDEVVYKILEYKDTIKTKRPS---------
KCY_RHOBA       VQTDGMSPDEVREEVLRLVRECVQASAANSASSDVTR
KCY_ECOL6       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOSM       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_SHIFL       LDSTTLSIEQLIEKALQ-YARQKLALA----------
KCY_ECOUT       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO81       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO55       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO7I       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOSE       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOK1       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOHS       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOLU       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOL5       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOBW       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_SHIF8       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO57       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO24       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOLC       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECOLI       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO5E       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO45       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_SHIB3       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO8A       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECODH       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ECO27       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_SHIDS       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_SHIBS       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_SHISS       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_ESCF3       LDSTTLSIEQVIEKALQ-YARQKLALA----------
KCY_SALNS       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALTI       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALDC       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALPC       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALSV       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALEP       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALG2       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALHS       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALPB       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALA4       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALTY       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALPK       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALPA       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALCH       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_SALAR       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_CITK8       LDSTRLSIEQVIEKALQ-YARQKLALA----------
KCY_ENT38       LDSTSLTIEQVIEKALQ-YARQKLALA----------
KCY_KLEP7       LDSTELNIEQVIEKALQ-YAREKLAVA----------
KCY_KLEP3       LDSTELNIEQVIEKALQ-YAREKLAVA----------
KCY_ERWT9       LDSTTMSIEQVIEIALN-YAREKLALV----------
KCY_SODGM       LDSTRLTIDEVIAKALA-HARQILALS----------
KCY_YERPP       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERPE       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERPG       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERPY       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERPB       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERPA       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERPN       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERP3       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERPS       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_YERE8       LDSTSMSIEQVIEQALA-YAQRILALPLKK-------
KCY_SERP5       LDSTSMSIDEVIQRALT-YAHEVLALPQQ--------
KCY_PECCP       LDSTEMTIDEVIARALA-YAREILA------------
KCY_PECAS       LDSTEMTIDEVIARALA-YAREILA------------
KCY_EDWI9       LDSTSLSIEQVIAQALA-HARQTLV------------
KCY_PROMH       LDSTSLSIDEVIEKSLA-YAKKICN------------
KCY_PHOLL       LDSTSMSIEEVIDKALN-YAKKILSIT----------
KCY_AERS4       VDSTSMTIDEVLATVLA-YAEQQLGDASAS-------
KCY_AERHH       VDSTAMSIDEVLVTVLA-YAEQQLGDVSTN-------
KCY_ALIF1       LDSTSMNIDEVVAQAIT-FIESKL-------------
KCY_ALIFM       LDSTSMNIEEVVVQAIT-FIESKL-------------
KCY_ALISL       LDSTSMNIDEVVAQALT-FIESKL-------------
KCY_VIBVU       LDSTSMSIDEVVEKALQ-YIESKLAE-----------
KCY_VIBVY       LDSTSMSIDEVVEKALQ-YIESKLAE-----------
KCY_VIBPA       LDSTSMTIDEVVEKALQ-YIESKLAE-----------
KCY_VIBCB       LDSTSMTIDEVVEKALQ-YIESKLAE-----------
KCY_VIBTL       LDSTSMNIEQVVEKALH-YIESKLAG-----------
KCY_VIBCH       LDSTTLTIDEVVEQALQ-YIESKLV------------
KCY_PHOPR       LDSTDMSIEQVTAQAFA-YIEQALEQKS---------
KCY1_HAEIN      LDSTTLSIDEVIDQALA-YIQRXGISFRFNCLFKEE-
KCY2_HAEIN      YSLNS----SIISCAFF-TISSEPTNSGTRS------
KCY_ACTSZ       LDSTELSIEDVIAQALA-YIESKTA------------
KCY_MANSM       LDSTTLSIEEVIAQALS-YIHQKVKI-----------
KCY_PASMU       LDSTSLSIEEVIAQALS-YIQQHLDIKA---------
KCY_HAEDU       LDSTHLSIEEVISQALA-HIAKFKKF-----------
KCY_BLOFL       LDSTHLSKNEVENKALL-FIQKKIGIINY--------
KCY_SHESH       IDTSGIGIDEVLDIALT-HIQTKLPSVS---------
KCY_SHEWM       IDTSQIGIEEVLNIALA-HIETNLSGVS---------
KCY_SHEHH       IDTTNINIEDVLDLALT-HIHQKLQVPA---------
KCY_SHEPA       IDTTNINIEDVLDLALT-HIHQKLQVPA---------
KCY_SHEPW       IDTTNISIEDVLAMALT-HIHKSFQVPA---------
KCY_SHELP       IDTTGIGIDEVVELALS-HIKEKLPDLVL--------
KCY_SHESM       IDTSDKGIDEVLELALN-YINQKLSNTN---------
KCY_SHESA       IDTSDKGIDEVLELALN-YINQKLSHNN---------
KCY_SHEON       IDTSDKGIDEVLELALN-YINQKLSSTN---------
KCY_SHESR       IDTSDKGIDEVLELALN-YINQKLSIAN---------
KCY_SHEPC       IDTSGKGIDEVLELALK-YINEKLSSAN---------
KCY_SHESW       IDTSGKGIDEVLELALK-HINEKLSSAN---------
KCY_SHEB5       IDTSGKGIDEVLALALN-FINQKLSDTN---------
KCY_SHEB2       IDTSGKGIDEVLALALN-FINQKLSDTN---------
KCY_SHEB9       IDTSGKGIDEVLALALN-FINQKLSDTN---------
KCY_SHEB8       IDTSGKGIDEVLALALN-FINQKLSDTN---------
KCY_SHEAM       IDTTGIGIDDVFAQCVA-HINDKLSASGF--------
KCY_SHEDO       IDTSGIGINEVFERVLE-HVKASIS------------
KCY_SHEFN       IDTSGIGIEDVLKQVLE-YVGQKITVT----------
KCY_COLP3       IDSTDISITEVVNKILM-FANGKLT------------
KCY_MARMS       IDSTNLTIEQVVEMIFAETAKAGLV------------
KCY_PSE14       LDSTELSIEQVLERILSEIALRGIAG-----------
KCY_PSEU2       LDSTELSIEQVLERILSEIALRGIAG-----------
KCY_PSESM       LDSTELSIEQVLERILSEIALRDIAG-----------
KCY_PSEF5       LDSTELSIDQVLQRILSEIAIRDIAG-----------
KCY_PSEFS       LDSTELSIEQVLERIMSEIAIRDIAG-----------
KCY_PSEPF       LDSTELSIDQVLERIMSEIAIRDIAG-----------
KCY_PSEPK       LDSTELSIEQVLQRIRSEIAQRDLI------------
KCY_PSEPG       LDSTELSIEQVLQRIRSEIAQRDLA------------
KCY_PSEPW       LDSTELSIEQVLHRIRSELAQRDLV------------
KCY_PSEE4       LDSTELSIEQVLQRIRSELALRDLI------------
KCY_AZOVD       LDSTELTIEQVVERIMSEIAARDLAG-----------
KCY_PSEU5       LDSTTLSIEEVLQRILSEVADRDLAG-----------
KCY_PSEAB       LDSTEMSIEAVVETIIRHCERQGWDV-----------
KCY_PSEAE       LDSTEMSIEAVVETIIRHCERQGWDV-----------
KCY_PSEA8       LDSTEMSIEAVVETIIRHCERQGWDV-----------
KCY_PSEA7       LDSTEMSIEAVVETIIHHCEQQGWDV-----------
KCY_METCA       IDSSDLSVDEVIQVCLSVVQSH---------------
KCY_NITOC       LDSTNLAIKEVFQQVLPWLSGKNT-------------
KCY_SACD2       LDSTALSIDEVKQQILGLAKARQLF------------
KCY_NEIMF       LDTSRLTIEETVKKVLDWYREV---------------
KCY_NEIMB       LDTSRLTIEETVKKVLDWYREV---------------
KCY_NEIMA       LDTSRLTIEETVKKVLDWYRKV---------------
KCY_NEIG1       LDTSRLTIEETVKKVLDWYRKV---------------
KCY_CHRVO       LDTTELTIDQAVDKVLEWFEEKQASGH----------
KCY_PARPJ       LDTSALSVDQAVEQVVQWYEALVPHA-----------
KCY_PARXL       LDTSALSVDQAVEQVVQWYEALVPHA-----------
KCY_PARP8       LDTSALSVDQAVEQVVQWYRALVPQS-----------
KCY_BURA4       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURCM       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURCA       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURCH       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURCC       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURCJ       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURL3       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURM1       LDTSALSVDEAVDQVLQWYRALGQPA-----------
KCY_BURVG       LDTSALSVDQAVDQVLQWYRALGQPA-----------
KCY_BURP0       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_BURPS       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_BURP6       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_BURM9       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_BURMA       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_BURMS       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_BURM7       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_BURTA       LDTSALTIEQSVEQVLAWYRELGQPA-----------
KCY_CUPNH       LDTSDMTVDQAVAQVLEWFAAVRPDA-----------
KCY_CUPTR       LDTSDMTVDQAVAQVLEWFAAVRPDA-----------
KCY_CUPPJ       LDTSDMTVDQAVAQVLEWFAAVRKA------------
KCY_CUPMC       LDTSEMTVEEAVAQVLEWFAAVR--------------
KCY_RALPJ       LDSSDMTVDEVVAQVLDWYRQVQGANKAN--------
KCY_RALSO       LDSSDMSVDEVVAQVLDWYRQVQGVKAR---------
KCY_POLAQ       LETSDLSIDQAVKTVLDWYQSAIA-------------
KCY_POLNS       LETSDLSIDQAVKTVLDWY------------------
KCY_NITEU       LDTTGLSIDQVVSRVLNMYAEARKA------------
KCY_NITEC       LDTTGLNIDQVVGKVLGMYADSGSIE-----------
KCY_BORBR       LDSSGLTIEQTVQAVLDFWRA----------------
KCY_BORPA       LDSSGLTIEQTVQAVLDFWRA----------------
KCY_BORPE       LDSSGLTIEQTVQAVLDFWCA----------------
KCY_XANCP       IDTSGIGIEDVVQRVVGLLDSRTP-------------
KCY_XANC8       IDTSGIGIEDVVQRVVGLLDSRTP-------------
KCY_XANCB       IDTSGIGIEDVVQRVVGLLDSRTP-------------
KCY_XANC5       IDTSGMGIEDVVQRVVGLLADRAPL------------
KCY_XANAC       IDTSGMGIEDVVQRVVGLLAGRTPS------------
KCY_XANOR       IDTSGIGVEDVVQRVVGLLADRTPS------------
KCY_XANOM       IDTSGIGVEDVVQRVVGLLADRTPS------------
KCY_XANOP       IDTSGIGVEDVVQRVVGLLADRTPS------------
KCY_STRM5       IDTTGIGIDDVVARVMDLLPVPAA-------------
KCY_STRMK       IDTTGIGIDDVVARVMDLLPVPAA-------------
KCY_XYLF2       IDSTCMEVDEVVAQVLALVTD----------------
KCY_XYLFT       IDSTCMEVDEVVAQVLALVTD----------------
KCY_XYLFA       IDSTCMEVDEVVAQVLALVTD----------------
KCY_XYLFM       IDSTCMEVDEVVAQVLALVTD----------------
KCY_DICNV       IDTTDLSVQAVLEKIDALWQAHFFNF-----------
KCY_ACIBC       IDSSELTIDQVFKLMVDYVNSRTVSN-----------
KCY_ACIBT       IDSSELTIDQVFKLMVDYVNSRTVSN-----------
KCY_ACIBS       IDSSELTIDQVFKLMVDYVNSRTVSN-----------
KCY_ACIBY       IDSSELTIDQVFKLMVDYVNSRTVSN-----------
KCY_ACIB5       IDSSELTIDQVFKLMVDYVNSRTVSN-----------
KCY_ACIB3       IDSSELTIDQVFKLMVDYVNSRTVSN-----------
KCY_ACIAD       IDSSNLSIDEVFQLMVNYVDQCIKA------------
KCY_COXBU       IDTTHLSIEAVFATVMNHVRQRGLANVANEK------
KCY_BUCBP       IDSTYMSLKQVSNVLLSYILKMQKFKL----------
KCY_MAGSA       LDTSDLDADQAFAAALGIIGSKR--------------
KCY_RHORT       LDTSRMTAEQALTAALDILAHKSQKT-----------
KCY_ACICJ       LDTSQMDANHAFTAAADLVNKVLARG-----------
KCY_GRABC       LDTTHLDADQAFQRAEQIVRRKWPR------------
KCY_RHOPA       LDNSYLDIEGGVRAAIDIVEAVRAGRRRV--------
KCY_RHOPT       LDNSYLDIEGGVRAAIDIVEAVRAGRRRV--------
KCY_RHOP2       LDNSNLDIEGGVRAAIAIVEAVRAGRRRV--------
KCY_RHOPS       LDNSNLDIEGGVRAAIDIVEAVRAGRRRV--------
KCY_RHOPB       LDNSHLDIESGVRAAIDIVEAVRAGRQRV--------
KCY_RHOP5       LDNSHLDVESGLRAAIDIVEAVRAGRLR---------
KCY_BRASO       LDNSHLDIESGVRAAIDIVEAVRAGRQRV--------
KCY_NITHX       LDNSNLDIEAGLKAAIAIVEAVRA--GR---------
KCY_NITWN       LDNSNLDIEAGLKAAIAIVESVRVRSGRA--------
KCY_OLICO       LDNSNLDIEGGVRAAIAIIEQARA--TR---------
KCY_BRADU       LDNSQLDIEGGVRAAIDIIEAVRAGRSRG--------
KCY_AZOC5       LDTSHLGIEESFAAALAIVERARG-------------
KCY_XANP2       LDTSALDIAQAFAAALAIVEARRAGR-----------
KCY_METS4       IDTTALDAEAAFRAAAAVVEARWPGRG----------
KCY_BEII9       LDTTDLDIEAAFEAALAIVDNRIRKLAS---------
KCY_METSB       LDTTKLDVEAAFKAALVIVESAHDSLRAGHPAF----
KCY_CAUVC       LDTSEMTIEQAFDAARRIVEDARARHRL---------
KCY_CAUVN       LDTSEMTIEQAFDAARRIVEDARARHRL---------
KCY_CAUSK       LDTSEMTIEQAFDAARRIVETARARWGNPKG------
KCY_BRUMB       LDTSEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUSI       LDTSEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUO2       LDTSEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUA2       LDASEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUA1       LDASEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUAB       LDASEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUME       LDTSEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUC2       LDTSEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_BRUSU       LDTSEMSIEAAFLAAKKLIDHALAQHRG---------
KCY_RHIME       LDTSEMSIEAAFQAAKTLVDAALKEKI----------
KCY_SINMW       LDTSEMSIEAAFQAAKTLIDVALNKTI----------
KCY_AGRFC       LDTSEMSIEAAFQAARTIIDAALKR------------
KCY_RHILO       LDTSEMAIEAAFLAAMAIVDDVLTRRNKA--------
KCY_BARHE       LDTSELSIEATFTVACALIDPIIKARIIG--------
KCY_BARQU       LDTSELGIEATFKIACALIDPIIKAHIIE--------
KCY_BART1       LDTSELSIEATFAIACSFIDPIIKMHIIG--------
KCY_BARBK       LDTSELSIEEAFAAACTLIDPLIKARAAL--------
KCY_RHOSK       LDTTELTIDAAVNKAIEAIELRQAQGRE---------
KCY_RHOS4       LDTTELTIDAAVNKAIEAIELRQAQGRE---------
KCY_DINSH       LDTSRLSIDEAVEKAIALATARMA-AREFSPIRPN--
KCY_MAGMM       VDTTYLSQTESIETVARLVASLLEKP-----------
KCY_CHLFF       LDSSDLTISQVLEKILALVSPEMP-------------
KCY_CHLCV       LDSSDLTISQVLEKILALVSPNLP-------------
KCY_CHLAB       LDSSDLTISQVLEKISALISPKLP-------------
KCY_CHLPN       IDSSDLTIRQVLEKILALLFRNEL-------------
KCY_CHLTB       IDSSDLTISQILEKILPLIPSHLT-------------
KCY_CHLT2       IDSSDLTISQILEKILPLIPSHLT-------------
KCY_CHLTR       IDSSDLTISQILEKILPLIPSHLT-------------
KCY_CHLTA       IDSSDLTISQILEKILPLIPSHLT-------------
KCY_CHLMU       IDSSDLTISQILEKIVPLIHSRLA-------------
KCY_DESVH       VDTGDLDIDGVFGVIMQHIRSRDGL------------
KCY_DESVV       VDTGDLDIDGVFGVIMQHIRSRDGL------------
KCY_DESAG       IDTTELDVQGVFAAIMSKLK-----------------
KCY_DESAD       VDTTHLDINGVFDKLVFETEKKVN-------------
KCY_LAWIP       IDSSIMDIDSILKIMLNYITIPHLSQ-----------
KCY_SYNFM       LDTSDLDISEVMSRLMDLIREKSRG------------
KCY_GEOSM       IDSTSLTIEEVLELMERTVKERLAQGDKG--------
KCY_GEOBB       IDSTSLTIEQVLELMESTVKERLAQGDKG--------
KCY_GEOSL       IDSTGLSIEEVLDRMESIVRERERATPGA--------
KCY_PELCD       IDTTCMNIDQVLERMLQVVAERQQVCDPSKEGAAS--
KCY_DESHD       LDTTGLQIEEIVDRILSLFNDKVETGYVRSQNQ----
KCY_DESHY       LDTTGLQIEEIVDRILSLFNDKVETGYVRSQNQ----
KCY_PELTS       IDCSSMPVEKVVKMIVARVSAGRRE------------
KCY_SYMTH       IDTTGKRVDEVVEEILRHCRRT---------------
KCY_DESRM       IDSSGMTIDEVVNSIITWVEKGK--------------
KCY_CHLTE       LDTSNMTIDEQVNVVYDLVNKIVEQQSL---------
KCY_PELPB       IDTSAMTIERQVEMVCQLARARE--------------
KCY_CHLT3       LDTSKMTIEEQVAAIYELATDVISQLK----------
KCY_FLAJ1       IDNSYLNKEEQFAAVLELVNDVVKID-----------
KCY_FLAPJ       IDNSHLSREEQFKIVLDLVNNI---------------
KCY_BACFR       LDNSHLTIAEQKEWLMAEYQKAIKA------------
KCY_BACFN       LDNSHLTIAEQKEWLMAEYQKAIKA------------
KCY_BACTN       LDNSNLSIEQQKEWLSEQFGKVVKE------------
KCY_BACV8       LDNSHMSIAEQKKWLTEKFQAAING------------
KCY_PARD8       LDNSHMTLEEQKAWLLEQYHKAIGS------------
KCY_PORG3       LDNSHMTIPQQKAWLLERFQEVTGS------------
KCY_PORGI       LDNSHMTIPQQKAWLLERFQEVTGS------------
KCY_CYTH3       IDTTYITVEEQVDCIMNIAVGKMIELEYNIENI----
KCY_SALRD       FDTTDCTIAEQVDFVVDRVKAQDGRGT----------
KCY_ROSCS       IISDGLSPEQVVALVIARIADRCDDSQEARA------
KCY_CHLAD       LVNDGLTPAEEVALVLNRFVYSEQALENGH-------
KCY_HERA2       ITTDGRSPEEVFQAILGLIGVEAQA------------
KCY_SOLUE       LDSTALSIAEVEEAILKIVRSRVTNGRDFS-------
KCY_MYCLB       VDTSKMAEAEVIAHLMDLVKQRSGAVW----------
KCY_MYCLE       VDTSKMAEAEVIAHLMDLVKQRSGAVW----------
KCY_MYCA1       VDTSDMTEAQVIDHLRDLVRQRSEVAR----------
KCY_MYCPA       VDTSDMTEAQVIDHLRDLVRQRSEVAR----------
KCY_MYCBO       VDTSDMTEAEVVAHLLELVTRRSEAVR----------
KCY_MYCBP       VDTSDMTEAEVVAHLLELVTRRSEAVR----------
KCY_MYCBT       VDTSDMTEAEVVAHLLELVTRRSEAVR----------
KCY_MYCTA       VDTSDMTEAEVVAHLLELVTRRSEAVR----------
KCY_MYCTU       VDTSDMTEAEVVAHLLELVTRRSEAVR----------
KCY_RHOOB       VDTSELGIDDVIGRLLLVVSERSGVGQ----------
KCY_RHOJR       VDTSELGIDDVIGRLLLVVSERTGAGQ----------
KCY_NOCFA       VDTSELTMDEVIDELSRVVAQQISTGSAQ--------
KCY_CORGL       VDTSDMTMDQVLDHLIHLVEASAERSNQ---------
KCY_COREF       IDTSAMTMDEVLTHLIQLTEASAERSNQ---------
KCY_CORDI       VDTSTLTLDQVVDTLMTLIEKSAERTAR---------
KCY_STRAW       VDTSDLTLQQVIECVVTLVEEKRAAK-----------
KCY_STRCO       VDTTALSLPQVIECVVTLVEEKRAGK-----------
KCY_STRGG       VDTTELTLQQVIECVVTLVEGKRVAA-----------
KCY_CUTAK       VDSTHLNLDQVIDAVIDLVPVTLR-------------
KCY_LEIXX       VDSTELDFDQTVDAVIAVVQKETHV------------
KCY_THET8       LDTGGMTLDEVVAWVLAHIRR----------------
KCY_THET2       LDTGGMTLDEVVAWVLAHIRR----------------
KCY_DEIDV       IDTGPLTLEQVIVAITSQLPSQ---------------
KCY_DEIRA       IDTGPLGLEEVIGEILGEIGQ----------------
KCY_DEIGD       IDTGPLALEDVIGVILAALPARSA-------------
KCY_BDEBA       VDTTALNLNQVVDAVVEYVKNKI--------------
KCY_MYCH7       LDTTNFTRDQIVSQISKLVFRKIGQFSLEI-------
KCY_MYCHJ       LDTTNFTRDQIVSQISKLVFRKIGQFSLEI-------
KCY_MYCH2       LDTTNFTRDQIVSQISKLVFRKIGQFSLEI-------
KCY_MYCS5       IDCTNMKIDEVVNKIISLIK-----------------
KCY_MYCAP       IDSTDMNFEQVVDKIVSLAKERM--------------
KCY_MYCPU       IVNDHMNIEETFEKILGLVNEAIDKK-----------
KCY_MYCCT       IDNSYLTIDQVVDIVVNKVHQLESQK-----------
KCY_MYCMS       IDNSYLTIDQVVDIVVNKVHQLESQK-----------
KCY_MESFL       IDNSNIPIQDVVNMVIDKIKELEGN------------
KCY_BORHD       IDTSYKCLDDVCDIIIKTFNLKKK-------------
KCY_BORT9       IDTSYKCLDDVCNIIIKTFNLKKKVIER---------
KCY_BORRA       IDTSYKSLDDVCDIIIKTFNLKKK-------------
KCY_BORDL       IDTSYKSLDDVCDIIIKTFNLKKK-------------
KCY1_BORBP      LDTSYKGLDDVCNIIIEKFNLKKVRER----------
KCY1_BORAP      LDTSYKGLDDVCNIIIEKFNLKKVRER----------
KCY_BORBZ       LDTSYKGLDDVCNIIIEKFNLKKVRER----------
KCY1_BORBU      LDTSYKGLDDVCNIIIEKFNLKKVRER----------