CLUSTAL format seed alignment for MF_00242

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARCA_MYCGI       ------MTDAPLGCNSEVGTLRAVILHRPGAELQRLTPRNNDTLLFDGLPWVARAQQEHD
ARCA_RHOJR       ---MNASGSAPLGANSEVGQLRAVLLHRPGDELKRLTPRNNDQLLFDGLPWVDRAQEEHD
ARCA_MYCTU       -------MGVELGSNSEVGALRVVILHRPGAELRRLTPRNTDQLLFDGLPWVSRAQDEHD
ARCA_VIBCB       --------MSKLYVGSEVGQLRRVLLNRPERALTHLTPSNCHELLFDDVLAVEAAGEEHD
ARCA_VIBPA       --------MSKLYVGSEVGQLRRVLLNRPERALTHLTPSNCHELLFDDVLAVEAAGEEHD
ARCA_VIBVU       --------MSKLYVGSEVGQLRRVLLNRPERALTHLTPSNCHELLFDDVLLVEAAGKEHD
ARCA_SALTY       --------MEKHFVGSEIGQLRSVMLHRPNLSLKRLTPSNCQELLFDDVLSVERAGEEHD
ARCA_SALTI       --------MEKHFVGSEIGQLRSVMLHRPNLSLKRLTPSNCQELLFDDVLSVERAGEEHD
ARCA2_ECOL6      -------MMEKHYVGSEIGQLRSVMLHRPNLSLKRLTPSNCQELLFDDVLSVERAGEEHD
ARCA_PSEAE       ----MSTEKTKLGVHSEAGKLRKVMVCSPGLAHQRLTPSNCDELLFDDVIWVNQAKRDHF
ARCA_PSEPU       ----MSAEKQKYGVHSEAGKLRKVMVCSPGLAHKRLTPSNCDELLFDDVIWVDQAKRDHF
ARCA_RHILO       -------METKFGVHSEVGQLRKVMVCAPGRAHQRLTPSNCDALLFDDVLWVDNAKRDHF
ARCA2_RHIME      -MSSKSSTQHTFGVHSEVGQLRKVMVCAPGRAHQRLTPSNCDALLFDDVLWVDNARRDHF
ARCA_STRCO       MTSNESAVSQALGVHSEVGRLRKVLVCSPGLAHRRLTPTNSDELLFDDVMWVENAQRDHA
ARCA_CUTAK       -------MTTPIGAWSEVGKLREVMVCEPRLAHRRLTPSNCRELLFDDVLWVEKAQEDHR
ARCA_CHRVO       --------MTKFGVHSECGKLRTVMVCRPGLAHKRLTPDNCHDLLFDDVIWVERAQKDHA
ARCA_MARMS       --------MIEFGVHSEVGKLRKVIVCRPGLAHSRLTPGNAAQLLYDDVLWVQQARTDHM
ARCA_RHIET       --------MRGFGVHSEVGKLRTVMVCRPSLAHQRLTPANCHDLLFDDVLWVHEAQKDHF
ARCA1_RHIME      --------MRTVGVHSEVGKLRTVMVCRPSLAHQRLTPGNCHDLLFDDVIWVHEAQKDHY
ARCA_DINSH       ------MTAHKLGVHSETGTLRQVIICRPGLAHRRLTPENCEELLFDDVFWVKQAKQDHE
ARCA_BORAF       ----MEEYLNPINIFSEIGRLKKVLLHRPGEELENLTPFIMKNFLFDDIPYLEVARQEHE
ARCA_BORBU       ---MEEEYLNPINIFSEIGRLKKVLLHRPGEELENLTPLIMKNFLFDDIPYLKVARQEHE
ARCA_STRP1       -----MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHD
ARCA_STRP3       -----MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHD
ARCA_STRPN       ------MSSHPIQVFSEIGKLKKVMLHRPGKELENLLPDYLERLLFDDIPFLEDAQKEHD
ARCA_CLOPE       -----MRDDRALNVTSEIGRLKTVLLHRPGEEIENLTPDLLDRLLFDDIPYLKVAREEHD
ARCA_LISIN       -------MENGLNITSEIGKLQTVLVKRPGSELENITPEYLESLLFDDIPYLKMMQKEHD
ARCA_LISMO       -----MKMEQALNITSEIGKLQTVLVKRPGSELENITPEYLESLLFDDIPYLKMMQKEHD
ARCA_STAAM       ------MTDGPIKVNSEIGALKTVLLKRPGKELENLVPDYLDGLLFDDIPYLEVAQKEHD
ARCA_STAAW       ------MTDGPIKVNSEIGALKTVLLKRPGKELENLVPDYLDGLLFDDIPYLEVAQKEHD
ARCA_BACLD       -----MIMTTPIHVYSEIGPLKTVMLKRPGRELENLTPEYLERLLFDDIPFLPAVQKEHD
ARCA_LACLA       -------MNNGINVNSEIGKLKSVLLHRPGAEVENITPDTMKQLLFDDIPYLKIAQKEHD
ARCA_LACSK       -------MTSPIHVNSEIGKLKTVLLKRPGKEVENITPDIMYRLLFDDIPYLPTIQKEHD
ARCA_MYCAR       -MSVFDSKFKGIHVYSEIGELESVLVHEPGREIDYITPARLDELLFSAILESHDARKEHK
ARCA_MYCHO       -MSVFDSKFNGIHVYSEIGELETVLVHEPGREIDYITPARLDELLFSAILESHDARKEHQ
ARCA_MYCPN       -------MKYNINVHSEIGQLQTVLVHTPGNEIRRISPRRLDDLLFSAVIEPDTAIQEHQ
                                ** * *. *::  *      : *     :*:. :        :* 

ARCA_MYCGI       AFADLLRSRGVEVLLLGDLLTEALDKSG-AARMQGISAAVDARR-LGAPLAQELSAYLRT
ARCA_RHOJR       AFADLLRSRGVEVLLLSDLLTETLGASG-AARIQGIGAAVDARK-LGHTLAQELAAHLRG
ARCA_MYCTU       EFAELLASRGAEVLLLSDLLTEALHHSG-AARMQGIAAAVDAPR-LGLPLAQELSAYLRS
ARCA_VIBCB       AFARTLREQDVEVLLLHDLLVETLAVP--EAKQWLLNTQISDFR-YGPTFARDLRQYFAE
ARCA_VIBPA       AFARTLREQDVEVLLLHDLLVETLAVP--EAKQWLLNTQISDFR-YGPTFARDLRQYLLE
ARCA_VIBVU       AFADTLRQQGVEVLLLHDLMVDTLAVP--EAKQWLLDVQISDFR-YGPIFARDLRRYLSE
ARCA_SALTY       IFANTLRQQGIEVLLLTDLLTQTLDVA--DAKAWLLDTQISDYR-LGPTFAADIRAWLAD
ARCA_SALTI       IFANTLRQQGIEVLLLTDLLTQTLDVA--DAKAWLLDTQISDYR-LGPTFAADIRAWLAD
ARCA2_ECOL6      IFANTLRQQGIEVLLLTDLLTQTLDIP--EAKSWLLETQISDYR-LGPTFATDVRTWLAE
ARCA_PSEAE       DFVTKMRERGIDVLEMHNLLTETIQNP--EALKWILDRKITADS-VGLGLTSELRSWLES
ARCA_PSEPU       DFVTKMRERGVDVLEMHNLLTDIVQQP--EALKWILDRKITSDT-VGVGLTNEVRSWLEG
ARCA_RHILO       DFMTKMRDRGVEVVEMHNLLAETVAVP--EGKKWILDNQVVPNQ-IGLGLVDEVRSYLEG
ARCA2_RHIME      DFMTKMRDRGVEVVEMHNLLAQTVAIP--EARKWILDNQVVPNQ-VGLELLDEIRSYLEG
ARCA_STRCO       AFVGELRRRGVEVVELHDLLAQIMALP--EARAWLLDRKITANQ-VGIGLIDAARAYLET
ARCA_CUTAK       DFVAKMRERGIVVHEMHQLLSEVLDIS--EGRSWVLDRKLSPNA-VGLGVDEDVRDWLND
ARCA_CHRVO       YMVEQMRARGIEVIEVHDALAKVLDDK--AARNWILDRKVKADN-VGIGMLSDLRSWLNE
ARCA_MARMS       DFCMKMESRGIKVLEFGQLLEETVRDK--GARNWILDRRINENQ-VGVGMLNELRSWLDD
ARCA_RHIET       DFVLKMQERGVEVLELHDLLGQTLANQ--QARDFLLDRRITPNV-LGSQIAEAMRPWLDE
ARCA1_RHIME      DFVLKMEERGVEVLELHDLLSDTLIDA--EARKFVLDRRVAPNV-MGSQIAELMRPWMEE
ARCA_DINSH       AFGAAMTQEGVEVLETGALLGETLEIP--EARKWVLDHRISAND-VGVGMRKDLRDWMDE
ARCA_BORAF       VFASILKNNLVEIEYIEDLISEVLVSSV-ALENKFISQFILEAEIKTDFTINLLKDYFSS
ARCA_BORBU       VFVNILKDNSVEIEYVEDLVSEVLASSV-ALKNKFISQFILEAEIKTDGVINILKDYFSN
ARCA_STRP1       AFAQALRDEGIEVLYLETLAAESL-VTP-EIREAFIDEYLSEANIRGRATKKAIRELLMA
ARCA_STRP3       AFAQALRDEGIEVLYLETLAAESL-VTP-EIREAFIDEYLSEANIRGRATKKAIRELLMA
ARCA_STRPN       AFAQALRDEGIEVLYLEQLAAESL-TSP-EIRDQFIEEYLDEANIRDRQTKVAIRELLHG
ARCA_CLOPE       AFAQTLREAGVEVLYLEVLAAEAIETSD-EVKQQFISEFIDEAGVESERLKEALIEYFNS
ARCA_LISIN       FFVKTMQDSNIEVLYLEKLAAEALK-EA-SNKENFLTKMIKESN-QMDESALYVRDYLMS
ARCA_LISMO       FFAKTMRDSNIEVLYLEKLAAEALR-EA-NNKESFLTKMIKESN-QMDESALYVRDYLMS
ARCA_STAAM       HFAQVLREEGVEVLYLEKLAAESIE-NP-QVRSEFIDDVLAESKKTILGHEEEIKTLFAT
ARCA_STAAW       HFAQVLREEGVEVLYLEKLAAESIE-NP-QVRSEFIDDVLAESKKTILGHEEEIKALFAT
ARCA_BACLD       QFAETLKQQGAEVLYLEKLTAEALD-DA-LVREQFIDELLTESKADINGAYDRLKEFLLT
ARCA_LACLA       FFAQTLRDNGAETVYIENLATEVFEKSS-ETKEEFLSHLLHEAGYRPGRTYDGLTEYLTS
ARCA_LACSK       QFAQTLRDNGVEVLYLENLAAEAID-AG-DVKEAFLDKMLNESHIKSPQVQAALKDYLIS
ARCA_MYCAR       QFVAELKANDINVVELIDLVAETYDLASQEAKDKLIEEFLEDSEPVLSEEHKVVVRNFLK
ARCA_MYCHO       SFVKIMKDRGINVVELTDLVAETYDLASKAAKEEFIETFLEETVPVLTEANKKAVRAFLL
ARCA_MYCPN       TFCQLLQEQNIEVVQLTDLTATTFDKANATAQNQFIETWLDQAEPKLTPEHRKVAKQYLL
                  :   :                             :   :                    

ARCA_MYCGI       LEAAP----LARILMAGMTFDELPFGENE--LSLVRRMHHGGDFVIDPLPNLLFTRDSSF
ARCA_RHOJR       VPAPD----LSTILTAGMTFDELPVAANT--ASLVRRMHHGGDFVIDPLPNLLFTRDSSF
ARCA_MYCTU       LDPGR----LAHVLTAGMTFNELPSDTRTD-VSLVLRMHHGGDFVIEPLPNLVFTRDSSI
ARCA_VIBCB       MDDEH----LASILLGGLAYSELPIKSSSM----LPKMKRPLDFVIEPLPNHLFTRDTSC
ARCA_VIBPA       MDDEH----LATILLGGLAYSELPIQSSSM----LPKMKRPLDFVIEPLPNHLFTRDTSC
ARCA_VIBVU       MDNEH----LATILLGGLAYSELPIQSASM----LPRMKQPLDFVIEPLPNHLFTRDTSC
ARCA_SALTY       MPHRE----LARHLSGGLTYGEIPASIKNM----VVDTHDINDFIMKPLPNHLFTRDTSC
ARCA_SALTI       MPHRE----LARHLSGGLTYGEIPASIKNM----VVDTHDINDFIMKPLPNHLFTRDTSC
ARCA2_ECOL6      MSHRD----LARHLSGGLTYSEIPASIKNM----VVDTHDINDFIMKPLPNHLFTRDTSC
ARCA_PSEAE       LEPRK----LAEYLIGGVAADDLPASEGANILKMYREYLGHSSFLLPPLPNTQFTRDTTC
ARCA_PSEPU       LEPRH----LAEFLIGGVAGQDLPVSEGAEVIKMYNKYLGHSSFILPPLPNTQFTRDTTC
ARCA_RHILO       LSNRD----LAETLIGGLSTHEFPESIGGEQLELIRDAAGVNEYLLPPLPNTLYTRDTTC
ARCA2_RHIME      LPDRE----LAETLIGGLSTHEFPETHGGEMLELIRDAAGVAEYLLPPLPNTLYTRDTTC
ARCA_STRCO       LSPRE----LAEYLVGGLATSDLPEDFRSPHLALARESTGAREYLMPPLPNTLYTRDTTC
ARCA_CUTAK       MPSDT----LAEYLIGGVAYGEVPADRRKHVLGALIKAHSENEFLIPPLPNTQFTRDTTA
ARCA_CHRVO       MPSSQ----LADHLVGGIAKFELP-FDPKG---LFGGYLDRSDFVLPPIPNSLFQRDPSC
ARCA_MARMS       MSAEQ----LAIYLIGGISVHELP-FKPHG---MFGNYLGGDGFVIPPLPNTQFPRDNSS
ARCA_RHIET       MPAAQ----LAAFMIGGIAISDLPEVKAKS---LMLSALPETDFVIPPIPNTLFQRDPSC
ARCA1_RHIME      MDSRR----LAAFLIGGISIADLPEGQGKA---LMASAFHSTQFVLPPIPNTLFQRDPSC
ARCA_DINSH       LPGTE----LATWLIGGLTVGDVPFEATSM----FGAYLGRHGFILPPLPNFLFTRDNSS
ARCA_BORAF       LTIDN----MISKMISGVVTEELKNYTSSL----DDLVNGANLFIIDPMPNVLFTRDPFA
ARCA_BORBU       LTVDN----MVSKMISGVAREELKDCEFSL----DDWVNGSSLFVIDPMPNVLFTRDPFA
ARCA_STRP1       IEDNQE---LIEKTMAGVQKSELPEIPASEK-GLTDLVESNYPFAIDPMPNLYFTRDPFA
ARCA_STRP3       IEDNQE---LIEKTMAGVQKSELPEIPASEK-GLTDLVESSYPFAIDPMPNLYFTRDPFA
ARCA_STRPN       IKDNQE---LVEKTMAGIQKVELPEIPDEAK-DLTDLVESEYPFAIDPMPNLYFTRDPFA
ARCA_CLOPE       FSDNKA---MVDKMMAGVRKEELKDYHRES---LYDQVNNVYPFVCDPMPNLYFTRDPFA
ARCA_LISIN       FDEEE----MIKKLMSGLKKSEIPERKKKHL-NEMM--DEQYPFFLDPLPNLYFTRDPAA
ARCA_LISMO       FDEEE----MIRKLMSGLKKSEIPERKKKHL-NEMM--DEQYPFFLDPLPNLYFTRDPAA
ARCA_STAAM       LSNQE----LVDKIMSGVRKEEIN-PKCTHL-VEYM--DDKYPFYLDPMPNLYFTRDPQA
ARCA_STAAW       LSNQE----LVDKIMSGVRKEEIN-PKCTHL-VEYM--DDKYPFYLDPMPNLYFTRDPQA
ARCA_BACLD       FDADS----MVEQVMSGIRKNELEREKKSHL-HELM--EDHYPFYLDPMPNLYFTRDPAA
ARCA_LACLA       MSTKD----MVEKIYAGVRKNELD-IKRTAL-SDMAGSDAENYFYLNPLPNAYFTRDPQA
ARCA_LACSK       MATLD----MVEKIMAGVRTNEID-IKSKAL-IDVS-ADDDYPFYMDPMPNLYFTRDPAA
ARCA_MYCAR       AKKTS--RELVEIMMAGITKYDLGIEA-------------DHELIVDPMPNLYFTRDPFA
ARCA_MYCHO       SKPT---HEMVEFMMSGITKYELGVES-------------ENELIVDPMPNLYFTRDPFA
ARCA_MYCPN       EQKAKSTLSMVRSMMGGIDKRKVAAANTI-----------NGDFLVDPMPNLYFTRDPFA
                          :     .*:   ..                        *:**  : **   

ARCA_MYCGI       WIGPRVAITSLSMHARVRETSLTDLIYAHHPRFLRVRRA-----------YESRSAPIEG
ARCA_RHOJR       WIGPRVAITSLALPARVRETSLTDIIYAHHPRFRGARRA-----------YESHTAPVEG
ARCA_MYCTU       WIGPRVVIPSLALRARVREASLTDLIYAHHPRFTGVRRA-----------YESRTAPVEG
ARCA_VIBCB       WVYGGVSLNPMMMPARQRETNHLRAIYRWHPTFAGQDFI----NYFGDEDQHYDNANVEG
ARCA_VIBPA       WVYGGVSLNPMMMPARQRETNHLRAIYRWHPIFAGQDFI----KYFGDDDLHYDNANVEG
ARCA_VIBVU       WVYGGVSLNPMMKPARQRETNHLRAIYQWHPIFAGQDFI----KYFGNEDLHYDNANIEG
ARCA_SALTY       WIYNGVSINPMAKPARQRETNNLRAIYRWHPQFAGGDFI----KYFGDEDINYDHATLEG
ARCA_SALTI       WIYNGVSINPMAKPARQRETNNLRAIYRWHPQFADGDFI----KYFGDENINYDHATLEG
ARCA2_ECOL6      WIYNGVSINPMAKPARQRETNNLRAIYRWHPQFAGGEFI----KYFGDENINYDHATLEG
ARCA_PSEAE       WIYGGVTLNPMYWPARRQETLLTTAIYKFHPEFANAEF----EIWYGDPDKDHGSSTLEG
ARCA_PSEPU       WIYGGVTLNPMYWPARRQETLLTTAIYKFHKEFTGADF----QVWYGDPDKDHGNATLEG
ARCA_RHILO       WIYGGVTQNPLYWPARHEETILTTSIYKFHPDFAGKV-----NVWWGDPTKDWGLATLEG
ARCA2_RHIME      WIYGGVTLNPLYWPARHEETILATAIYKFHPDFVGKV-----NVWWGEPTTDWGLATLEG
ARCA_STRCO       WLYGGLTLNPLYWSARHDETLLMKAIYTFHPDFKGS------KVWWGDPERDWGQATFEG
ARCA_CUTAK       WIFGGVTFNPMRWPARQQETVLASAIYTHHPIFAERDF----KIWYGCAEADHGMSTLEG
ARCA_CHRVO       WIYEGVTLNPMYWPARRQETLILQSIYQFHPYFAGKVN-----IWWGGCDTDHGPATLEG
ARCA_MARMS       WIYNGVTVNPMFWPARRPETLLVTAVYRFHPEFAPAFNNGDFKIWWGDPDLDHGPATAEG
ARCA_RHIET       WIYGGVTCNPMFWPARRAETLIQRAIYKFHPIFLGGDFQ----IWWGDSDQPFANASMEG
ARCA1_RHIME      WIYNGVTCNPMFWPARRAETLIQRAVYKFHPSFKGAAFD----IWWGDSDEQFANATMEG
ARCA_DINSH       WVYGGVTLNPMYWQARRPETLLTAAIYRYHPKFAGKVH-----EIWADPLKNHGLATLEG
ARCA_BORAF       SIGNGVTINKMFTKVRQRETIFAEYIFKYHPVYKE-NVPIWL--------NRWEEASLEG
ARCA_BORBU       SIGNGITINKMYTKVRRRETIFAEYIFKYHSAYKE-NVPIWF--------NRWEETSLEG
ARCA_STRP1       TIGTGVSLNHMFSETRNRETLYGKYIFTHHPIYGGGKVPMVY--------DRNETTRIEG
ARCA_STRP3       TIGTGVSLNHMFSETRNRETLYGKYIFTHHPIYGGGKVPMVY--------DRNETTRIEG
ARCA_STRPN       TIGNAVSLNHMFADTRNRETLYGKYIFKYHPIYGG-KVDLVY--------NREEDTRIEG
ARCA_CLOPE       TIGHGITLNHMRTDTRNRETIFAKYIFRHHPRFEGKDIPFWF--------NRNDKTSLEG
ARCA_LISIN       VIGSGVTINKMFQPARRRESLFIELILKHHPRFSSQEIPIWS--------GREEPFPLEG
ARCA_LISMO       VIGNGVTINRMFQPARRRESIFIELILKHHPRFSNQDIPVWS--------GRGEPFSLEG
ARCA_STAAM       SIGHGITINRMFWRARRRESIFIQYIVKHHPRFKDANIPIWL--------DRDCPFNIEG
ARCA_STAAW       SIGHGITINRMFWRARRRESIFIQYIVKHHPRFKDANIPIWL--------DRDCPFNIEG
ARCA_BACLD       AIGSGLTINKMKEPARRRESLFMRYIINHHPRFKGHEIPVWL--------DRDFKFNIEG
ARCA_LACLA       SMGVGMTINKMTFPARQPESLITEYVMANHPRFKD--TPIWR--------DRNHTTRIEG
ARCA_LACSK       SMGDGLTINKMTFEARQRESMFMEVIMQHHPRFANQGAQVWR--------DRDHIDRMEG
ARCA_MYCAR       SVGNGVTIHYMRYKVRQRETLFSRFVFSNHPKLINTPWYY----------DPSLKLSIEG
ARCA_MYCHO       SVGNGVTIHFMRYIVRRRETLFARFVFRNHPKLVKTPWYY----------DPAMKMPIEG
ARCA_MYCPN       SIGHGISINRMKYLTRRRETLFASFIFANHPIIAARKFYF----------KPIDMGTIEG
                  :   :    :   .*  *:     :   *                            **

ARCA_MYCGI       GDVLLLAPGVVAVGVGERTTPAGAEALARSLFD--DDLAHTVLAVPIAQERAQMHLDTVC
ARCA_RHOJR       GDVLLLAPGVVAVGVGERTTPAGAEALARSVFE--DELAHTVLVVPIAQARASMHLDTVC
ARCA_MYCTU       GDVLLLAPGVVAVGVGERTTPAGAEALARSLFD--DDLAHTVLAVPIAQQRAQMHLDTVC
ARCA_VIBCB       GDVLVIGKGAVLIGMSERTTPQGVENLAASLFK--SGQAKEVIAIDLPKHRSCMHLDTVM
ARCA_VIBPA       GDVLVIGKGAVLIGMSERTTPQGVENLAASLFK--AGQASEVIAIDLPKHRSCMHLDTVM
ARCA_VIBVU       GDVLVIGKGAVLIGMSERTTPQGVENLAANLFK--HGQAKEVIAIELPKHRSCMHLDTVM
ARCA_SALTY       GDVLVIGRGAVLIGMSERTTPQGVEFLAQALFK--HRQAERVIAVELPKHRSCMHLDTVM
ARCA_SALTI       GDVLVIGRGAVLIGMSERTTPQGVEFLAQALFK--HRQAERVIAVELPKHRSCMHLDTVM
ARCA2_ECOL6      GDVLVIGRGAVLIGMSERTTPQGIEFLAQALFK--HRQAERVIAVELPKHRSCMHLDTVM
ARCA_PSEAE       GDVMPIGNGVVLIGMGERSSRQAIGQVAQSLFA--KGAAERVIVAGLPKSRAAMHLDTVF
ARCA_PSEPU       GDVMPVGKGIVLIGMGERTSRHAIGQLAQNLFE--KGAAEKIIVAGLPKSRAAMHLDTVF
ARCA_RHILO       GDVMPIGKGNVLIGMSERTSRQAISQLAATLFE--KGAAERVIVAAMPKLRAAMHLDTVF
ARCA2_RHIME      GDVMPIGKGNVLIGMSERTSRQAISQLAATLFE--KGAAQRVIVAAMPKLRAAMHLDTVF
ARCA_STRCO       GDIMPVGNGVVLMGMSERTSRQAITQVAAALFR--SGAAEHVVVAGMPKLRSAMHLDTVF
ARCA_CUTAK       GDIMPVGNGTVLIGMGERSSWQAITQVARSLFA--QNAARRMVVAAMAPDRASMHLDTVF
ARCA_CHRVO       GDVMPIGNGVVLIGMGERTSPQAVVQVAKRVLHR-EGGAKRVIACQMPKSRAAMHLDTVF
ARCA_MARMS       GDVMAWGNGSVLIGMGERTSPQAVGQIAKRLFE--QGAATRVIACQMPRSRSAMHLDTVF
ARCA_RHIET       GDVMPIGNGTVLIGMGERTTYQAVGQVAQALFR--SKAAKRVVGCLMPKSRAAMHLDTVF
ARCA1_RHIME      GDVMPIGDGILLVGMGERTTYQAVGQVAKALFK--AGAATRVIGCLMPKSRAAMHLDTVF
ARCA_DINSH       GDVMPVGNGLVLVGMGERTSPQGVGLMAQALFG--EGRATRVIACQMPKSRAAMHLDTVF
ARCA_BORAF       GDELVLNKGLLVIGISERTEAKSVEKLAISL-FKNKTSFDTILAFQIPKNRSYMHLDTVF
ARCA_BORBU       GDEFVLNKDLLVIGISERTEAGSVEKLAASL-FKNKAPFSTILAFKIPKNRAYMHLDTVF
ARCA_STRP1       GDELVLSKDVLAVGISQRTDAASIEKLLVNI-FKQNLGFKKVLAFEFANNRKFMHLDTVF
ARCA_STRP3       GDELVLSKDVLAVGISQRTDAASIEKLLVNI-FKQNLGFKKVLAFEFANNRKFMHLDTVF
ARCA_STRPN       GDELVLSKDVLAVGISQRTDAASIEKLLVNI-FKKNVGFKKVLAFEFANNRKFMHLDTVF
ARCA_CLOPE       GDELILSKEILAVGISQRTDSASVEKLAKKLLYYPDTSFKTVLAFKIPVSRAFMHLDTVF
ARCA_LISIN       GDELILNEETVLVGVSERTDARAVERLAESLFSRA-PKIKRVLAAEIPETRSFMHLDTVF
ARCA_LISMO       GDELVLNEETVLVGVSERTDARAVERLAESLFNRS-PKIKRVLAVEIPETRSFMHLDTVF
ARCA_STAAM       GDELVLSKDVLAIGVSERTSAQAIEKLARRIFENPQATFKKVVAIEIPTSRTFMHLDTVF
ARCA_STAAW       GDELVLSKDVLAIGVSERTSAQAIEKLARRIFENPQATFKKVVAIEIPTSRTFMHLDTVF
ARCA_BACLD       GDELVLNEETVAIGVSERTTAQAIERLVRNLFQR-QSRIRRVLAVEIPKSRAFMHLDTVF
ARCA_LACLA       GDELILNKTTVAIGVSERTSSKTIQNLAKELFANPLSTFDTVLAVEIPHNHAMMHLDTVF
ARCA_LACSK       GDELILSDKVLAIGISQRTSAQSIEELAKVLFANH-SGFEKILAIKIPHKHAMMHLDTVF
ARCA_MYCAR       GDVFIYNNDTLVVGVSERTDLQTVTLLAKNIVANKECEFKRIVAINVPKWTNLMHLDTWL
ARCA_MYCHO       GDVFIYNNETLVVGVSERTDLDTITLLAKNIKANKEVEFKRIVAINVPKWTNLMHLDTWL
ARCA_MYCPN       GDIFVYDQQTVVMGLSERTTEAAINVLAKKIQQDSSTSFKRIFVINVPQLPNLMHLDTWL
                 ** :      : :*:.:*:       :   :          :.   ..     *****  

ARCA_MYCGI       TMVDTDAVVMYPNIQDSLTAFPIRR---KSGGVTIDRA--APFVDAAADAMGIGK--LRV
ARCA_RHOJR       TMVDHDAVVMYPIIQDTLSAFTIHR---EDKGVSIRGA--DPFLTAAAEAMGIGK--LRV
ARCA_MYCTU       TMVDTDTMVMYANVVDTLEAFTIQR---TPDGVTIGDA--APFAEAAAKAMGIDK--LRV
ARCA_VIBCB       THMDVDTFSVYPEIMRKDLDTWRLTPKG-NGEMHVEAS--HNYLHAIESALGLDQ--LKI
ARCA_VIBPA       THMDVDTFSVYPEIMRKDLDTWRLTPKGTDGEMHVEAS--HNYLHAIESALGLDQ--LKI
ARCA_VIBVU       THMDVDTFSVYPEIMRKDLHTWRLTPKG-NGEMQVEAL--HNYLHAIERALGLNH--LNI
ARCA_SALTY       THIDIDTFSVYPEVVRPDVQCWTLTPDG-RGGLKRTQE--STLVHALETALGIDQ--VRL
ARCA_SALTI       THIDIDTFSVYPEVVRPDVQCWTLTPDG-RGGLKRTQE--STLVHALETALGIDQ--VRL
ARCA2_ECOL6      THIDIDTFSVYPEVVRPDVNCWTLTPDG-HGGLKRTQE--STLLHAIEKALGIDQ--VRL
ARCA_PSEAE       SFCDRDLVTVFPEVVKEIVPFSLRPDPSSPYGMNIRRE-EKTFLEVVAESLGLKK--LRV
ARCA_PSEPU       SFCDRDLVTVFPEVVKEIKPFIITPDSSKPYGMNIAPQ-DASFLEVVSEQLLGKKDKLRV
ARCA_RHILO       TFADRDCVLLYPDIVNGIEAFSYRP-DGK-GGVELHKD-KGTFVETVRDALGLKK--MRV
ARCA2_RHIME      TFADRDCVLIYPDIVNEIEAFSYRP-GEKPGSLELHKD-RGSFVETVRDALGLKE--MRV
ARCA_STRCO       TFADRDVVTLYPRIMDAVHTFSLRP-GDRAPGFDVVDEGSTPFVDVVAKALGLPK--LRV
ARCA_CUTAK       SFCDVDLVTLYKPVVDTITPLVLEP-SSEAAGFSVRVD-DRHFTDVVASSLGLDG--LRT
ARCA_CHRVO       SFLDIDLLSVFPDVVDEITCTSMYA-GDREGEIRFERHEGVKLVDVVREALNLKE--IRV
ARCA_MARMS       SHCDRDVVTAFTDVCDEIQCYTLRP-GDHAGQIDFRK-EKKHLFQLAADCLGIKK--LNV
ARCA_RHIET       SFCDRDVVTLFAEVVDQVRCYSMYP-KDDDGTFEIHP-DNRPMLDVVAEALDLPQ--LRT
ARCA1_RHIME      TFCDRDVVTLFADVVDQIRCYSLFP-LDDEGNFEVRQ-EDRPMLEVVAEALGVDK--LRT
ARCA_DINSH       TFCGDNIVTSFKEVADEMTCYDLHP-GEGDKPLDMRHD-TRPMFEVVAEAMGFKK--LNV
ARCA_BORAF       TQIDYSVFTSFTSD---DMYFSIYVLTYNPSSS-KIHIKKEKARIKDVLSFYLGRK-IDI
ARCA_BORBU       TQIDYSVFTSFTSD---DMYFSIYVLTYNSNSN-KINIKKEKAKLKDVLSFYLGRK-IDI
ARCA_STRP1       TMVDYDKFTIHPEI---EGDLRVYSVTYDNE---ELHIVEEKGDLAELLAANLGVEKVDL
ARCA_STRP3       TMVDYDKFTIHPEI---EGDLRVYSVTYDNE---ELHIVEEKGDLADLLAANLGVEKVDL
ARCA_STRPN       TMVDYDKFTIHPEI---EGDLHVYSVTYENE---KLKIVEEKGDLAELLAQNLGVEKVHL
ARCA_CLOPE       TQVDYDKFTVHPGI---VGPLEVYALTKDPENDGQLLVTEEVDTLENILKKYLDRD-IKL
ARCA_LISIN       TMVNFAQFTIHPAIQNQQGELNVYILEKS---ENGLEITPRR-DFKRVIAEVLGVPEVDF
ARCA_LISMO       TMVNFAQFTIHPAIQNQQGELNIYILEKS---ENGLEITPRR-DFQRVIAEVLDEPEIDF
ARCA_STAAM       TMIDYDKFTMHSAILKAEGNMNIFIIEYDDV-NKDIAIKQSS-HLKDTLEDVLGIDDIQF
ARCA_STAAW       TMIDYDKFTMHSAILKAEGNMNIFIIEYDDV-NKDIAIKQSS-HLKDTLEDVLGIDDIQF
ARCA_BACLD       TMVDRDQFTIHPAIQGPEGDMRIFVLERGKT-ADEIHTTEEH-NLPEVLKRTLGLSDVNL
ARCA_LACLA       TMINHDQFTVFPGIMDGAGNINVFILRPG-K-DDEVEIEHLT-DLKAALKKVLNLSELDL
ARCA_LACSK       TMIDYDKFTIHPGIQGAGGMVDTYILEPG-N-NDEIKITHQT-DLEKVLRDALEVPELTL
ARCA_MYCAR       TMLDKDKFLYSPIANDVFKFWDYDLVNGGAE---PQPVENGLPLEGLLQSIINKKPVLIP
ARCA_MYCHO       TMLDKNKFLYSPIANDVFKFWDYDLVNGGAE---PQPQLNGLPLDKLLASIINKEPVLIP
ARCA_MYCPN       TMLDRNKFLYSPNMLAVLKAWRIDFTDPALK---WNEIAGDLS--TILHTIIGQKPMLIP
                 :  .   .                                                 :  

ARCA_MYCGI       IDTGL-DPVTAEREQWDDGNNTLALAPGVVVAYERNTETNARLADSGIEVLPIAASELGT
ARCA_RHOJR       IDTGL-DNVTAEREQWDDGNNTLALAPGVVVAYERNVETNARLEASGIEVLRIAGSELGS
ARCA_MYCTU       IHTGM-DPVVAEREQWDDGNNTLALAPGVVVAYERNVQTNARLQDAGIEVLTIAGSELGT
ARCA_VIBCB       ITTGG-DSYEAEREQWNDANNVLTVKPGVVIGYERNVYTNEKYDKAGIEVLTIPGNELGR
ARCA_VIBPA       ITTGG-DSYEAEREQWNDANNVLTVKPGVVIGYERNVYTNEKYDKAGIQVLTVPGNELGR
ARCA_VIBVU       ITTGG-DSYEAEREQWNDANNVLTVKPGVVIGYERNVYTNEKYDKAGIEVLTIPGNELGR
ARCA_SALTY       ITTGG-DAFEAEREQWNDANNVLTLRPGVVVGYERNIWTNEKYDKAGITVLPIPGDELGR
ARCA_SALTI       ITTGG-DAFEAEREQWNDANNVLTLRPGVVVGYERNIWTNEKYDKAGITVLPIPGDELGR
ARCA2_ECOL6      ITTGG-DAFEAEREQWNDANNVLTLRPGVVVGYERNIWTNEKYDKAGITVLPIPGDELGR
ARCA_PSEAE       VETGG-NSFAAEREQWDDGNNVVCLEPGVVVGYDRNTYTNTLLRKAGVEVITISASELGR
ARCA_PSEPU       VETGG-NSFAAEREQWDDGNNVVALEPGVVIGYDRNTYTNTLLRKAGIEVITISAGELGR
ARCA_RHILO       VETGG-NAYMRERTQWDSGANLVCASPGVVYAYDRNTYTNTLLRKEGIEVITIIGAELGR
ARCA2_RHIME      VETGG-NAYVRERTQWDSGANLVCLSPGVVLAYDRNTYTNTLLRKAGVEVITITGAELGR
ARCA_STRCO       VETGG-DAYASERQQWDSGNNAVAVEPGVVFTYDRNTLTNALLREARVEVVTIVGAELGR
ARCA_CUTAK       VETGG-DCWEAQREQWDDGNNVVALEPGVVVGYDRNTATNALLAKAGVEVVEIKAAELGR
ARCA_CHRVO       IQTGG-DAYQREREQWDDGNNVVALDRRVVVAYDRNTYTNRLMREHGVEVIEIPASELGR
ARCA_MARMS       VQTGG-DHYQKEREQWDDGNNVIALEPGVVVAYDRNTYTNTLLRKAGVEVITVSGAELGR
ARCA_RHIET       VETGG-NSYQAEREQWDDGNNVVALEPGVVVAYDRNTYTNTLLRKAGIEVITIRGSELGR
ARCA1_RHIME      IATGG-NTYEAEREQWDDGNNVVALEPGVVVAYDRNTYTNTLLRKAGIEVITIRGSELGR
ARCA_DINSH       VPTGGSDPFEQSREQWNDGNNVLALRPGVVMGYDRNDDTNAALRAEGIKVIELPGAELGR
ARCA_BORAF       IKCAGGDLIHGAREQWNDGANVLAIAPGEIIAYSRNHVTNKLFEENGIKVHRIPSSELSR
ARCA_BORBU       IKCAGGDLIHGAREQWNDGANVLAIAPGEVIAYSRNHVTNKLFEENGIKVHRIPSSELSR
ARCA_STRP1       IRCGGDNLVAAGREQWNDGSNTLTIAPGVVVVYNRNTITNAILESKGLKLIKIHGSELVR
ARCA_STRP3       IRCGGDNLVAAGREQWNDGSNTLTIAPGVVVVYNRNTITNAILESKGLKLIKIHGSELVR
ARCA_STRPN       IRCGGGNIVAAAREQWNDGSNTLTIAPGVVVVYDRNTVTNKILEEYGLRLIKIRGSELVR
ARCA_CLOPE       IKCGGGDEIIAAREQWNDGSNTLAIAPGEVIVYSRNYVTNEILEKEGIKLHVIPSSELSR
ARCA_LISIN       IPCGGEDVIVSAREQWNDGANTLAIAPGEVITYDRNHVSNDLLRKAGIKVHEVISSELSR
ARCA_LISMO       IPCGGEDVIVSAREQWNDGANTLAIAPGEVITYDRNQVSNDLLRSAGIKVHEVISSELSR
ARCA_STAAM       IPTGNGDVIDGAREQWNDGSNTLCIRPGVVVTYDRNYVSNDLLRQKGIKVIEISGSELVR
ARCA_STAAW       IPTGNGDVIDGAREQWNDGSNTLCIRPGVVVTYDRNYVSNDLLRQKGIKVIEISGSELVR
ARCA_BACLD       IFCGGGDEIASAREQWNDGSNTLAIAPGVVVTYDRNYISNECLREQGIKVIEIPSGELSR
ARCA_LACLA       IECGAGDPIAAPREQWNDGSNTLAIAPGEIVTYDRNYVTVELLKEHGIKVHEILSSELGR
ARCA_LACSK       IPCGGGDAVVAPREQWNDGSNTLAIAPGVVVTYDRNYVSNENLRQYGIKVIEVPSSELSR
ARCA_MYCAR       IAGEGASQMEIERETHFDGTNYLAIRPGVVIGYSRNEKTNAALEAAGIKVLPFHGNQLSL
ARCA_MYCHO       IGGAGATEMEIARETNFDGTNYLAIKPGLVIGYDRNEKTNAALKAAGITVLPFHGNQLSL
ARCA_MYCPN       IAGADANQTEIDIETHFDGTNYLTIAPSVVVGYARNKLTHQTLEAAGVKVIAFKGNQLSL
                 :                .. * :      :  * **  :        : :  . . :*  

ARCA_MYCGI       GRGGPRCMSCPAGRDPL--
ARCA_RHOJR       GRGGPRCMSCPVARDPL--
ARCA_MYCTU       GRGGPRCMSCPAARDPL--
ARCA_VIBCB       GRGGARCMSCPIERDDI--
ARCA_VIBPA       GRGGARCMSCPIERDDI--
ARCA_VIBVU       GRGGARCMSCPIERDDI--
ARCA_SALTY       GRGGARCMSCPLERDGI--
ARCA_SALTI       GRGGARCMSCPLERDGI--
ARCA2_ECOL6      GRGGARCMSCPLHRDGI--
ARCA_PSEAE       GRGGGHCMTCPIVRDPIDY
ARCA_PSEPU       GRGGGHCMTCPIVRDPIDY
ARCA_RHILO       GRGGGHCMTCPIIRDAVDY
ARCA2_RHIME      GRGGGHCMTCPIIRDAVDY
ARCA_STRCO       GRGGGHCMTCPLVREPVDF
ARCA_CUTAK       GRGGGHCMTCPITRDPVDY
ARCA_CHRVO       GRGGGHCMTCPIIRDEVKV
ARCA_MARMS       GRGGGHCMTCPVWRDPVSY
ARCA_RHIET       GRGGGHCMTCPIWRDPAY-
ARCA1_RHIME      GRGGGHCMTCPIWREPTD-
ARCA_DINSH       GRGGSRCMSCPTIRDAV--
ARCA_BORAF       GRGGPRCMSMPLIREDI--
ARCA_BORBU       GRGGPRCMSMSLVREDI--
ARCA_STRP1       GRGGPRCMSMPFEREDI--
ARCA_STRP3       GRGGPRCMSMPFEREDI--
ARCA_STRPN       GRGGPRCMSMPFEREEV--
ARCA_CLOPE       GRGGPRCMSMPLIREDL--
ARCA_LISIN       GRGGPRCMTMPITRGNLK-
ARCA_LISMO       GRGGPRCMTMPLVRENLK-
ARCA_STAAM       GRGGPRCMSQPLFREDI--
ARCA_STAAW       GRGGPRCMSQPLFREDI--
ARCA_BACLD       GRGGPRCMSMPLYREDVK-
ARCA_LACLA       GRGGARCMSQPLWREDL--
ARCA_LACSK       GRGGPRCMSMPLVRRKT--
ARCA_MYCAR       GMGNARCMSMPLSRKDVKW
ARCA_MYCHO       GMGNARCMSMPLSRKDVKW
ARCA_MYCPN       GMGSARCMSMPLVRKPL--
                 * *. :**: .  *