CLUSTAL format seed alignment for MF_00245

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1753_CLOAB      -------MEERIYLSMLLSTYGSLLTEKQVNVMRLYYDDDLSMPEIAELNNTTRQAIHDL
Y1714_CLOPE      -------MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDL
Y2485_BACHD      ------MLDKTLRMNYLFDFYQSLLTEKQRKYMSLYYLDDFSLGEIAEEFDVSRQAVYDN
YLXM_BACSU       -----MSLEKTTRMNYLFDFYQSLLTSKQKSYMSLYYLDDFSLGEIAEEYEVSRQAVYDN
Y1916_LISIN      ------MFEKTNRMNLLFDFYQELLTTKQKSYVSFYYLDDYSLGEIAEEFEVSRQAIYDN
Y1802_LISMO      ------MFEKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDN
Y1061_STRMU      -----MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFDVSRQAVYDN
Y1201_STRP1      --MNIMEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDN
Y1288_STRPN      -----MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDN
YOFM_LACLA       -----MEIEKTNRMNTLFEFYATLLTDKQMNYIELYYADDYSLAEIAEEFNISRQAVYDN
Y1236_STAAM      --MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDN
Y1463_CALS4      ------MEDDFLFMTLLYDFYGALLTDKQREIFEMYYLNDYSLGEISEILDISRQGVYDA
Y1394_FUSNN      -----MILDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDN
P13_MYCMY        MKLKNNLLEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDS
Y424_MYCPN       --MNQTKLNQRLKQQQLFDIYGELLTKRQACYFNEYINLDLSMQEIADKYQVKKSSIHQH
Y142_UREPA       --MLNK--NKRWYLIALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEISKSAISDC
                          .      * . *  **: :*   .  .   * *: **:.    .: .: : 

Y1753_CLOAB      IKRCHKMLLNYENKLKLVEKYKRNEDIKKDIKDKLYILKDKIQDKDNVQLIDEIEKDINS
Y1714_CLOPE      IKRCSKQLHSYDEKLKLSKKVDKRYRIKEELMAELN--KNSNLDENIKKYIDEKLEEIIN
Y2485_BACHD      IKRTEAMLEEYEEKLSLLAKFEKRSEILQQLKEAVD--KQA-TSEELMALLESLD-TLE-
YLXM_BACSU       IKRTEAMLEQYEEKLLLLKKFQERKEMFNKLKELAS--GSK-EEEEITALIEALE-KLD-
Y1916_LISIN      IKRTEESLEKYEEKLGMLRKYQQREKLFDQLEAQLT--KKNFLDEQVKDTLEQLK-NID-
Y1802_LISMO      IKRTEESLEKYEEKLGMLKKYQQREKLFTQLEAQLT--KKNFLDEQVKDTLEQLK-NID-
Y1061_STRMU      IKRTEKILEDYEMKLHMYSDYVVRSEIFDAIMKKYP--NDP-YLQNKISILTTID-NRD-
Y1201_STRP1      IKRTEKILETYEMKLHMYSDYVVRSEIFDDMIAHYP--HDE-YLQEKISILTSID-NRE-
Y1288_STRPN      IKRTEKILEDYEMKLHMYSDYIVRSQIFDQILERYP--KDD-FLQEQIEILTSID-NRE-
YOFM_LACLA       IKRTEKVLESYEEKLHLFSNYVVRNQLLEELMKKYS--TDQ-YLITKLQEIQQID-EEEF
Y1236_STAAM      IRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLS--NPE----QIQRYIQQLE-DLE-
Y1463_CALS4      LKRAEDSLEFYEEKLGLVKKHQEMMKKIEKIKECIKLIKEREKDEEILKIIEDMARELEE
Y1394_FUSNN      IKRGVALLYDYEDKLKFYQMKKNIRKELVDLKEDFT-------KENLEKIIENLL-----
P13_MYCMY        ISKTSKLLFSLETKLHLKQKQDLLISLINKIETNQID------EKQFIKSLKEVIWWKY-
Y424_MYCPN       IKTCNLIFNRFEAKLQLFKKQQLRLKLYEKITDPQLR------E-QLIKLR---------
Y142_UREPA       LNKVCDQLLKYEQALLIYEKNKKRNDLYTLINDSELV------K-KLKDI----------
                 :      .   :  * :             :                             

Y1753_CLOAB      FSI
Y1714_CLOPE      A--
Y2485_BACHD      ---
YLXM_BACSU       ---
Y1916_LISIN      ---
Y1802_LISMO      ---
Y1061_STRMU      ---
Y1201_STRP1      ---
Y1288_STRPN      ---
YOFM_LACLA       ---
Y1236_STAAM      ---
Y1463_CALS4      LNP
Y1394_FUSNN      ---
P13_MYCMY        ---
Y424_MYCPN       ---
Y142_UREPA       ---