CLUSTAL format seed alignment for MF_00248

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HSLV_AQUAE      --------MEVKATTILAVRRD--GK--TAVGGDGQVTLG-SSVIKHTARKIRKL-YKGQ
HSLV_THEMA      --------MKFHGTTILVVRRN--GQ--TVMGGDGQVTFG-STVLKGNARKVRKL-GEGK
HSLV_AGRFC      ------------MTTIITVRKG--GK--VVMAGDGQVSLG-QTVMKGNARKVRRIGKG-E
HSLV_RHIME      ----------MHATTIITVRKG--GK--VVMAGDGQVSLG-QTVMKGNARKVRRLSKG-D
HSLV_BRUME      --MIEHNPTTIYGTTIVTVRKD--GK--VVIAGDGQVSLG-NTVMKGNARKVRRIGKG-N
HSLV_BRUSU      --MIEHNPTTIYGTTIVTVRKD--GK--VVIAGDGQVSLG-NTVMKGNARKVRRIGKG-N
HSLV_RHILO      ----------MHATTIVTVRKG--NK--VVIAGDGQVSLG-QTIMKGNARKVRRIGKGGN
HSLV_CAUVC      MQSNSSSFPDWHGTTILAVRKN--GS--TVIAGDGQVSMG-PTVVKGNARKVRRLAGG-K
HSLV_BUCAI      ------------MTTILSVRLK--NK--VVIGGDGQATLG-NTIMKSNVKKIRSL-YHEK
HSLV_BUCAP      ------------MTTILSVRLK--NK--VVIGGDGQATLG-NTIMKSNVKKIRTL-YHEK
HSLV_BUCBP      ------------MTTILSVRLN--KQ--VVIGGDGQATLG-NTIIKSNVKKVRTL-YNNK
HSLV_ECOLI      ------------MTTIVSVRRN--GH--VVIAGDGQATLG-NTVMKGNVKKVRRL-YNDK
HSLV_SALTY      ------------MTTIVSVRRN--GH--VVIAGDGQATLG-NTVMKGNVKKVRRL-YNDK
HSLV_YERPE      ------------MTTIVSVRRD--GH--VVIGGDGQVTLG-NTVMKGNAKKVRRL-YNNK
HSLV_WIGBR      ------------MTTIVSVRRN--GH--IVIGGDGQATLG-NTIMKNNVKKVRTL-YNDT
HSLV_HAEIN      ------------MTTIVSVRRN--GQ--VVVGGDGQVSLG-NTVMKGNARKVRRL-YNGK
HSLV_PASMU      ------------MTTIVSVRRN--GQ--VVVGGDGQVSLG-NTVMKGNARKVRRL-YNGK
HSLV_VIBPA      ------------MTTIVSVRRN--NK--VVIAGDGQVSLG-NTVMKGNARKVRRL-YNNK
HSLV_VIBVU      ------------MTTIVSVRRN--NK--VVIAGDGQVSLG-NTVMKGNARKVRRL-YNNK
HSLV_VIBCH      ------------MTTIVSVRRN--NK--VVIAGDGQVSLG-NTVMKGNARKVRRL-YNNK
HSLV_SHEON      ------------MTTIVSVRRN--NQ--VVIAGDGQVSLG-NTVMKGNAKKVRRL-YHNK
HSLV_PSEPK      ------------MTTIVSVRRN--GK--VVMGGDGQVSLG-NTVMKGNAKKVRRL-YHGQ
HSLV_PSESM      ------------MTTIVSVRRH--GK--VVMAGDGQVSLG-NTVMKGNAKKVRRL-YHGE
HSLV_PSEAE      ------------MTTIVSVRRN--GK--VVMGGDGQVSLG-NTVMKGNAKKVRRL-YHGQ
HSLV_RALSO      -------MEQYHGTTIVSVRRG--NQ--VALGGDGQVTLG-NIVMKGTARKVRTI-YDGK
HSLV_XANAC      -MDPSQNPNIVHATTIISVRRG--GH--VAVAGDGQVTLG-HTVMKGNARKVRRLGREGQ
HSLV_XANCP      -MDPSQNPNVVHATTIISVRRG--GH--VAVAGDGQVTLG-HTVMKGNARKVRRLGRDGQ
HSLV_XYLFA      ------MSNVFHATTIVCVRRG--DK--VAIAGDGQVTLG-HTVMKSNARKVRRLGRDGQ
HSLV_CHLTE      ---MGYEKPQIRSTTVIGIIRD--GK--AALGSDGQMTLG-NTVMKHSTRKIRSL-YQGR
HSLV_MANHA      ------------MTTIVCVRKD--GK--VAIGGDGQATLG-NCIEKGTVRKVRRL-YKDK
HSLV_RICCN      ----MSDNLSLHGTTILCLKKN--EE--IIIAADGQVSHG-NTVLKSTARKLRTI-ANNK
HSLV_RICPR      ----MSDNFALHGTTILCLKKK--EE--IIIAADGQVSHG-NTVLKSTARKLRTI-ANNK
HSLV_BORBU      --------MSFKGTTVIAIKKN--GK--TVVAADGQVTFG-HTVLKSNAIKIRKL-LNGK
HSLV_HELPY      ---------MFEATTILGYRGELNHKKFALIGGDGQVTLG-NCVVKANATKIRSL-YHNQ
HSLV_HELPJ      ---------MFEATTILGYRGEFDNKKFALIGGDGQVTLG-NCVVKANAIKIRSL-YHNQ
HSLV_CAMJE      ---------MFHATTILAYKGK--NK--SVIGGDGQVSFG-NTVLKGNAVKIRKL-NNGK
HSLV_BACHD      ------MEMTFHATTIFAIHHN--GK--CAMAGDGQVTFGNAVVMKHTARKVRKI-YHGK
CLPQ_BACSU      -------MSSFHATTIFAVQHK--GR--SAMSGDGQVTFGQAVVMKHTARKVRKL-FNGK
HSLV_LISIN      --------MELHATTIFAVQHD--GK--AAMAGDGQVTLGESVVMKHTAKKVRRL-FHDK
HSLV_LISMO      --------MELHATTIFAVQHD--GK--AAMAGDGQVTLGESVVMKHTAKKVRRL-FHDK
HSLV_STAAM      -----MSNTTLHATTIYAVRHN--GK--AAMAGDGQVTLGQQVIMKQTARKVRRL-YEGK
HSLV_STAES      ------MDNSLHATTIYAVRHN--GE--AAMAGDGQVTLGQQVIMKQTARKVRRL-YEGK
HSLV_LACLE      ------------MTTICSVKYN--GQ--TAIAGDGQVTLGKSIIAKTTAKKIRRI-YHDQ
HSLV_LACPL      ------MTTKFEATTICAVRQN--GH--NAMAGDGQVTMGEKVVMKGTAHKVRRI-YNDQ
HSLV_CALS4      ---------MFRGTTIVAVRRG--DR--VSVAGDGQVTFGDSTILKHGAKKIRRL-YNGE
                             **:              :..*** : *   : *  . *:* :     

HSLV_AQUAE      VIVGFAGSAADGLALMERLEAKLEEYRGNLL---KASVQLAKDWRMDKYLRRLEALLLAV
HSLV_THEMA      VLAGFAGSVADAMTLFDRFEAKLREWGGNLT---KAAVELAKDWRTDRVLRRLEALLLVA
HSLV_AGRFC      VIAGFAGATADAFTLLDRLEKKLEQYPGQLM---RAAVELAKDWRTDKYLRNLEAMMLVA
HSLV_RHIME      VIAGFAGATADAFTLLERLEAKLEQYPDQLM---RAAVELAKDWRTNKYLRNLEAMMLVA
HSLV_BRUME      VIAGFAGATADAFTLLERLEAKLEQYPDQLM---RASVELTKDWRTDRYLRKLEAMMLVA
HSLV_BRUSU      VIAGFAGATADAFTLLERLEAKLEQYPDQLM---RASVELAKDWRTDRYLRKLEAMMLVA
HSLV_RHILO      VIAGFAGATADAFTLLERLEAKLEQYPDQLT---RACVELAKDWRTDRYLRRLEAMMLVA
HSLV_CAUVC      VVAGFAGATADAFTLIERLEAKLEQYPDQLA---RACVDLAKDWRTDRYLRRLEAMLLVA
HSLV_BUCAI      VIAGFAGGTADAFTLFEMFDKKLAMYQGQLQ---RAAIELAKDWRSDRMLRKLEALLAVA
HSLV_BUCAP      VIAGFAGGTADAFTLFEMFEKKLAMYQGQLP---RAAIELAKDWRSDRMLRKLEALLAVA
HSLV_BUCBP      VIAGFAGGTADAFTLFELFEKKLLMYQGQLQ---RSAIELAKDWRTDKILRKLEALLAVA
HSLV_ECOLI      VIAGFAGGTADAFTLFELFERKLEMHQGHLV---KAAVELAKDWRTDRMLRKLEALLAVA
HSLV_SALTY      VIAGFAGGTADAFTLFELFERKLEMHQGHLV---KAAVELAKDWRTDRMLRKLEALLAVA
HSLV_YERPE      VIAGFAGGTADAFTLFELFERKLEMHQGHLT---KAAVELAKDWRTDRMLRKLEALLAVA
HSLV_WIGBR      VIAGFAGGTADAFTLFELFEKKLQIHQGRFV---KSAVELAKDWRTDRMLRRLEALLAVA
HSLV_HAEIN      VLAGFAGGTADAFTLFELFERKLEMHQGHLL---KSAVELAKDWRTDRALRKLEAMLIVA
HSLV_PASMU      VLAGFAGGTADAFTLFELFERKLEMHQGHLL---KSAVELAKDWRTDRALRKLEAMLIVA
HSLV_VIBPA      VLAGFAGGTADAFTLFERFESKLQMHQGHLT---KAAVELAKDWRSDRALRKLEALLAVA
HSLV_VIBVU      VLAGFAGGTADAFTLFERFESKLQMHQGHLT---KAAVELAKDWRSDRALRKLEALLAVA
HSLV_VIBCH      VLAGFAGGTADAFTLFERFESKLQMHQGHLT---KAAVELAKDWRSDRALRRLEAILAVA
HSLV_SHEON      VLAGFAGGTADAFTLFERFESKLEMHQGHLL---RSAVELAKDWRTDRMLRKLEAMLVVA
HSLV_PSEPK      VIAGFAGATADAFTLFERFEGQLEKHQGHLV---RAAVELAKEWRTDRSLSRLEAMLAVA
HSLV_PSESM      VIAGFAGATADAFTLFERFEAQLEKHQGHLV---RAAVELAKDWRTDRSLSRLEAMLAVA
HSLV_PSEAE      VLAGFAGATADAFTLFERFEQQLEKHQGHLV---RAAVELAKDWRTDRSLSRLEAMLAVA
HSLV_RALSO      VLVGFAGATADAFSLLDRFEAKLQKYQGHLL---RAAVDLAKDWRTDRALRHLEAMLIVA
HSLV_XANAC      VLAGFAGAAADAFTLFELFEAKLDKH-GQLT---RAAVELAKDWRTERRLGKLEALLAVA
HSLV_XANCP      VLAGFAGAAADAFTLFELFEAKLDKH-GQLT---RAAVELAKDWRTERRLGKLEALLAVA
HSLV_XYLFA      VLAGFAGAAADAFTLFELFEAKLEKH-GQLS---RAAVELAKDWRTERRLGKLEALLVVA
HSLV_CHLTE      FITGFAGATADALTLLDRFESKLEAYSGKLD---RAAVELAKDWRTDKYLRRLEAMLAVV
HSLV_MANHA      VVTGFAGSTADAFILRDLFEKKLELHQGHLV---KSAVELAKEWRTERALRRLEAMMIVA
HSLV_RICCN      IIAGFAGSTADGLALFEKLAVKIEQHKHNLL---RSAVELAKDWRSDKYLRRLEAMMIVA
HSLV_RICPR      IIVGFAGSTADGLALFEKLEIKIEQYNSNLL---RSAVELAKDWRNDKYLRRLEAMMIVA
HSLV_BORBU      ILAGFAGSTSDAITLFEKFEEKIKAKGDGLIDIKRAAVDLAKDWRSDKILHKLEAMMLVA
HSLV_HELPY      VLSGFAGSTADAFSLFDMFERILESKKGDLF---KSVVDFSKEWRKDKYLRRLEAMMIVL
HSLV_HELPJ      VLSGFAGSTADAFSLFDMFERILESKKGDLF---KSVVDFSKEWRKDKYLRRLEAMMIVL
HSLV_CAMJE      VLAGFAGSTADAFNLFDMFENLLQSSKGDLL---KAAIDFSKEWRKDKYLRKLEAMMLVL
HSLV_BACHD      VLAGFAGSVADAFTLFEKFEAKLEEFNGNLQ---RSAVEVAKEWRSDKVLRRLEAMLIVM
CLPQ_BACSU      VLAGFAGSVADAFTLFEKFEAKLEEYNGNLK---RAAVELAKEWRSDKVLRKLEAMLIVM
HSLV_LISIN      VIAGFAGSVADAFTLFEKFEAKLNEYNGNLE---RAAVELAQQWRSDSVLRKLEAMLIVM
HSLV_LISMO      VIAGFAGSVADAFTLFEKFEAKLNEYNGNLE---RASVELAQQWRSDSVLRKLEAMLIVM
HSLV_STAAM      VLAGFAGSVADAFTLFEKFETKLQQFSGNLE---RAAVELAQEWRGDKQLRQLEAMLIVM
HSLV_STAES      VLAGFAGSVADAFTLFEKFETKLQQFSGNLE---RAAVELAQEWRGDKQLRQLEAMLIVM
HSLV_LACLE      VVIGFAGGVADAVSLQEMLEGKLESYSGDLR---RAAVEMAQSWRKDQTLQKLEAMVIAF
HSLV_LACPL      VVVGFAGSVADAFNLEDRFEKKLNEFSGNLQ---RAAVELAQEWRSDQALQKLEALLIVM
HSLV_CALS4      VIVGFAGSVADAMTLSQKFEEKLEQYGGNLK---RAAVELAQEWRKDKILRKLEALLIAA
                .: ****..:*.. * : :   :      :    :: ::.::.** :  * .***:: . 

HSLV_AQUAE      DREHMLLISGNGDIIEPDEP-----VLAIGSGGDYARAAALALYR-NTD-LSAREIVEKS
HSLV_THEMA      DKENIFIISGNGEVIQPDDD-----AAAIGSGGPYALAAAKALLR-NTD-LSAREIVEKA
HSLV_AGRFC      DKSTTLAITGNGDVLEPEH-----GAIAIGSGGNYAFAAARAMMD--TD-KSAEEVARQS
HSLV_RHIME      DRTVTLAITGNGDVLEPEH-----GTIAIGSGGNYAFAAARALMD--SD-KSAEEIARRA
HSLV_BRUME      DSKVTLALTGTGDVLEPEQ-----GVMAIGSGGNYALAAARALIE--TD-KSAEEIARKA
HSLV_BRUSU      DSKVTLALTGTGDVLEPEQ-----GVMAIGSGGNYALAAARALIE--TD-KSAEEIARKA
HSLV_RHILO      DKSVSLALTGTGDVLEPEH-----GVMAIGSGGNYALAAARALMD--TD-KDAEEIARKA
HSLV_CAUVC      DKTAIYTVTGVGDVLEPGESLGGGAVAAIGSGGNYALAAGKALID--LD-LSAEDIARKA
HSLV_BUCAI      DKKTSLIITGNGDVIQPEDD-----LIAIGSGGSYAQSSARALIE-NTH-LDANQIVRKS
HSLV_BUCAP      DKDTSLIITGNGDVIQPEDD-----LIAIGSGGSYAQSAARALIN-NTT-LNADEIVEKS
HSLV_BUCBP      DKETSLIVTGNGDVIQPENN-----LMAIGSGGSYAQAAAIAMIE-NTS-LTAKQIVEKA
HSLV_ECOLI      DETASLIITGNGDVVQPEND-----LIAIGSGGPYAQAAARALLE-NTE-LSAREIAEKA
HSLV_SALTY      DETASLIITGNGDVVQPEND-----LIAIGSGGPYAQAAARALLE-NTE-LGAREIAEKA
HSLV_YERPE      DETASLIITGNGDVVQPEDD-----LIAIGSGGPYAQSAARALLE-NTE-LGARDIVEKS
HSLV_WIGBR      DKNTSLIITGNADVIQPESD-----VIAIGSGGPYAQSAARALLE-NTD-LCARDIVRKS
HSLV_HAEIN      DEKESLIITGIGDVVQPEEDQ----ILAIGSGGNYALSAARALVE-NTE-LSAHEIVEKS
HSLV_PASMU      DEKESLIITGIGDVVQPEADQ----ILAIGSGGNFALSAARALVE-NTE-LSAREIVEKS
HSLV_VIBPA      DETASLIITGNGDVVQPEND-----LIAIGSGGAYAQAAATALLE-NTD-LDAREIAEKA
HSLV_VIBVU      DETASLIITGNGDVVQPEND-----LIAIGSGGAYAQAAATALLE-NTE-LDAREIAEKA
HSLV_VIBCH      DETASLIITGNGDVLQPEHD-----LIAIGSGGNYAQAAAIALLE-NTE-LDARTIAEKA
HSLV_SHEON      DAEASLIITGNGDVVQPEHD-----LVAIGSGGNYAQAAALALLQ-NTE-LSALEIAEKS
HSLV_PSEPK      NKDASLIITGNGDVVEPEDG-----LIAMGSGGAYAQAAARALLN-KTD-LSAREIAETA
HSLV_PSESM      NKDASLIITGNGDVVEPEDG-----LIAMGSGGAFAQAAARALLL-KTD-LSAREIAETS
HSLV_PSEAE      NKDASLIITGNGDVVEPEHG-----LIAMGSGGGFAQAAALALLQHNAE-LSAREVAETA
HSLV_RALSO      DRESTLVITGNGDVLDPEGG-----IAAIGSGGAYAQSAAKALME-NTE-LAPRDVVEKS
HSLV_XANAC      DKETSLIISGTGDVVEPEDG-----IIAIGSGGSYALSAARALLA-HTQ-LDAKTIAAEA
HSLV_XANCP      DKETSLIISGTGDVIEPEDG-----IIAIGSGGSYALSAARALLA-HTE-LDAKTIATEA
HSLV_XYLFA      DKETSLVISGTGDVIEPEDG-----IVAIGSGGSYALSAARALMA-HTA-LDARTIATEA
HSLV_CHLTE      STDKALIISGTGDVIEPEDG-----IVAIGSGSMYALAAARSLMK-HTT-LSAEEIVRES
HSLV_MANHA      NDSEFLLVSGSGDVIEPEQD-----VLAIGSGGNYAKAAALALLRTENN-LSAKEIVAEA
HSLV_RICCN      DRSHILILTGNGDVVEPENN-----VAAIGSGGLFALSAARALMSYENN-LTAEEIALKS
HSLV_RICPR      DRSHILILTGNGDVIEPENN-----VAAIGSGGLFALSAARALMSYENN-LTAEEIALKS
HSLV_BORBU      DSNNILLISGTGDVVEPEED-----VISIGSGGNYAYSAALAYME-NKK-LSAFEVALRS
HSLV_HELPY      NFDHIFILSGMGDVLEAEDNK----IAAIGSGGNYALSAARALDH-FAH-LEPRKLVEES
HSLV_HELPJ      NFDHVFILSGTGDVLEAEDNK----IAAIGSGGNFALSAARALDH-FAH-LEPRKLVEES
HSLV_CAMJE      DRNHIFLLSGTGDVVEPEDGQ----IAAIGSGGNYALSAARALAK-HTD-LDEEELVKSS
HSLV_BACHD      NEEHLLLVSGTGEVIEPDDG-----ILAIGSGGNYALAAGRALKKKAPQ-LSAREIAQAA
CLPQ_BACSU      NQDTLLLVSGTGEVIEPDDG-----ILAIGSGGNYALAAGRALKKHAGESMSASEIARAA
HSLV_LISIN      DKDTLLLVSGTGEVIEPDDG-----ILAIGSGGNYALAAGRALKRHNGGQMEAKDIARHA
HSLV_LISMO      DKDTLLLVSGTGEVIEPDDG-----ILAIGSGGNYALAAGRALKRHNGGQMEAKDIARHA
HSLV_STAAM      DKDAILVVSGTGEVIAPDDD-----LIAIGSGGNYALSAGRALKRHASH-LSAEEMAYES
HSLV_STAES      NKDAILIVSGTGEVIAPDDD-----LIAIGSGGNYALSAGRALKRHAAQ-LSASEMAYES
HSLV_LACLE      NDQDLLLISGNGEVLEPDES-----VVAIGSGGYYAQAAAVGMLRHASG-MTASEIAKEA
HSLV_LACPL      NKDDMLLVSGSGEVITPDND-----VLAIGSGGNFALAAARAMQLHAKD-MSAKEVAEAA
HSLV_CALS4      DKKDTLLISGTGEVIEPDED-----VIGIGSGGNYAMAAALALRYNTDL--DTEEIARKA
                .      ::* .::: .          .:***. :* ::. .             :.  :

HSLV_AQUAE      LKIASEICIYTNDKFVIEEI-------------
HSLV_THEMA      MTIAGEICIYTNQNIVIEEV-------------
HSLV_AGRFC      LDIAADICVYTNHNLVVETLDAE----------
HSLV_RHIME      LEIAGDICVYTNHNVVVETLDAE----------
HSLV_BRUME      MNIAADICIYTNHNIIVESLDAQ----------
HSLV_BRUSU      MNIAADICIYTNHNIIVESLDAQ----------
HSLV_RHILO      MQIASDICVYTNNNFVVETLDAA----------
HSLV_CAUVC      MGIAAEICVYTNGNLTVESL-------------
HSLV_BUCAI      LNIAANICIYTNHNFTIKELFSEK---------
HSLV_BUCAP      LNIAANICIYTNHSFTIKELFSEK---------
HSLV_BUCBP      LKITSGICIYTNNIFTIKELTSEK---------
HSLV_ECOLI      LDIAGDICIYTNHFHTIEELSYKA---------
HSLV_SALTY      LDIAGDICIYTNHFHTIEELTAKA---------
HSLV_YERPE      LSIAGDICIYTNRFQTIEELTY-----------
HSLV_WIGBR      LQISGDICLYSNHFFSFEELIHENKDII-----
HSLV_HAEIN      LRIAGDICVFTNTNFTIEELPN-----------
HSLV_PASMU      LKIAGDICVYTNTHFTIEELPNS----------
HSLV_VIBPA      LNIAGDICVFTNHHHTVEELDSTTEPETPAA--
HSLV_VIBVU      LNIAGDICVFTNHNHTIEELEIPAELPNLSQA-
HSLV_VIBCH      LNIAGDICVFTNHHHTIEELEIPQAMLPQGASA
HSLV_SHEON      LTIAGDICVFTNQFKTIEELNY-----------
HSLV_PSEPK      LNIAGDICVFTNHNLTIEEQDLAD---------
HSLV_PSESM      LHIAGDICVFTNHNITIEEQDLAD---------
HSLV_PSEAE      LNIAGSICVFTNQNLTIEELDSAV---------
HSLV_RALSO      LRIAGELCIYTNTNFVIETLE------------
HSLV_XANAC      INIAGDICIYTNRNVVVEEL-------------
HSLV_XANCP      INIAGDICIYTNRNVVVEEL-------------
HSLV_XYLFA      IGIAGNICIYTNRNVVVDEL-------------
HSLV_CHLTE      LQIAADICIYTNDHIVIETL-------------
HSLV_MANHA      LKIAGDIDIYSNYNHVIEEV-------------
HSLV_RICCN      MNIAADLCVFSNHNIIMEKVV------------
HSLV_RICPR      MNIAADLCVFSNHNIIMEKVV------------
HSLV_BORBU      LKIAARVCIYTNSNIVLEEIENE----------
HSLV_HELPY      LKIAGDLCIYTNTNIKILEL-------------
HSLV_HELPJ      LKIAGDLCIYTNTNIKILEL-------------
HSLV_CAMJE      LQIAGEICIYTNTNIKTYVIEDEK---------
HSLV_BACHD      LETAGDICVYTNDQLIVEEL-------------
CLPQ_BACSU      LETAGEICVYTNDQIILEELE------------
HSLV_LISIN      LEIASEICVFTNDHITVEEL-------------
HSLV_LISMO      LEIASEICVFTNDHITVEEL-------------
HSLV_STAAM      LKVAADICVFTNDNIVVETL-------------
HSLV_STAES      LKVAADICVFTNDNIIVETL-------------
HSLV_LACLE      VNIAADIDVFTDHEIVTDEIEEK----------
HSLV_LACPL      IHIAGDIDIFTNHNVISETL-------------
HSLV_CALS4      LEIASKICVYTNNNITVETL-------------
                :  :. : ::::