CLUSTAL format seed alignment for MF_00249

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HSLU_AGRFC      -----------MTTFSPREIVSELDRHIIGQHDAKRAVAIALRNRWRRQQLDESLRDEVM
HSLU_RHIME      -----------MSNFSPREIVSELDRYIIGQKDAKRAVAIALRNRWRRQQLDDELRDEVM
HSLU_BRUME      -----------MSNFSPREIVSELDRFIIGQKDAKRAVAIALRNRWRRQQLEGQMREEVM
HSLU_RHILO      -----------MTTFSPREIVSELDRFIIGQKDAKRAVAIALRNRWRRQQLEGQMREEVM
HSLU_CAUVC      -----------MTEFSPREIVSELDRYIVGHAEAKKAVAVALRNRWRRRRVPADLRDEVT
HSLU_RICCN      MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNRCRRKRVEGNLRNEIV
HSLU_RICPR      MKSTETTYKKDNMGLTPSQIVNELNRFIVGQDKAKKAVAIALRNRYRRKRVEGNLRNEIV
HSLU_BUCAI      -----------MSEMTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELRYEVT
HSLU_BUCAP      -----------MSEMTPPQIVSELNKFIIGQEQAKKAVAIALRNRWRRMQLNNELRHEIT
HSLU_SALTI      -----------MSEMTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVT
HSLU_SALTY      -----------MSEMTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVT
HSLU_ECOLI      -----------MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVT
HSLU_YERPE      -----------MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELRHEVT
HSLU_HAEIN      -----------MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVT
HSLU_PASMU      -----------MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVT
HSLU_MANHA      ------------MSMTPREIVSELDAHIIGQKDAKRAVAIALRNRWRRMQLPEDLRQEVT
HSLU_VIBCH      -----------MSEMTPREIVSELNRHIIGQDKAKRAVAIALRNRWRRMQLEESLRVEVT
HSLU_PSEAE      ------------MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRAEVT
HSLU_RALSO      ----------MPETMTPSEIVSELDKHIIGQQKAKKAVAVALRNRWRRQQVADPLRQEIT
HSLU_XYLFA      ---MPSKTDFTSSTMTPREIVQELDRHIVGQQAAKRSVAIALRNRWRRMQLPEELRNEVM
HSLU_AQUAE      --MTTKSLSELLEELTPKRVVEELNKYVVGQEEAKKAVAIALRNRWRRQKLPENLRNEVI
HSLU_CALS4      --------MRNVKNYTPKEIVAELDKYIVGQKEAKKSVAVALRNRYRRSLLPEDFKEEVT
HSLU_THEMA      --------MKSFDEMTPKEIVQELDKYIVGQYEAKKAVAIAVRNRIRRQKLPEEWRKEVL
HSLU_HALH5      ----------MKNVLTPRQIVERLDQYIVGQEGAKRSVAIALRNRYRRFQLEDKLRDEIT
CLPY_BACSU      ---------MEKKPLTPRQIVDRLDQYIVGQQNAKKAVAVALRNRYRRSLLDEKLKDEVV
HSLU_LISIN      -----MTNLTLMNQLTPKQIVEKLDQYIIGQTGAKKSVAVALRNRYRRQLMDESIRDEII
HSLU_LISMO      -----MTNLTLRNQLTPKQIVEKLDQYIIGQNGAKKSVAVALRNRYRRQLMDESIRDEII
HSLU_STAAM      -------MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEIS
HSLU_LACLE      -----------MREKTPKQIVDLLDKYIVGQNEAKKSVAIALYNRYRRAQLPEDVQKDIT
HSLU_HELPY      ---------MSKLNMTPREIVAYLDEYIIGQKEAKKSIAIAFRNRYRRLQLEKSLQEEIT
HSLU_HELPJ      ---------MSKLNMTPREIVAYLDEYIIEQKEAKKFIAIALRNRYRRLQLEKSLQEEIT
HSLU_CAMJE      ------------MNLTPKEIVKFLDDYVIGQKKAKKIIAIALRNRYRRMQLSPELQDDIV
HSLU_BORBU      ------MNKLEEHYIVPKDVVAELDKYIIGQDEAKKLVSIALVNRYIRSRLPKEIKDEVM
                                *  :*  *: .:: :  **: :::*. **  *  :    : :: 

HSLU_AGRFC      PKNILMIGPTGVGKTEISRRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRDLVEIGIG
HSLU_RHIME      PKNILMIGPTGVGKTEISRRLAKLAGAPFVKVEATKFTEVGYVGRDVEQIVRDLVEVGIS
HSLU_BRUME      PKNILMIGPTGVGKTEISRRLAKLAGAPFVKVEATKFTEVGYVGRDVEQIIRDLVEIAIT
HSLU_RHILO      PKNILMIGPTGVGKTEISRRLARLAGAPFVKVEATKFTEVGYVGRDVEQIIRDLVEIAIG
HSLU_CAUVC      PKNILLIGPTGVGKTEIARRLAKLAQAPFLKVEATKFTEVGYVGRDVDQIVRDLVESALA
HSLU_RICCN      PKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVN
HSLU_RICPR      PKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVGRDVESIIRDLVEIAVN
HSLU_BUCAI      PKNILMIGPTGVGKTEIARRLAKLADSPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIK
HSLU_BUCAP      PKNILMIGPTGVGKTEIARRLAKLANSPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAIK
HSLU_SALTI      PKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVK
HSLU_SALTY      PKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVK
HSLU_ECOLI      PKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVK
HSLU_YERPE      PKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVK
HSLU_HAEIN      PKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMK
HSLU_PASMU      PKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMK
HSLU_MANHA      PKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLADVSMK
HSLU_VIBCH      PKNILMIGPTGVGKTEIARRLAKLANVPFIKVEATKFTEVGYVGKEVESIIRDLTDVAVK
HSLU_PSEAE      PKNILMIGPTGVGKTEIARRLARLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAVK
HSLU_RALSO      PKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDTIVRDLAEMAVK
HSLU_XYLFA      PKNILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIGRDLVDTAVK
HSLU_AQUAE      PKNILMIGPTGVGKTEIARRLANLIKAPFVKVEATKYTEIGYVGRDVESMVRELVEVSFQ
HSLU_CALS4      PKNILMVGPTGVGKTEIARRIAKLVEAPFVKVEATKFTEVGYVGRDVDSMVRDLVEAAVR
HSLU_THEMA      PKNILMIGPTGVGKTEIARRLAQLSGSPFLKVEATRFTEVGYVGKNVDSMIRDLVEISVN
HSLU_HALH5      PKNILMIGPTGVGKTEIARRLAKLVGAPFVKVEATKFTEVGYVGRDVESMIRDLVETSVR
CLPY_BACSU      PKNILMMGPTGVGKTEIARRIAKLSGAPFIKIEATKFTEVGYVGRDVESMVRDLVETSVR
HSLU_LISIN      PKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVR
HSLU_LISMO      PKNILMIGPTGVGKTEIARRIAKIVRAPFSKVEATKFTEVGYVGRDVESMVRDLVEVSVR
HSLU_STAAM      PKNILMIGPTGVGKTEIARRMAKVVGAPFIKVEATKFTELGYVGRDVESMVRDLVDVSVR
HSLU_LACLE      PKNILMAGPTGVGKTEIARRLADIVDAPFVKVEATKFTEVGYVGRDVESMVRDLANEAVR
HSLU_HELPY      PKNILMIGSTGVGKTEIARRIAKIMELPFVKVEASKYTEVGFVGRDVESMVRDLVNNSVL
HSLU_HELPJ      PKNILMIGSTGVGKTEIARRMAKIMKLPFVKVEASKYTEVGFVGRDVESMVRDLVNNSVL
HSLU_CAMJE      PKNILMIGSTGVGKTEIARRLAKMMGFPFIKIEASKYTEVGFVGRDVESMVRDLANAALN
HSLU_BORBU      PKNIIMIGSTGIGKTEIARRLSKLIKAPFIKVEATKYTEVGYVGRDVESMVRDLMSIAVN
                ****:: *.**:*****:**:: :   ** *:**:::**:*:**::*: : *:* . .. 

HSLU_AGRFC      LVREKKRAEVQAKAHQSAEERVLDALVGSTAS----------------------------
HSLU_RHIME      LVREKRRAEVKAKAHQNAEERVLDALVGTTAS----------------------------
HSLU_BRUME      LVREKRREDVKAKAHLNAEERVLDALVGKTAS----------------------------
HSLU_RHILO      LVREKMREDVKARAHINAEERVLEALVGKTAS----------------------------
HSLU_CAUVC      MVREKRRAAVKAKAEGGAEERILDALTG-PGS----------------------------
HSLU_RICCN      TEKTLAKTKVDIHAREKAIERILDSLVGKTSS----------------------------
HSLU_RICPR      TEKALAKIAVDINAREKAIERILDSLVGKTSS----------------------------
HSLU_BUCAI      MIRIKNIKKNKVRVEEIVEEKILDVLVPTPKKN--------------WTES---------
HSLU_BUCAP      MIRVKNIEKNKLRVEEIVEERILDVLVPRPKNN--------------WTEN---------
HSLU_SALTI      MVRVQAIEKNRYRAEELAEERILDVLIPPAKNN--------------WGQA---------
HSLU_SALTY      MVRVQAIEKNRYRAEELAEERILDVLIPPAKNN--------------WGQA---------
HSLU_ECOLI      MVRVQAIEKNRYRAEELAEERILDVLIPPAKNN--------------WGQT---------
HSLU_YERPE      MVRHQSIEKMRYRAEELAEERILDVLIPPAKNN--------------WGVP---------
HSLU_HAEIN      LVRQQEIAKNRARAEDVAEERILDALLPPAKNQ--------------WGEV---------
HSLU_PASMU      LVRQTEIEKNRFRAEEAAEDRILDALLPPAKNQ--------------WGQV---------
HSLU_MANHA      LVRQQAVEKNKMRAQDAAEDRILDVLLPPAKDQ--------------WGNV---------
HSLU_VIBCH      LTHQQAMEKVKFRAEELAEERVLDALLPPPRDA--------------WGQA---------
HSLU_PSEAE      MLREQEIQKVKYRAEDAAEERILDALLPAARPA--------------MGFG---------
HSLU_RALSO      QTRESEMKKVRAKAEDAAEDRLLDVLIPPPRD---------------IGFA---------
HSLU_XYLFA      MYREQAKVRVRTQAEEYAEERILDVLLPRRSVG--------------IGFDVD-----AD
HSLU_AQUAE      MVKQEKMKEVRERARRLAEERLLDYLVPHQFTS--------------FGIRES-----R-
HSLU_CALS4      MVKEEKLKAVTEKAKKLAEERLIDYLLGKKKKQ---PKNP---FEMIFNYPSS-----ER
HSLU_THEMA      MVKQEKIKEVERQAEELVEERILDALVPESKAM---PVVTNPFINLITGGQQQ-----QY
HSLU_HALH5      LVKEEKMKGVKKQAEEQANQRIVELLVPA-KK--KT-QAYKNPLEMLFGQQQE---NTDH
CLPY_BACSU      LIKEEKMNEVKEQAEENANKRIVRLLVPG-KK--KQ-SGVKNPFEMFFGGSQP---NGED
HSLU_LISIN      LVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKK--KQ-TTSQNPLEALFGSMN----QPDE
HSLU_LISMO      LVKEEKMQLVRVKAEKNAEKRLIKLLAPSQKK--KQ-TTSQNPLEALFGGMN----QPDE
HSLU_STAAM      LVKAQKKSLVQDEATAKANEKLVKLLVPSMKK--KA-SQTNNPLESLFGGAIPNFGQNNE
HSLU_LACLE      IVEKEEFVKVEGQAIRQANKTLVRLLVPGVKRNNRQ-NQMQQMQEMIQSLLAG---GGMS
HSLU_HELPY      LVENEHKEKLKDKIEEAVIEKIAKKLLPPLPN----------------GVS---------
HSLU_HELPJ      LVENEHKERLKDKIEEAVVEKIAKKLLPPLPS----------------GVS---------
HSLU_CAMJE      LVKNEQREKNKDKIDEFIENKILEKLLPPLPK----------------GIS---------
HSLU_BORBU      MVKEEMYSTVRDDALVRTEERIVDSLFKGSSNS--------------ENMD---------
                  .                . :   *                                  

HSLU_AGRFC      ----------PGTRESFRKKLRDGELDDKEIDIEVADSGS-GMPGFEIPGMPGANIGVLN
HSLU_RHIME      ----------PATRDSFRKKLRANELDDKEIEVDVAEAGS-PGGAFEIPGMPGANIGVLN
HSLU_BRUME      ----------PVTRDSFRKKLRNGEMDDKEIEIEVSDSG--ASPNFEIPGMPGANIGVLN
HSLU_RHILO      ----------PATRDSFRKKLRDGELDDKEIEIEVADTGNGGMPGFEIPGMPGANIGVLN
HSLU_CAUVC      ----------TAARESFRKKLRAGELDDKEVELQLADTG---GPSFDIPGQPGA--AVFN
HSLU_RICCN      ----------SETREKFKEKILNGELDDKEIEISVADTTPVGGGSFEIPGMPGASMGVLN
HSLU_RICPR      ----------SETREKFKAKVLNGELDDTEIEISVADTTPVGGGGFEIPCIPGASMGVLN
HSLU_BUCAI      ---EK-NESLAKTIQTFRKKLREGVLDEKEIEINILS-T---TMGVEIMAPPGMEELTNQ
HSLU_BUCAP      ---EK-NESLLNTLQVFRKKLREGILDEKEIEINVLA-S---TMGVEIMAPPGMEELTSQ
HSLU_SALTI      ---EQ-QQEPSAARQTFRKKLREGQLDDKEIEINLAA-A---PMGVEIMAPPGMEEMTSQ
HSLU_SALTY      ---EQ-QQEPSAARQTFRKKLREGQLDDKEIEINLAA-A---PMGVEIMAPPGMEEMTSQ
HSLU_ECOLI      ---EQ-QQEPSAARQAFRKKLREGQLDDKEIEIDLAA-A---PMGVEIMAPPGMEEMTSQ
HSLU_YERPE      ---DE-SQEPSATRQTFRKKLREGQLDDKEIEIDLAA-A---PMGVEIMAPPGMEEMTNQ
HSLU_HAEIN      ---EN-HDSHSSTRQAFRKKLREGQLDDKEIEIDVSAGV---SMGVEIMAPPGMEEMTNQ
HSLU_PASMU      ---ET-TDSNNTTRQVFRKKLREGQLDDKEIDIDVAA-P---SMGVEIMAPPGMEEMTNQ
HSLU_MANHA      ---QE-SD-NNSTRQTFRKKLREGQLDDKEIEIDVAA-----QVSVEIMTPPGMEEMTSQ
HSLU_VIBCH      ---EQ-KEENSSTRQVFRKKLREGQLNDKEIEINVAV-P---QMGVEIMAPPGMEEMTNQ
HSLU_PSEAE      ---DEPAREDSNTRQLFRKRLREGQLDDKEIDIEVAD-N---PAGVEIMAPPGMEEMTNQ
HSLU_RALSO      ---QP-EEKDSNARQVFRKKLREGQLDDKEIELEVAA-G---MPGMDIMGPPGMEEMTEQ
HSLU_XYLFA      VIRQEPSAHESETRAKFRRMLRSGELEEREIELDVAV-----NVSMDIMTPPGMEEMGQQ
HSLU_AQUAE      ---------DAGKREELRQKLRKGELDDRIVEIEVKEKT---VPMVGIAGPPGLEELENQ
HSLU_CALS4      T--EEPDNVDSYKREEIRQRLRSGELDNHMVEIEVTDTT---PPMLEMYTNLGAEELNIT
HSLU_THEMA      T--PEDRRRFRAKREEMREKLRKGELEDEEIEIELEETV---SPFMGIFGP-GMEDLGIE
HSLU_HALH5      QETSAEQDTLTERRRRMSHQLALGELEDHYVTVEVEEQT---PQFFDMLQGSGMEQMGMN
CLPY_BACSU      EAESQEEANIEEKRKRMAHQLALGELEDYYVTVEVEEQQ---PSMFDMLQGSGMEQMGMN
HSLU_LISIN      PAEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQ---NPMFDMMRGTGMDQMS-G
HSLU_LISMO      SPEEEVDQELKNKRSQIEWRLQNGELDDEIVTVEVKEQQ---NPMLDMMRGAGMDQMN-G
HSLU_STAAM      DEEEPPTEEIKTKRSEIKRQLEEGKLEKEKVRIKVE--Q---DPGALGMLGTNQNQQ---
HSLU_LACLE      EETEEVTDEIRNQRLSVAEKLDRGLLENEEVTIEVE--Q---APKANPM-GDMMGQMGMD
HSLU_HELPY      ---EEKKQEYANSLLKMQQRIAQGELDSREIEIEVRKKS----IEIDSNVPPEILRVQEN
HSLU_HELPJ      ---EEKKQEYANSLLKMQQRIAQGELDSREIEIEVRKKS----IEIDSNVPPEILRVQEN
HSLU_CAMJE      ---DEKQEEYKNSLEKMRTKLRNGDLDESTIEIEISQNM----FDTNPNLPPEMGAMQD-
HSLU_BORBU      ---PNEIKAEEKVKEKLRKKLRAGELDDTTIEIQISSKMP--FSTIEIFTGGNFEEIDMG
                                .   :  . ::.  : :.:                         

HSLU_AGRFC      LSEMFGKAMGGR-TKKVRTTVSKSYTDLVRDESDKLLDNEMIQREAVKSVENDGIVFLDE
HSLU_RHIME      LSEMFGKALGGR-TKKVKTTVKDSYALLVNDESDKLLDNEQIQREAVAAAENDGIVFLDE
HSLU_BRUME      ISDMLGKAMGGR-TKTRKTTVKDSYPILINDESDKLLDQDQIVQEALRVSEDEGIVFIDE
HSLU_RHILO      INDMLSKAMGGKKTKSRKTTVKESYDLLVSDESDKLLDQDEVVRRALDATENDGIVFLDE
HSLU_CAUVC      LSDMMKSLGGGR-TKTHKTTVSGAWAPLIAEESDKLLDQEALTQEALELAENHGIVFLDE
HSLU_RICCN      LGDMIGRALGSSKTKTKKMLVKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDE
HSLU_RICPR      LGDMIGRALGNSKTKTKKMLIKDAMTVIIPEESEKLIDQEKIIQKAINLAENDGIVFIDE
HSLU_BUCAI      LQSLFQNLGGHK-KSSRRLKIKDAIVLLTEEEAAKLINQEEIKKEAINAVEQNGIVFIDE
HSLU_BUCAP      LQSLFQNLGGHK-KNTRRLKIKDAVLLLKEEEAAKLINQEEIKKEAINAVEQNGIVFVDE
HSLU_SALTI      LQSIFQNLGGQK-QKPRKLKIKDAMKLLVEEEAAKLVNPEELKQDAIDAVEQHGIVFIDE
HSLU_SALTY      LQSMFQNLGGQK-QKPRKLKIKDAMKLLVEEEAAKLVNPEELKQDAIDAVEQHGIVFIDE
HSLU_ECOLI      LQSMFQNLGGQK-QKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDE
HSLU_YERPE      LQSMFQNIAGQK-QKPRKIKIKEALKLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDE
HSLU_HAEIN      LQSLFQNLGSDK-TKKRKMKIKDALKALIDDEAAKLINPEELKQKAIDAVEQNGIVFIDE
HSLU_PASMU      LQSMFQNLSSGQ-TKKRKMKIKDALKTLIDDEAAKLINPEDLKQKAIDAVEQNGIVFIDE
HSLU_MANHA      LQSLFEGMSPSK-TKKRKMKIKDALKVMLDEEAAKLVNPEELKQQAIEAVEQHGIVFIDE
HSLU_VIBCH      LQGLFQNLAGDT-KKKRKMKIKDALKALVEEEAAKLVNQEELKEQAIYNVENNGIVFIDE
HSLU_PSEAE      LQNLFSGMSKGK-KKTRKLKVAEALKLIRDEEAVRLVNEEELKARALEAVEQHGIVFIDE
HSLU_RALSO      IRSMFAGLGQGK-KHRRKMKVHEAFKLLVEEEAGKLVNEEELKHKAIANVEQNGIVFLDE
HSLU_XYLFA      LRQMFSNIGGGK-SQKRKLTIKAARPLLIEEEAAKLVNEDEIRAAAIEACEQNGIVFIDE
HSLU_AQUAE      IKEMLSGLIPSK-RR-RKVKVKEALQILEQEEAEKLIDMEEVAREAIYRAENFGIIFIDE
HSLU_CALS4      LQDMFSDLLPKK-KKLRKVTVAEAKKILEAEEAQNLIDMDEVIEEAVKRAENDGIIFIDE
HSLU_THEMA      ITNMFSGMLPKR-KKKRKMKVSEARKVLLPLEAEKLIDMDKVVQEALDRAQNRGIIFIDE
HSLU_HALH5      MQEMLGNMMPKK-RKKRKLTVREARRVLTEEEAQKLIDMDEVTQEAVSKAEQLGIVFIDE
CLPY_BACSU      MQDALSGLMPKK-KKRRKMTVREARKVLTNEEASKLIDMDEVGQEAVQRAEESGIIFIDE
HSLU_LISIN      MQDALSGMFPAK-KKKRKVTVREAKKILFEDEASKLIDSDELAAEGIHRAEQMGMIFIDE
HSLU_LISMO      MQDALSGMFPAK-KKKRKVTVREAKKILFEDEASKLIDADELAAEGIHRAEQMGMIFIDE
HSLU_STAAM      MQEMMNQLMPKK-KVEREVAVETARKILADSYADELIDQESANQEALELAEQMGIIFIDE
HSLU_LACLE      MSSMLGDMLPKK-KVKRTLPVSQARKLLVQEEEKKLVNYDDIYQKAMDRAGQSGIIFIDE
HSLU_HELPY      LIKVFHKEQD---KVKKTLSVKEAKEALKAEISDTLLDSEAIKMEGLKRAESSGVIFIDE
HSLU_HELPJ      LIKVFHKEQD---KVKKTLSVKEAKEALKAEISDTLLDGEAIKMEGLKRAESSGVIFIDE
HSLU_CAMJE      IVKVIGVGSK---KVKKEMKIKDAKNALKNEAGEKILDQESIKSEALKRAENEGIIFIDE
HSLU_BORBU      IGGLLGNIFDRK--KKRELKIKKAKEIILAEELEKLVDHENISDIAKSKVENMGIIFIDE
                :   :               :  :   :       ::: :     .     . *::*:**

HSLU_AGRFC      IDKIAAR--DGGMGA-GVSREGVQRDLLPLVEGTTVSTKYGPVKTDHVLFIASGAFHVAK
HSLU_RHIME      IDKIATR--EGGIGA-GVSREGVQRDLLPLVEGTTVATKYGPVKTDHILFIASGAFHVAK
HSLU_BRUME      IDKIAAR--EGGSGA-GVSREGVQRDLLPLVEGTTVATKYGPVKTDHILFITSGAFHVSK
HSLU_RHILO      IDKIAAR--SDISG--GPSREGVQRDLLPLVEGTTVATKYGPVKTDHILFIASGAFHVSK
HSLU_CAUVC      IDKVASS--SQRSGA-DVSREGVQRDLLPLIEGTTVSTKYGPVKTDHILFIASGAFHVAK
HSLU_RICCN      IDKIASTGSSGAKNA-EISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAK
HSLU_RICPR      IDKIASTSNAGAKNA-EISREGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAK
HSLU_BUCAI      IDKICRR--GDSSGP-DISREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQTST
HSLU_BUCAP      IDKICKR--RDSSGP-DVSREGVQRDLLPLVEGCTVSTKYGMVKTDHILFIASGAFQTST
HSLU_SALTI      IDKICKR--GETSGP-DVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVAK
HSLU_SALTY      IDKICKR--GETSGP-DVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVAK
HSLU_ECOLI      IDKICKR--GESSGP-DVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAK
HSLU_YERPE      IDKICKR--GQTSGP-DVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVSS
HSLU_HAEIN      IDKICKK--GEYSGA-DVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVAR
HSLU_PASMU      IDKICKK--GEYSGA-DVSREGVQRDLLPLVEGTTVSTKHGMVKTDHILFIASGAFQVAR
HSLU_MANHA      IDKICKK--GEHSGG-DVSREGVQRDLLPIIEGSTVNTKHGMVKTDHILFICSGAFQVAR
HSLU_VIBCH      IDKICKR--GEVSGP-DVSREGVQRDLLPLIEGSTVSTKHGMVRTDHILFIASGAFQVAK
HSLU_PSEAE      IDKIAKR--ANAGGA-DVSREGVQRDLLPLIEGCTVNTKLGMVKTDHILFIASGAFHLSK
HSLU_RALSO      IDKITSR--SEHGGG-EVSRQGVQRDLLPLVEGTTVSTKYGMIKTDHILFIASGAFQLSK
HSLU_XYLFA      IDKVVKR--GDTVGGGDVSREGVQRDLLPLVEGSNVSTKYGTIRTNHILFIASGAFHLTK
HSLU_AQUAE      IDKIAVK--TPGAGP-GVSREGVQRDLLPILEGTTVNTKYGPVKTDHILFIGAGAFHMAK
HSLU_CALS4      IDKIAST--GYSAGP-DVSREGVQRDLLPIIEGCTVMTKYGPVKTDYILFIAAGAFNVAK
HSLU_THEMA      IDKIAGK--ESAVGP-DVSRQGVQRDLLPIVEGTTIMTKYGPVRTDFILFIAAGAFHVSR
HSLU_HALH5      IDKIAGK--G--QQSADVSREGVQRDILPIVEGSTVVTKYGPVSTDHMLFIGAGAFHVAK
CLPY_BACSU      IDKIAKN--GGASSSADVSREGVQRDILPIVEGSTVVTKYGSVKTDHVLFIAAGAFHMAK
HSLU_LISIN      IDKIASK--EG-GGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSK
HSLU_LISMO      IDKIASK--EG-GGNAQVSREGVQRDILPIVEGSQISTKYGTVNTEYILFIAAGAFHMSK
HSLU_STAAM      IDKVATN--NH-NSGQDVSRQGVQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSK
HSLU_LACLE      IDKITAA--DK-RNSAGVSREGVQRDILPIVEGSTVSTKYGPLSTDHILFIAAGAFAESK
HSLU_HELPY      IDKIAVS--SKEGSRQDPSKEGVQRDLLPIVEGSVVNTKYGSIKTEHILFIAAGAFHLSK
HSLU_HELPJ      IDKIAVS--SKEGSRQDPSKEGVQRDLLPIVEGSVVNTKYGSIKTEHILFIAAGAFHLSK
HSLU_CAMJE      IDKIAVS--SGNSNRQDPSKEGVQRDLLPIVEGSNVQTKIGTLKTDHILFIAAGAFHLSK
HSLU_BORBU      IDKIAAK---NRSGN-DVSREGVQRDILPIIEGSKVNTKYGIVDTSHILFIAAGAFNLAK
                ***:              *::*****:**::**  : ** * : *..:*** :***  : 

HSLU_AGRFC      PSDLLPELQGRLPIRVELKPLTKEDFRRILTETEASLIRQYKALMATEELDLDFTDDAID
HSLU_RHIME      PSDLLPELQGRLPIRVELRALTKEDFRRILTETEASLIRQYKALLETEGVALDFTEDAID
HSLU_BRUME      PSDLLPELQGRLPIRVELSALTREDFRRILTETEASLIKQYIALMETEEVKLEFSDDAID
HSLU_RHILO      PSDLLPELQGRLPIRVELRALEKQDFVRILTETEASLIKQYIALMKTEGVDLTFTDDAID
HSLU_CAUVC      PSDLLPELQGRLPIRVELKGLSRDDMRRILTEPEANLIRQHQALMATEEVTLVFTDEAID
HSLU_RICCN      PSDLLPELQGRLPIRVELNSLTKDDMIKILLEPETSLIKQYSALIGTEDVHLEFAASAIE
HSLU_RICPR      PSDLLPELQGRLPIRVELNLLTKDDMIKILLEPETSLIKQYSALIGTEEVHLEFTDAAIE
HSLU_BUCAI      PSDLIPELQGRLPIKVELQALTIDDFEKILTEPTASITAQYKALMETEGVYINFTKEGIR
HSLU_BUCAP      PSDLIPELQGRLPIKVELQPLTINDFEKILTEPTASITAQYKALMKTEGVCINFTKEGIR
HSLU_SALTI      PSDLIPELQGRLPIRVELQALTTSDFERILTEPNASVTVQYKALMATEGVNIEFTDSGIK
HSLU_SALTY      PSDLIPELQGRLPIRVELQALTTSDFERILTEPNASVTVQYKALMATEGVNIEFTDSGIK
HSLU_ECOLI      PSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMATEGVNIEFTDSGIK
HSLU_YERPE      PSDLIPELQGRLPIRVELQALTTDDFERILTEPSASLTEQYKALMATEGVTIEFTREGIR
HSLU_HAEIN      PSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVK
HSLU_PASMU      PSDLIPELQGRLPIRVELSALSAVDFERILTEPNASLTEQYKALMATEGVNIEFTGESIK
HSLU_MANHA      PSDLLPELQGRLPIRVELKSLTKEDFERILTEPNASLTLQYRELMKTEGVEIEFTKDGIS
HSLU_VIBCH      PSDLIPELQGRLPIRVELEALSSNDFKRILTEPKASLTEQYVALMKTEQVDVQFTEDGIK
HSLU_PSEAE      PSDLVPELQGRLPIRVELKALSPNDFERILTEPHASLTEQYRELLKTEGLAIEFAEDGIK
HSLU_RALSO      PSDLIPELQGRFPIRVELDSLSVDDFQAILTQTDASLTKQYQALMKTEDVELVFADDGIR
HSLU_XYLFA      PSDLIPELQGRFPIRVELDALSKADFIRILTEPKAALTKQYQELLKTEGVSLDFTEDAID
HSLU_AQUAE      PSDLIPELQGRFPIRVELKPLTKEDFKRILVEPENALTKQYIELLKTENVYLEFTDDAIE
HSLU_CALS4      VSDLIPELQGRFPIRVNLKPLTKEDFVRILKEPKNALTKQYQELLRTEGVEIKYTEEAIE
HSLU_THEMA      PSDLIPELQGRFPIRVELSPLTEEDFVRILKEPENAIIKQYQALLSTEGVELVFTEDGIR
HSLU_HALH5      PSDLIPELQGRFPIRVELSNLTVDDFVRILVEPDNALLKQYAALLETEGIKIVFTDEAVH
CLPY_BACSU      PSDLIPELQGRFPIRVELNKLTVDDFVRILVEPDNALLKQYQALLQTEGISLEFSDEAIH
HSLU_LISIN      PSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVE
HSLU_LISMO      PSDLIPELQGRFPIRIELDKLTQEDFYKILTEPDNALIKQYKALLKTEGIDLIFTKEAVE
HSLU_STAAM      PSDLIPELQGRFPIRVELDSLSVEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAIT
HSLU_LACLE      PSDLIPELQGRFPIRVELDALTKDDFVRILKDPQNSLLKQYIALLKADGVDLVFTAEAVD
HSLU_HELPY      PSDLIPELQGRFPLRVELENLTEEIMYMILTQTKTSIIKQYQALLKVEGVEIAFEDDAIK
HSLU_HELPJ      PSDLIPELQGRFPLRVELENLTEEIMYMILTQTKTSIIKQYQALLKVEGVEIAFEDDAIK
HSLU_CAMJE      PSDLIPELQGRFPLRVELDSLDDKALYEILTRPKNSLLKQYSQLLKTENLELEFDDEAIK
HSLU_BORBU      PSDLIPELQGRFPIKVELKSLSIDDLKKILKQTKNSLIKQYVAMFKVYDLDLKFSEEAID
                 ***:******:*::::*  *    :  **  .   :  *:  :: .  : : :   .: 

HSLU_AGRFC      ALADVAVHLNSSVENIGARRLQTVMERVLDEISFNAPDRGGSA----VKIDQEYVKKHVG
HSLU_RHIME      ALAEVAVQLNANVENIGARRLQTVMERVLDDVSFNAPDRGGQG----VTIDAEYVRRHVG
HSLU_BRUME      ALADIAVDLNATVENIGARRLQTVMEKVLDEISFTAPDKAGAT----FIIDAAYVKEKIG
HSLU_RHILO      SLAGIAVDLNDSVENIGARRLQTVMERVLDEISYDAPDRNGTS----VTIDAAYVEKHVG
HSLU_CAUVC      ALADAAVAVNGSVENIGARRLQTVMEKVVEEISFTAADRGGET----VTIDAAYVQERVG
HSLU_RICCN      KIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKGKK----ITIDDKFVENQLS
HSLU_RICPR      KIADYAITVNLEVEDIGARRLHTILENLLEDISFEASEMKVKK----IIIDDKFVENQLS
HSLU_BUCAI      NIAEAAWKVNESIENIGARRLHTVLEKLMEDISFNASDNKGNT----IEINSNYVEEHLD
HSLU_BUCAP      NIAEAAWKVNESMENIGARRLHTILEKLMEDISFNACDNVGKT----IEINSEYVGKHLD
HSLU_SALTI      RIAEAAWQVNETTENIGARRLHTVLERLMEEISYNASDLHGQN----ITIDAEYVSKHLD
HSLU_SALTY      RIAEAAWQVNETTENIGARRLHTVLERLMEEISYNASDLHGQN----ITIDAEYVSKHLD
HSLU_ECOLI      RIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQN----ITIDADYVSKHLD
HSLU_YERPE      KIAEAAWQVNERTENIGARRLHTVLERLMEDISYDASESSGQS----ITIDAEYVGKHLD
HSLU_HAEIN      KIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQT----VNIDAAYVADALG
HSLU_PASMU      KIAEAAFRVNEKTENIGARRLHTVMERLMDKISFNASDMQGQV----VRIDEAYVMDALG
HSLU_MANHA      RIAESAFRVNEKTENIGARRLHTVLERLMDGISFDASERRGEK----IIIDENYVSEALN
HSLU_VIBCH      QIADAAWQVNETTENIGARRLHTVLERLMDEISFDATEKAGQA----FVIDAAYVKARLG
HSLU_PSEAE      RLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAADLASEHSDKPILIDAGYVNSHLG
HSLU_RALSO      RLAEIAFSVNEKVENIGARRLYTVMERLLEDLSFHAHKSSGET----VTIDAAYVDSRLN
HSLU_XYLFA      RIAEIAYLVNERQENIGARRLHTVLERLLEMLSYESPDRDGES----VTVDADYVNAHLG
HSLU_AQUAE      EIARIAEEINTKTENIGARRLHTVMEKLLEDISFNAPEMAGQT----IIIDAKFVKAKLE
HSLU_CALS4      TIAEVAYLINQQSEDIGARRLHTVMEKLFEDLSFHAPELSGQE----IVITADYVKEQLK
HSLU_THEMA      EMARIAYQLNQRLENIGARRLYTVAEKVLEEISFEAPDIPEKR----VVVDAEYVRRRLE
HSLU_HALH5      KIATIATEVNQETENIGARRLHTLLERLLEDLSFEAPDVNLEE----IVITPEYVTEKLA
CLPY_BACSU      KIAEVAYHVNQDTDNIGARRLHTILERLLEDLSFEAPDVTMEK----ITITPQYVEEKLG
HSLU_LISIN      RIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMES----IKVTENYVNEKLA
HSLU_LISMO      RIAEIAFQVNQDSDNIGARRLHTILEKLLEDLLFEAPEINMES----IKVTENYVNEKLA
HSLU_STAAM      RLAEIAYQVNQDTDNIGARRLHTILEKMLEDLSFEAPSMPNAV----VDITPQYVDDKLK
HSLU_LACLE      KIAEIAFEVNQGTDNIGARRLATILEKLLEEVLYEGPDMEMGQ----ITITQAYVEQKLS
HSLU_HELPY      ELAKLSYNANQKSEDIGARRLHTTIEKVLEDISFEAEDYSGQN----VTITKELVQSKLE
HSLU_HELPJ      ELAKLSYNANQKSEDIGARRLHTTIEKVLEDISFEAEDYSGQS----VTITKELVQSKLG
HSLU_CAMJE      EIAKIASRANEEMQDIGARRLHTVIEKLLEDLSFEADEYAGKK----FVVDKKMVEEKLG
HSLU_BORBU      RIAELTFNMNLESENLGARRLHGVMEIVLADLFFEVPGSKLKK----FEINLDYVNKKI-
                 :*  :   *   :::*****    * :.  : :             . :    *   : 

HSLU_AGRFC      DLAADTDLSRYIL
HSLU_RHIME      DLAANTDLSRYIL
HSLU_BRUME      GLAKNTDLSRFIL
HSLU_RHILO      DLSRNTDLSRFIL
HSLU_CAUVC      ALAANADLSRFIL
HSLU_RICCN      KIITNLDLAKFVL
HSLU_RICPR      KIITNLDLAKFVL
HSLU_BUCAI      QLTSNEDLGRFIL
HSLU_BUCAP      QLISNEDLGRFIL
HSLU_SALTI      ALVADEDLSRFIL
HSLU_SALTY      ALVADEDLSRFIL
HSLU_ECOLI      ALVADEDLSRFIL
HSLU_YERPE      ELVADEDLSRFIL
HSLU_HAEIN      EVVENEDLSRFIL
HSLU_PASMU      DVVENEDLSRFIL
HSLU_MANHA      DVVENEDLSRFIL
HSLU_VIBCH      ELVEDEDLSRFIL
HSLU_PSEAE      ELAEDEDLSRYIL
HSLU_RALSO      ELAGSEDLSRYVL
HSLU_XYLFA      ELVKDPDLSRYIL
HSLU_AQUAE      NLVKDEELSRYIL
HSLU_CALS4      DSLNKYEVNKYIL
HSLU_THEMA      KIVQDEDLSAYIL
HSLU_HALH5      AIAKNRDLSQYIL
CLPY_BACSU      TIAKNKDLSQFIL
HSLU_LISIN      PIMTNKDLTQFIL
HSLU_LISMO      PIMQNKDLTQFIL
HSLU_STAAM      SISTNKDLSAFIL
HSLU_LACLE      DIVKNKDLTKFIL
HSLU_HELPY      DLVADENLVKYIL
HSLU_HELPJ      DLVADENLVKYIL
HSLU_CAMJE      DIIENKDLARYIL
HSLU_BORBU      QINEQKDLNYYII
                    . ::  :::