CLUSTAL format seed alignment for MF_00253_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYG_BACC1       ------------MYSMEQVVNLAKHRGFVFPGSEIYGGLANTWDYGPLGIELKNNVKKAW
SYG_BACCZ       ------------MYSMEQVVNLAKHRGFVFPGSEIYGGLANTWDYGPLGIELKNNVKKAW
SYG_BACAN       ------------MYSMEQVVNLAKHRGFVFPGSEIYGGLANTWDYGPLGIELKNNVKKAW
SYG_BACHK       ------------MYSMEQVVNLAKHRGFVFPGSEIYGGLANTWDYGPLGIELKNNVKKAW
SYG_STAAM       -----------MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAW
SYG_STAAN       -----------MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAW
SYG_STAAR       -----------MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAW
SYG_STAAS       -----------MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAW
SYG_STAAW       -----------MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAW
SYG_STAES       -----------MVKNMDTIVQLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNIKKAW
SYG_CLOPE       ---------MAVEKTMDKIVALCKNRGFIFPGSEIYGGLANSWDYGPLGVEFKNNVKRAW
SYG_CLOTE       ---------MTVEKTMDKIVALAKNRGFIFPGSEIYGGLANSWDYGPLGVEFKNNVKKAW
SYG_CLOAB       ---------MKDEKTMDKIVSLAKNRGFVFAGSEIYGGLANSWDYGPLGVELKNNVKKLW
SYG_CALS4       ---------MPVKVTMDKIVALAKNRGFVFPGSEIYGGLANTWDYGPLGVEMKNNIKRIW
SYG_LEPIC       -----MEKKESLDSSLKEIVSVCKRRGFVYPGSEIYGGLSNTFDYGPYGVELLQNLKQLW
SYG_LEPIN       -----MEKKESLDSSLKEIVSVCKRRGFVYPGSEIYGGLSNTFDYGPYGVELLQNLKQLW
SYG_BDEBA       -------MKIKHLEDLNTLVSLSKRRGFVFQSSEIYGGLGSCWDYGPLGSLMKLNVKRAW
SYG_CHLTE       ---------------MNKLVSLAKRRGFIFPSSEIYGGLSSCFDYGPLGSEMKKNIKDLW
SYG_BORBU       ------------MVRMEDIISLAKRKGFVFQSSEVYGGLSGAWDYGPLGVELKKNIKKEW
SYG_BORBP       ------------MVRMEDIISLAKRKGFVFQSSEVYGGLSGAWDYGPLGVELKKNIKSEW
SYG_TREDE       --------MEDHKISMEKIVSLCKRRGFVFQSSEIYGGQNGAWDYGPLGIELKNNVSRAW
SYG_TREPA       ---------------MEKIVGLCKRRGFVFPSSEIYGGQGGVWDYGPMGIALKNNIAHAW
SYG_COREF       ---------MAQQSIIDTVVNLCKRRGLVYPCGEIYGGTRSAWDYGPLGVELKENIKRQW
SYG_CORGL       ---------MAQQSIIDTVVNLCKRRGLVYPCGEIYGGTRSAWDYGPLGVELKENIKRQW
SYG_NOCFA       ----MEKSRVAPKSKVDTVANLAKRRGLVYPCGEIYGGTKSAWDYGPLGVELKENIKRQW
SYG_MYCBO       -------MHHPVAPVIDTVVNLAKRRGFVYPSGEIYGGTKSAWDYGPLGVELKENIKRQW
SYG_MYCTU       -------MHHPVAPVIDTVVNLAKRRGFVYPSGEIYGGTKSAWDYGPLGVELKENIKRQW
SYG_MYCPA       -------MHRLVASVIDTVVNLAKRRGFVYPSGEIYGGTRSAWDYGPLGVEFKENIKRQW
SYG_CUTAK       MRTWKKGTAVASTSTLDNVINLCKRRGFVFPCGEIYGGTRAAWDYGPFGVELKENIKRQW
SYG_BIFLO       ----------MAQSKLDEVVSLAKRRGFVFPAGEIYGGTRSAWDYGPLGVALKDNIKREW
SYG_STRAW       ----------MAADKIDTIVSLSKRRGFVFPCSEIYGGQKAAWDYGPLGVELKENIKRQW
SYG_STRCO       ----------MAADKIDTIVSLSKRRGFVFPCSEIYGGQRAAWDYGPLGVELKENLKRQW
SYG_THET2       ----------MPASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAW
SYG_THET8       ----------MPASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAW
SYG_DEIRA       ----------MPATSMEELVSLCKRRGFIFQGSEIYGGLQGFYDYGPLGVELKNNIKAAW
SYG_MESFL       ---------------MEKLIAHLKSQGFIFQGSEIYGGLANSWDYGPLGVEVKNKLKQAW
SYG_MYCMS       -----------MSKSIEKMISHLKNQGFVFQGSEIYGGLANSWDYGPLGCEVKNKLKKVW
SYG_MYCGA       -----------MELKQDQIVNFLKNYGFVYQSSEIYNGLANSWDYGPLGALLKNNIKQLL
SYG_MYCPE       ---------MSKKIDQETIVNHFKNYGFVYQNSEIYNGLANAWDFGPLGSLIKNNLKNLW
SYG_MYCGE       ---------MAKVYNQEVYVQFLKQHGFVFQSSEIYNGLNNSWDFGPLGAVLKQQIKQAL
SYG_MYCPN       ---------MAQVYSQEVYVQYLKRYGFVFQSSELYNGLANSWDFGPLGAVLKQQIKTAL
SYG_UREPA       --------MRYKFKTQEDLVNHLKSVGFVFANSEIYNGLANAWDYGPLGVLLKNNLKNLW
                                .      *  *:::  .::*.*    :*:** *  .  ::    

SYG_BACC1       WKKFIQESPYNVGLDAAILMNPKTWIASGHVGNFNDPMIDCKKCKARHRADKLIEDAL-D
SYG_BACCZ       WKKFIQESPYNVGLDAAILMNPKTWIASGHVGNFNDPMIDCKKCKARHRADKLIEDAL-D
SYG_BACAN       WKKFIQESPYNVGLDAAILMNPKTWIASGHVGNFNDPMIDCKKCKARHRADKLIEDAL-D
SYG_BACHK       WKKFIQESPYNVGLDAAILMNPKTWIASGHVGNFNDPMIDCKKCKARHRADKLIEDAL-D
SYG_STAAM       WQKFITQSPFNVGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQD
SYG_STAAN       WQKFITQSPFNVGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQD
SYG_STAAR       WQKFITQSPFNVGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQD
SYG_STAAS       WQKFITQSPFNVGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQD
SYG_STAAW       WQKFITQSPFNVGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQD
SYG_STAES       WQKFITQSPYNVGIDAAILMNPKTWEASGHLGNFNDPMIDNKDSKIRYRADKLIEDYMQN
SYG_CLOPE       WKKFVQESKYNVGLDSAILMNREVWVASGHVGGFSDPLMDCKECKARFRADKLVEDHM-T
SYG_CLOTE       WKKFVQESPYNVGIDAAILMNREVWVASGHVGGFSDPLMDCKECKARCRADKLIEDYM-Q
SYG_CLOAB       WKKFVQDNTYNVGLDCAILMNSEVWVASGHLGGFSDPLMDCKECKSRFRADKIVEDYL-T
SYG_CALS4       WKKFIQESPYNVGIDSAILMNREVWVASGHVASFSDPLMDCKECKSRFRADQLIEDYI-K
SYG_LEPIC       WKYFVHLREDIVGLDSSILLNPKVWEASGHVSNFNDPLIDCKNCKTRIRADKFLEDQKGE
SYG_LEPIN       WKYFVHLREDIVGLDSSILLNPKVWEASGHVSNFNDPLIDCKNCKTRIRADKFLEDQKGE
SYG_BDEBA       WNAMTRR-PDIVGLDAAILMHPMVWKASGHVDGFSDPLVDCKECKTRFRADNTDSYINEK
SYG_CHLTE       WNAMTRRHQNIVGIDASIMMNPTVWEASGHVASFNDPMIDDKTTKRRYRADHLIENHIEK
SYG_BORBU       WKSMVYLHENIVGLDSAIFMRPEIWRASGHVDGFSDSMVDCKDCKSRFRADFIDLS----
SYG_BORBP       WKSMVYLHENIVGLDSAIFMRPEIWRASGHIDGFSDSMVDCKDCKSRFRADFIDLS----
SYG_TREDE       WKEMTQLHDNIVGLDAAILMHPRTWEASGHVENFTDPLVDCKKCKSRFRADHLPPENLEK
SYG_TREPA       WQDMTRLHDHIVGLDAAILMHPNVWRTSGHVDHFSDPLVDCTVCKSRFRADQVAVP-SAG
SYG_COREF       WRTMVTSRPDVVGVDTSVILPRQVWVTSGHVEVFTDPLVESLHTHKRYRADHLLEAYEE-
SYG_CORGL       WRSMVTSRPDVVGVDTSVILPRQVWVTSGHVEVFTDPLVESLNTHKRYRADHLLEQYEE-
SYG_NOCFA       WRSMVTSREDVVGLDSSVILPRQVWEASGHVATFTDPLVESLITHKRYRADHLLEAYEE-
SYG_MYCBO       WRSVVTGRDDVVGIDSSIILPREVWVASGHVDVFHDPLVESLITHKRYRADHLIEAYEA-
SYG_MYCTU       WRSVVTGRDDVVGIDSSIILPREVWVASGHVDVFHDPLVESLITHKRYRADHLIEAYEA-
SYG_MYCPA       WRSVVTGREDVVGLDSSIILPRQVWVASGHVEVFHDPLVESLITHKRYRADHLIEAYEA-
SYG_CUTAK       WRAMVTRRDDVVGLDSSVILPREVWVASGHVGVFNDPLTECLSCHKRMRADHLQEGHAA-
SYG_BIFLO       WRSMVVTRPDVVGVDTSIILPPEVWVASGHVSVFNDPLVECLNCHKRNRADKLEESYAE-
SYG_STRAW       WRYMVTSREDVVGIDSSVILATEVWVASGHVATFSDPLTECTSCHKRYRADHLEEAYEA-
SYG_STRCO       WRYMVTSREDVVGLDSSVILAPEVWVASGHVATFTDPLTECTSCHKRFRADHLEEAYEE-
SYG_THET2       WRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKRYRLDHLLKEQPEE
SYG_THET8       WRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKRYRLDHLLKEQPEE
SYG_DEIRA       WRSNVYERDDMEGLDASIIMHRMVLRHSGHEATFSDPMIDNKKNNKRYRLDHLLKDQKAD
SYG_MESFL       WNHFVRKNPYNIGLDSSIILNSSVWKASGHIDGFNDPLIDCKKCNSRWRADKLIEEFNSE
SYG_MYCMS       WDFFVKKNPLNVGLDSSIILNSKVWKASGHIDGFNDPLIDCKNCKSRWRADKLIEEFDSS
SYG_MYCGA       LKHFVFSQPDMKLLDSSIILNPLVWQASGHLDNFSDPLVDCKKCKSRYRADKLIEELNDD
SYG_MYCPE       LKHFIYSKKEMHLIDTNIILNPLVWKASGHIDNFSDPLIDCKECKSRFRADKLILENTKE
SYG_MYCGE       YNFFIKNKADVLLVETPIILSELVWKASGHLANFVDTLVDCKSCKYRFRVDQINAEIKAK
SYG_MYCPN       YNFFIKNKRDVLLIDTPIILNEQIWKASGHLANFTDALVDCKSCKLRFRVDHLDEQIKSA
SYG_UREPA       WKEFVTKQKNIVGLDSAIILNPLVWKASGHLDNFSDPLIDCKSCKTRYRADKLIESFNKD
                             ::  ::        ***   * *.: :    : * * *         

SYG_BACC1       AKGIE--------------MVVDGLTFDQMADLMKEHEVKCPDCG-SEEFTEIRQFNLMF
SYG_BACCZ       AKGIE--------------MVVDGLTFDQMADLMKEHEVKCPDCG-SEEFTEIRQFNLMF
SYG_BACAN       AKGIE--------------MVVDGLTFDQMADLMKEHEVKCPDCG-SEEFTEIRQFNLMF
SYG_BACHK       AKGIE--------------MVVDGLTFDQMADLMKEHEVKCPDCS-SEEFTEIRQFNLMF
SYG_STAAM       VKGDEN-------------FIADGLSFEQMKKIIDDEGIVCPVSK-TANWTEIRQFNLMF
SYG_STAAN       VKGDEN-------------FIADGLSFEQMKKIIDDEGIVCPVSK-TANWTEIRQFNLMF
SYG_STAAR       VKGDEN-------------FIADGLSFEQMKKIIDDEGIVCPVSK-TANWTEIRQFNLMF
SYG_STAAS       VKGDEN-------------FIADGLSFEQMKKIIDDEGIVCPVSK-TANWTEIRQFNLMF
SYG_STAAW       VKGDEN-------------FIADGLSFEQMKKIIDDEGIVCPVSK-TANWTEIRQFNLMF
SYG_STAES       EKGDEN-------------FIADGLSFDEMKKIIDDEGIVCPVSK-TANWTDIRQFNLMF
SYG_CLOPE       ANGAEV-------------ATADGWSNEELMDYITKNNIVCPKCG-KLNYTDIRKFNLMF
SYG_CLOTE       DKDENF-------------ESADGWSNEQLKDFIDKNNIACPKCG-EHNFTDVRKFNLMF
SYG_CLOAB       EQGAEV-------------ASADGWSNEKLENFIKDKHIKCPKCG-KENFTSIRKFNLMF
SYG_CALS4       EKGLDI--------------SIEGWTNEQMMEFIKEHKVPCPKCG-AHNFTEIRKFNLMF
SYG_LEPIC       -------------------GFATGLTLEKMNQVIKESNFACPNCGQRGTFTEARDFNLMF
SYG_LEPIN       -------------------GFATGLTLEKMNQVIKESNFACPNCGQRGTFTEARDFNLMF
SYG_BDEBA       ---------------------------------------KCPNCG-SKNLSEERSFNLMF
SYG_CHLTE       LHRDGKEAEAAAIKVAYEAAGGTEDPNRTLYNIIIEAGIKAPDTG-SADWTEVRQFNLMF
SYG_BORBU       --------------------------------------KNCPNCKVGNNFTSPRSFNLMF
SYG_BORBP       --------------------------------------KNCPNCKVGNNFTSPRSFNLMF
SYG_TREDE       --------------------------------------RVCPDC--GGELTDTRKFNLMF
SYG_TREPA       --------------------------------------GPCPQC--GGALTGVRNFNLMF
SYG_COREF       ------------------------KHGHPPAN--GLADINDPETGQPGKWTEPKAFSGLL
SYG_CORGL       ------------------------KHGHPPVN--GLADINDPETGQPGNWTEPKAFSGLL
SYG_NOCFA       ------------------------KHGHPPAN--GLADIRDPETGEPGRWTEPRNFSGLL
SYG_MYCBO       ------------------------KHGHPPPN--GLADIRDPETGEPGQWTQPREFNMML
SYG_MYCTU       ------------------------KHGHPPPN--GLADIRDPETGEPGQWTQPREFNMML
SYG_MYCPA       ------------------------KHGHPPPN--GLADIRDPDTGEPGRWTEPREFNMML
SYG_CUTAK       ------------------------KHGIADPDSISLEEVNCPNCGNKGQWTEPRDFNMML
SYG_BIFLO       ------------------------KHGDKMPEN-GMKDIVCPNCGIRGQWTEPRDFNMML
SYG_STRAW       ------------------------KHNRSPEN--GLADINCPNCGNKGQFTEPKQFSGLL
SYG_STRCO       ------------------------KKGHAPEN--GLADLNCPNCGNKGTFTEPKQFSGLL
SYG_THET2       VLKRLYRAMEVEEGNLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPPRYFNMMF
SYG_THET8       VLKRLYRAMEVEEENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPPRYFNMMF
SYG_DEIRA       VQAKVAEIMGESADNFAALVAALNAKPAQASAAFKEAGVRDPFSGEVGEWTDPKPFNMMF
SYG_MESFL       -------------------INAGVMTENQMEEFIREQNIKCPKCQ-ACDFTQIRKFALMF
SYG_MYCMS       -------------------INTGIMTSAQLEDYINQNNILCKKCQ-KKDFTQIRQFALMF
SYG_MYCGA       S-----------------IKITENTDPSYLEQILVDKKVECKKCE-STNWTKIRKFNLMF
SYG_MYCPE       -------------------EINEQTDSDTLIKIISDNKIKCPNCK-KSNWTEIRKFNLMF
SYG_MYCGE       -------------------------------KDWNSFKVNCPNCH-NQNWSEVRDFNLLF
SYG_MYCPN       -------------------------------TQWNPKQVNCPNCK-ANNWSEVRDFNLLF
SYG_UREPA       ------------------IHIAENSTNEEFMKVLNDHKIFCPTCK-QFNWTDIRHFNLMF
                                                                  :  : *  ::

SYG_BACC1       KTFQGVTESSTNEIFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFT
SYG_BACCZ       KTFQGVTESSTNEIFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFT
SYG_BACAN       KTFQGVTESSTNEIFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFT
SYG_BACHK       KTFQGVTESSTNEIFLRPETAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFT
SYG_STAAM       KTFQGVTEDSTNEIFLRPETAQGIFVNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFI
SYG_STAAN       KTFQGVTEDSTNEIFLRPETAQGIFVNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFI
SYG_STAAR       KTFQGVTEDSTNEIFLRPETAQGIFVNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFI
SYG_STAAS       KTFQGVTEDSTNEIFLRPETAQGIFVNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFI
SYG_STAAW       KTFQGVTEDSTNEIFLRPETAQGIFVNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFI
SYG_STAES       KTFQGVTEDSTNELFLRPETAQGIFVNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFI
SYG_CLOPE       KTFQGITEDSKNEVYLRPETAQGIFVNFKSVQRTTRKKVPFGIAQIGKSFRNEITPGNFT
SYG_CLOTE       KTFQGVTEDAQSEIFLRPETAQGIFVNFKNAIRTTRRKMPFGMAQIGKSFRNEITPGNFT
SYG_CLOAB       KTFQGVTEDASSEIYLRPETAQGIFVNFKNVQRSSRKKVPFGIGQIGKAFRNEITPGNFT
SYG_CALS4       KTYVGVTEDSKSEVFLRPETAQGIFVNFKNVQRTSRKKIPFGIGQIGKSFRNEITPGNFI
SYG_LEPIC       KTSHGASAEDSLDIYLRPETAQGIFLNFKNVVSTTRRKIPFGIAQIGKSFRNEIMARQFV
SYG_LEPIN       KTSHGASAEDSLDIYLRPETAQGIFLNFKNVVSTTRRKIPFGIAQIGKSFRNEIMARQFV
SYG_BDEBA       KTHMGPLEDSGSVVYLRPETAQGHFVNFQNCQQASRYKIPFGIAAIGKSFRNEITPGNFI
SYG_CHLTE       QCNMGAVADSAGVVYLRPETAQGIFVNFHNVREASRMKVPFGIAQIGKAFRNEIVKGNFI
SYG_BORBU       KTHIGVVEDSSSEVYLRPETAQGIFVNFRNVLDSSRLKIPFGIAQVGKAFRNEIVTKNFI
SYG_BORBP       KTHIGVVEDSSSEIYLRPETAQGIFVNFRNVLDSSRLKIPFGIAQVGKAFRNEIVTKNFI
SYG_TREDE       KTHIGPTDDNSSVIYLRPETAQGIYVNYKNIIQSNRMKIPFGIAQIGKAFRNEIVTKNFI
SYG_TREPA       STHMGPTDERASLLYLRPETAQGIYVNYKNVLQTTRLKVPFGIAQIGKAFRNEIVTKNFI
SYG_COREF       KTFLGPVDDEEGLHYLRPETAQGIFVNFKNVMNSSRMKPPFGIANIGKSFRNEITPGNFI
SYG_CORGL       KTFLGPVDDEEGLHYLRPETAQGIFVNFKNVMNTSRMKPPFGIANIGKSFRNEITPGNFI
SYG_NOCFA       KTFLGPVDDEEGLHYLRPETAQGIFINYKNVETTARKKPPFGIAQIGKSFRNEITPGNFI
SYG_MYCBO       KTYLGPIETEEGLHYLRPETAQGIFVNFANVVTTARKKPPFGIGQIGKSFRNEITPGNFI
SYG_MYCTU       KTYLGPIETEEGLHYLRPETAQGIFVNFANVVTTARKKPPFGIGQIGKSFRNEITPGNFI
SYG_MYCPA       KTYLGPIETEEGLHYLRPETAQGIFVNFANVVTTARKKPPFGIGQIGKSFRNEITPGNFI
SYG_CUTAK       KTYLGPVEDKSGLHYLRPETAQGIFVNFQNVLTSARKKPPFGIAQTGKSFRNEITPGNFI
SYG_BIFLO       RTHLGPVEDENSLHYLRPETAQGIFVDFKNVMTSSRSRPPFGIANMGKSFRNEITPGNFI
SYG_STRAW       STHLGPTQDSGSVAYLRPETAQGIFTNFAQVQQTSRRKPPFGIAQMGKSFRNEITPGNFI
SYG_STRCO       STHLGPTQDSGSVAYLRPETAQGIFTNFAQVQTTSRRKPPFGIAQMGKSFRNEITPGNFI
SYG_THET2       KTYVGPVEDEAALAYLRPETAQGIFVNFKNVLDATSRKLPFGIAQIGKAFRNEITPRNFI
SYG_THET8       KTYVGPVEDEASLAYLRPETAQGIFVNFKNVLDATSRKLPFGIAQIGKAFRNEITPRNFI
SYG_DEIRA       RTTIGPVADEESYGYLRPETAQGIFTNFKNVVDSTSRRLPFGIAQIGKAFRNEITPRNFI
SYG_MESFL       KTNQGVLEDESSSVYLRPETAQGIFINFKNAQRSLRKKLPFGIGQIGKSFRNEITPGNFI
SYG_MYCMS       KTNQGVLEDDSSIVYLRPETAQGIFINFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFI
SYG_MYCGA       KTFQGVVEDSLNTIYLRPETAQGIFINFKNIVRTQRMKLPFGVAQIGKAFRNEITPGNFI
SYG_MYCPE       DTSIGVVDDKKDLVYLRPETAQGIFINFKNIQRTQRQKLPFGVGQIGKAFRNEITPGNFI
SYG_MYCGE       QTEIGVVNNDKRLVFLRPETAQGSFINFKNILQAKKRNLPFAIAQFGKSFRNEITPGNFL
SYG_MYCPN       QTEIGVVNSEKRLVYLRPETAQGIFINFKQLLQLKKRPLPFGVAQFGKSFRNEVTPGNFL
SYG_UREPA       KTHQGVIEDPKNIVYLRPETAQGIFVNFKNVQRSMRLHLPFGIAQIGKSFRNEITPGNFI
                    *         :******** : :: .         **.:.  **:****:   :* 

SYG_BACC1       FRTREFEQMELEFFCKPGEDLEWFAFWRETCKNWLLS-LGMTEESMRLRDHGEEELSHYS
SYG_BACCZ       FRTREFEQMELEFFCKPGEDLEWFAFWRETCKNWLLS-LGMTEESMRLRDHGEEELSHYS
SYG_BACAN       FRTREFEQMELEFFCKPGEDLEWFAFWRETCKNWLLS-LGMTEESMRLRDHGEEELSHYS
SYG_BACHK       FRTREFEQMELEFFCKPGEDLEWFAFWRETCKNWLLS-LGMTEESMRLRDHGEEELSHYS
SYG_STAAM       FRTREFEQMELEFFCKPGEEIEWQNYWKTFASDWLTS-LNMSSENMRLRDHDEDELSHYS
SYG_STAAN       FRTREFEQMELEFFCKPGEEIEWQNYWKTFASDWLTS-LNMSSENMRLRDHDEDELSHYS
SYG_STAAR       FRTREFEQMELEFFCKPGEEIEWQNYWKTFASDWLTS-LNMSSENMRLRDHDEDELSHYS
SYG_STAAS       FRTREFEQMELEFFCKPGEEIEWQNYWKTFASDWLTS-LNMSSENMRLRDHDEDELSHYS
SYG_STAAW       FRTREFEQMELEFFCKPGEEIEWQNYWKTFASDWLTS-LNMSSENMRLRDHDEDELSHYS
SYG_STAES       FRTREFEQMELEFFCKPGEEIEWQNYWKTFASEWLTD-LNISEDNMRLRDHDEDELSHYS
SYG_CLOPE       FRTREFEQMELEFFCKPGTDLEWFNFWKDSCWNFLLN-LGMKEENIRMRDHGEEELSFYS
SYG_CLOTE       FRTREFEQMELEFFCKPGTDLEWFEYWRDYSWNFLLS-LGLAKDNLRIREHAKEELAFYS
SYG_CLOAB       FRTREFEQMELEFFCKPGTDLEWFKYWKDYCWSFLLD-LGINKENLRFRDHSAEELVFYS
SYG_CALS4       FRTREFEQMELEFFCKPGEDMEWFNYWRQFCMDWLVE-FGLKRENLRFRDHKKEELSHYS
SYG_LEPIC       FRTREFEQMEMEFFCEPGTQKEWFSHWVNYCMNWLTEQVGIKKENLRVREHEKEELSFYS
SYG_LEPIN       FRTREFEQMEMEFFCEPGTQKEWFSHWVNYCMNWLTEQVGIKKENLRVREHEKEELSFYS
SYG_BDEBA       FRTREFEQMEMQYFVEPGTDEQFFKEWKERRWNFYIK-FGIKPENLKFKDHD--KLAHYA
SYG_CHLTE       FRMVEFEQMEMQYFVKPGTQLEAFEAWREERFRWYSETLGMSKEKLHWYKHD--KLAHYA
SYG_BORBU       FRTCEFEQMEMQFFVHPKQIDEWFCYWQQNRMNFFIETLKISPDRLRFKAHDSTQLAHYA
SYG_BORBP       FRTCEFEQMEMQFFVHPKQIDEWFCYWQQNRMNFFIETLKIRPDKLRFKAHDSTQLAHYA
SYG_TREDE       FRTCEFEQMEMQFFVKPGTDDEWFDYWKKQRWAFY-EKYGVRTNKLQWHQHGKDELAHYA
SYG_TREPA       FRTCEFEQMEMQFFVRPAEDTHWFEYWCAQRWAFY-QKYGVRMNHMRWRTHAAHELAHYA
SYG_COREF       FRTREFEQMEMEFFVKPGEDEEWHQHWIDARHQWYID-LGVNPDNLRLYEHPQEKLSHYS
SYG_CORGL       FRTREFEQMEMEFFVKPGEDEEWHQHWIDTRLQWYIN-LGIKPENLRLYEHPQEKLSHYS
SYG_NOCFA       FRTREFEQMEMEFFVKPGEDEQWHQYWIDTRLAWYTD-LGIDPENLRLYEHPKEKLSHYS
SYG_MYCBO       FRTREFEQMEMEFFVEPATAKEWHQYWIDNRLQWYID-LGIRRENLRLWEHPKDKLSHYS
SYG_MYCTU       FRTREFEQMEMEFFVEPATAKEWHQYWIDNRLQWYID-LGIRRENLRLWEHPKDKLSHYS
SYG_MYCPA       FRTREFEQMEMEFFVEPSTAKEWHQYWIDTRLQWYVE-LGIDPQNLRLFEHPADKLSHYS
SYG_CUTAK       FRTREFEQMEMEFFVEPGTDEEWHQYWIDVRTAWYTD-LGINPDNLRHYEHPKEKLSHYS
SYG_BIFLO       FRTREFEQMEMEFFVTPGTDEEWHQYWIDARTRWYID-LGVKPENLRHYEHPKEKLSHYS
SYG_STRAW       FRTREFEQMEMEFFVKPGEDEKWQEFWMQERWNWYTG-LGLREENMRWYDHPAEKLSHYS
SYG_STRCO       FRTREFEQMEMEFFVKPGEDEKWQEYWMEQRWNWYTG-LGLREENMRWYEHPAEKLSHYS
SYG_THET2       FRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQE-MGLSRENLVPYEQPPEELAHYA
SYG_THET8       FRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQE-MGLSRENLVPYQQPPEELAHYA
SYG_DEIRA       FRVRELEQMEIEFFVTPGTDEEWHEHWLEKRLKWWED-QGVPREKIEILDVPKEDLAHYS
SYG_MESFL       FRTREFEQMELEFFFNPSDEKDWFSYWLNEVETFLQDKIQINKENYRVRSHEKDELAHYS
SYG_MYCMS       FRTREFEQMELEFFFDPSDQKDWFKYWLDQIELFLTKKICLDKSNYKIRENLKDELSHYA
SYG_MYCGA       FRTREFEQFEIEYFLEPELVKEKFDWYINQIEDFLINKLLINKQLIKRHEIAKDELAHYS
SYG_MYCPE       FRTREFEQMEIEYFCDKKDSPKVFDNFLESIKTFLFKTLKIHENNIKIIDYPKEELAHYS
SYG_MYCGE       FRTREFEQFEIEWFCKPDDANSLFEKQLIMVEQFLQTVLKINPELLKKHEYDQSELAHYA
SYG_MYCPN       FRVREFEQFEMEWFCNPQASLSVFESQQQAIAHFLFKVLQLNPALVKQYEYDKNELAHYA
SYG_UREPA       FRTREFEQMEIEFFLKEEIAYDVFDKYLNQIQNWLVTCCGLDLNNLRKHEHPKEELSHYS
                **  *:**:*:::*                   :      :             .* .*:

SYG_BACC1       NATTDIEFKFPF---GWGELWGVASRTDFDLKRHME---------------HSNEDFNYI
SYG_BACCZ       NATTDIEFKFPF---GWGELWGVASRTDFDLKRHME---------------HSNEDFNYI
SYG_BACAN       NATTDIEFKFPF---GWGELWGVASRTDFDLKRHME---------------HSNEDFNYI
SYG_BACHK       NATTDIEFKFPF---GWGELWGVASRTDFDLKRHME---------------HSNEDFNYI
SYG_STAAM       NATTDIEYKFPF---GWGELWGIASRTDFDLRKHAE---------------HSGEDFRYH
SYG_STAAN       NATTDIEYKFPF---GWGELWGIASRTDFDLRKHAE---------------HSGEDFRYH
SYG_STAAR       NATTDIEYKFPF---GWGELWGIASRTDFDLRKHAE---------------HSGEDFRYH
SYG_STAAS       NATTDIEYKFPF---GWGELWGIASRTDFDLRKHAE---------------HSGEDFRYH
SYG_STAAW       NATTDIEYKFPF---GWGELWGIASRTDFDLRKHAE---------------HSGEDFRYH
SYG_STAES       NATTDIEYKFPF---GWGELWGIASRTDYDLRQHSE---------------HSGEDFKYH
SYG_CLOPE       NATSDIEYLFPF---GWGELWGIADRTDYDLNKHAE---------------HSGQDMTYL
SYG_CLOTE       KATVDIEYLFPF---GWGELWGIADRTDYDLKQHMN---------------HSGKDLTYL
SYG_CLOAB       KATSDIEYKFPF---GWGELWGVADRTDYDLKKHMD---------------HSGEDMNYL
SYG_CALS4       TATTDIEYNFPF---GWGELWGIANRTDYDLRQHME---------------HSGEDMTYT
SYG_LEPIC       EGTSDIEFKYNF---GWGELWGIASRTDYDLNQHQK---------------FSGEDLKYQ
SYG_LEPIN       EGTSDIEFKYNF---GWGELWGIASRTDYDLNQHQK---------------FSGEDLKYQ
SYG_BDEBA       KAAVDVEFKFPM---GFSELEGIHNRSDFDLSQHMK---------------FSGKNLEYF
SYG_CHLTE       DLAYDIKFEFPF---GIEEIEGIHSRTDFDLSQHQK---------------YSGKSMEYI
SYG_BORBU       KAAFDIEYEFPF---GFQEVEGIHNRGNYDLTQHAK---------------FSNKPKVFE
SYG_BORBP       KSAFDIEYEFPF---GFQEVEGIHNRGNYDLTQHSK---------------FSNNPKIFE
SYG_TREDE       KDAYDIEYEFPM---GFKELEGVHNRTNYDLTRHTE---------------YSGKDMQYI
SYG_TREPA       RAACDIEYAFPM---GFRELEGVHNRGDFDLTRHAQ---------------HSGKDLCYV
SYG_COREF       KRTVDIEYAFNFANSKWGELEGIANRTDYDLRVHSE---------------GSGEDLSYF
SYG_CORGL       KRTVDIEYAFNFANTKWGELEGIANRTDYDLRVHSE---------------GSGEDLSFF
SYG_NOCFA       TRTVDIEYRFRFQGSEWGELEGVANRTDYDLKTHSE---------------HSGTELSYF
SYG_MYCBO       DRTVDIEYKFGFMGNPWGELEGVANRTDFDLSTHAR---------------HSGVDLSFY
SYG_MYCTU       DRTVDIEYKFGFMGNPWGELEGVANRTDFDLSTHAR---------------HSGVDLSFY
SYG_MYCPA       DRTVDIEYKFGFAGNPWGELEGVANRTDFDLSTHSK---------------HSGVDLSFY
SYG_CUTAK       KRTVDVEYKFGFSGSDWGELEGIANRTDFDLGNHSR---------------HSGKDLSYY
SYG_BIFLO       KRTVDIEYKFGFQGSDWGELEGIANRTDYDLSAHSK---------------HSGEDLSYF
SYG_STRAW       KRTADIEYRFQFGGNEWGELEGVANRTDYDLSAHAK---------------ASGQDLSYF
SYG_STRCO       KRTADIEYRFSFGGSEWGELEGVANRTDYDLSSHAK---------------ASGQDLSYY
SYG_THET2       KATVDILYRFPH---GLEELEGIANRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYR
SYG_THET8       KATVDILYRFPH---GLEELEGIANRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYR
SYG_DEIRA       KRTYDLMYDYPTL--GHEEIEGIANRSDYDLGSHTKSQSELGLVAKVEENNDSIAKLTIP
SYG_MESFL       TATSDIEFKFPF---GWGELWGVAHRGNFDLNAHQE---------------ASKQDLTYL
SYG_MYCMS       LKTSDIEFNFPF---GWGELWGISHRSDFDLKVHQN---------------LSKEDLTVL
SYG_MYCGA       SRTIDFQFNFPH---GWSELWGLAHRGNFDLTAHSN---------------ESGKTLDYH
SYG_MYCPE       SRTVDFLYNFPH---GYSELWGLADRGEFDLTAHQN---------------LSKKSLEYL
SYG_MYCGE       KKTTDFLFNFPH---GLKELWGLANRGDFDLKQHQE---------------FSKKSMSFF
SYG_MYCPN       NKTVDFLFQFPH---GLRELWGLADRGTFDLEQHQK---------------YAKKPLDFF
SYG_UREPA       KKTIDFEYNFLH---GFSELYGIAYRTNYDLSVHMN---------------LSKKDLTYF
                  : *. : :        *: *:  *  :**  *                  :       

SYG_BACC1       DPQT-----NERYVPYCIEPSLGADRVTLAFLCDAYEEEQLE------------------
SYG_BACCZ       DPQT-----NERYVPYCIEPSLGADRVTLAFLCDAYEEEQLE------------------
SYG_BACAN       DPQT-----NERYVPYCIEPSLGADRVTLAFLCDAYEEEQLE------------------
SYG_BACHK       DPQT-----NERYVPYCIEPSLGADRVTLAFLCDAYEEEQLE------------------
SYG_STAAM       DPET-----NEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGS----------------
SYG_STAAN       DPET-----NEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGS----------------
SYG_STAAR       DPET-----NEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGS----------------
SYG_STAAS       DPET-----NEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGS----------------
SYG_STAAW       DPET-----NEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGS----------------
SYG_STAES       DPET-----NEKYIPYCIEPSLGADRVTLAFLCDAYAEEGVEGS----------------
SYG_CLOPE       DPTT-----NEKYVPYVIEPSLGADRVALAFLVEAYDEEELEGAN---------------
SYG_CLOTE       DPET-----NEKYLPYCIEPSLGADRVALAFLVDAYDEEELDGG----------------
SYG_CLOAB       DPST-----NEKYVPYVIEPSLGADRVALAFLIDAYDEEELEGG----------------
SYG_CALS4       DPVT-----GEKYIPYCIEPSVGVDRLMLAFLVDAYDEEEVEGE----------------
SYG_LEPIC       DQVQ-----NKKYVPFVVEPALGVNRLFLAVVTDAYEEEKLP------------------
SYG_LEPIN       DQVQ-----NKKYVPFVVEPALGVNRLFLAVVTDAYEEEKLP------------------
SYG_BDEBA       DEPN-----KKKYIPYVIETAVGCDRLFLAFLCDAYREEVTT----------------DE
SYG_CHLTE       DQTT-----NERYIPYVVETSSGCDRTFLALLSDAYQEDVVD----------------GE
SYG_BORBU       YHDL---LTKEKYVPYVIETSAGLTRSVLMTLCDAYSEE--------------------E
SYG_BORBP       YHDL---LTKERYVPHVIETSAGLTRSVLMTLCNAYSEE--------------------E
SYG_TREDE       DQD----NGNEKYIPYIIETSAGLTRNVLMFICDAYDEE-------------KVADK---
SYG_TREPA       DPDPNLDAAARRYVPCVVETSAGLTRCVLMFLCDAYTEEYVQAPNVAFSETTQTADQEGA
SYG_COREF       DQET-----GERWIPYVIEPAAGLGRAMMVFLMDAYHEDEAP----------------NS
SYG_CORGL       DQET-----NERWIPFVIEPAAGLGRAMMMFLMDAYHEDEAP----------------NS
SYG_NOCFA       DQAN-----NERYIPYVIEPAAGLTRSLMAFLVDAYAEDEAP----------------NA
SYG_MYCBO       DQIN-----DVRYTPYVIEPAAGLTRSFMAFLIDAYTEDEAP----------------NT
SYG_MYCTU       DQIN-----DVRYTPYVIEPAAGLTRSFMAFLIDAYTEDEAP----------------NT
SYG_MYCPA       DQAT-----DSRYIPYVIEPAAGLTRSFMAFLIDAYVEDEAP----------------NA
SYG_CUTAK       DQAN-----NKRYLPYVIEPAAGLTRSLMAFMVDAYTEDEAP----------------NA
SYG_BIFLO       NQAT-----GEKYVPYVIEPAAGLTRSLMCFLVDAYDVDEAP----------------NT
SYG_STRAW       DQEA-----GERWTPYVIEPAAGVGRAMLAFLLDAYVEDEAP----------------NA
SYG_STRCO       DQEA-----QERWTPYVIEPAAGVGRAMLAFLLDAYIEDEAP----------------NA
SYG_THET2       DPET-----GKWFVPYVIEPSAGVDRGVLALLAEAFTREELP----------------NG
SYG_THET8       DPET-----GKWFVPYVIEPSAGVDRGVLALLAEAFTREELP------------------
SYG_DEIRA       HPET-----NKPVVPFVIEPSAGVDRAMLAVLSEAFTKETLE----------------NG
SYG_MESFL       DPTT-----NQKVLPHVIEPSVGVERMMLAILWQAYHEEDLG------------------
SYG_MYCMS       KEEN-----NQKVLANVIEPSVGVERLMLAIFWQAYTEEQLE------------------
SYG_MYCGA       NEIE-----KTKIIPDVIEPSLGIERILYAIFCAHYHVEQLA------------------
SYG_MYCPE       NEET-----KEKFVPSVIEPSVGVERLLYAILIDAYDEEKID------------------
SYG_MYCGE       DSEL-----NQHFLPFIIEPAVGIERLFYALIVSSYRREIIN------------------
SYG_MYCPN       DGEN-----NEHFIPAVVEPSVGIERLFYALIVSSYQQEQLE------------------
SYG_UREPA       DEET-----KQKYIPHVIEPSVGVERLLYAILTEATFIEKLA------------------
                              .  :*.: *  *     .      :                     

SYG_BACC1       ---NDSRTVLRFHPALAPYKAAILPLSKK---LSEGATEVFAELA--KDFMV--DFDETG
SYG_BACCZ       ---NDSRTVLRFHPALAPYKAAILPLSKK---LSEGATEVFAELA--KDFMV--DFDETG
SYG_BACAN       ---NDSRTVLRFHPALAPYKAAILPLSKK---LSEGATEVFAELA--KDFMV--DFDETG
SYG_BACHK       ---NDSRTVLRFHPALAPYKAAILPLSKK---LSEGATEVFAELA--KDFMV--DFDETG
SYG_STAAM       ---KDARTVLHFHPALAPYKAAILPLSKK---LSGEAIKIFEQLS--SKFSI--DFDESQ
SYG_STAAN       ---KDARTVLHFHPALAPYKAAILPLSKK---LSGEAIKIFEQLS--SKFSI--DFDESQ
SYG_STAAR       ---KDARTVLHFHPALAPYKAAILPLSKK---LSGEAIKIFEQLS--SKFSI--DFDESQ
SYG_STAAS       ---KDARTVLHFHPALAPYKAAILPLSKK---LSGEAIKIFEQLS--SKFSI--DFDESQ
SYG_STAAW       ---KDARTVLHFHPALAPYKAAILPLSKK---LSGEAIKIFEQLS--SKFSI--DFDESQ
SYG_STAES       ---KDARTVMHFHPALAPYKAAVLPLSKK---LSSEAIKIFEQLS--SSFAI--DFDESQ
SYG_CLOPE       -GKVDVRTVMHLHPALAPFKAAILPLSKK---LSEKADEVYAELS--KHFNV--DYDETG
SYG_CLOTE       ----DSRTVLRLHPALAPFKAAILPLTKK---LKDKSLEVYSMLS--KYFNV--DYDEAG
SYG_CLOAB       ----DQRIVLHFHPQIAPIKAAVLPLSKK---LSEKALDVYSKIS--SKFNI--EYDETG
SYG_CALS4       -----TRVVLRLHPAIAPVKVAVFPLSKK---LNEAAYKIYLDLK--KKFPA--EYDESG
SYG_LEPIC       --DGETRTVLRFSPKIAPVKAAVFPLMKK-DGLPEKSREIFADLS--KLGNI--EYDDGG
SYG_LEPIN       --DGETRTVLRFSPKIAPVKAAIFPLMKK-DGLPEKSREIFADLS--KLGNI--EYDDGG
SYG_BDEBA       AGKEDVRVVMGLHPEIAPFKVAVLPLSKK-EELSSISEKLRDQLA--EDFDV--NYDESQ
SYG_CHLTE       P-----RVMLKLAPKVAPVKAAVLPLMKK-GEMGEKAAQLCRDLS--ESFMV--QYDDAA
SYG_BORBU       LSDGDKRIVLRLHPKLAPYKIAIFPLVKK-VELTEIARRIYMELC--DDFHI--FYDDSG
SYG_BORBP       LSDGDKRIVLRLHPKLAPYKIAIFPLVKK-VELVEIARRIYIELC--DDFHI--FYDDSG
SYG_TREDE       GNDDDWRTVLRFHPNIAPITVAVLPLMKK-DGLAELAEEIRNELK--EEFKT--DYDQSG
SYG_TREPA       ARTGEMRIVLRLHPALSPTTVAFLPLVKK-DGLVDLARAVRDELR--EDFAC--DFDAAG
SYG_COREF       KGGVDKRVVLKLDRRLAPVKVAVLPLSKK-PELSGPAEKLAAELR--QFWNV--EYDTSG
SYG_CORGL       KGGVDKRVVLKLDRRLAPVKVAVLPLSKK-DTLTPLAEKLAAELR--EFWNV--DYDTSG
SYG_NOCFA       KGGVDVRTVLRLDRRLAPVKAAVLPLSRN-ADLTPKAKDLAAQLR--KHWNV--EFDDAG
SYG_MYCBO       KGGMDKRTVLRLDPRLAPVKAAVLPLSRH-ADLSPKARDLGAELR--KCWNI--DFDDAG
SYG_MYCTU       KGGMDKRTVLRLDPRLAPVKAAVLPLSRH-ADLSPKARDLGAELR--KCWNI--DFDDAG
SYG_MYCPA       KGKMEKRAVLRLDPRLAPVKAAVLPLSRH-ADLSPKARDLAAELR--RFWNI--EFDDAG
SYG_CUTAK       KGGVDKRTVLKLDPRLSPVKAAVLPLSRN-SDLSPKARDLAARLR--EHWNV--DFDDAQ
SYG_BIFLO       KGGVDKRTVLRLDPRLAPVKAAVLPLSKK-PELQTVAQNLADDLRF-NEWMI--DYDESG
SYG_STRAW       KGKMEKRTVLRLDPRLSPVKVAVLPLSRN-PELSPKAKGLATALR--QHWNI--EFDDAG
SYG_STRCO       KGKLEKRTVLRLDPRLSPVKVAVLPLSRN-PELSPKAKGLAQALR--QNWNI--EFDDAG
SYG_THET2       ----EERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRV--LYEDTG
SYG_THET8       --NGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRV--LYEDTG
SYG_DEIRA       ----NERIVLKLKPHLAPIKVAVIPLARNREEITDVAKAIKAELQGLGLGRV--LYEDSG
SYG_MESFL       --EGNSRIVMKLPYNLAPYQIAVMPLQKQ---QNDQAQALYSNLLNNFDVT----YDETG
SYG_MYCMS       --ENNSRTVLKLPYNLAPYQVAITPLSKQ---LNQNAHQLFLELLKDFDAV----YDETG
SYG_MYCGA       --DNDSREVLRLPVSLSPYQLAILPLVNK---LKDQAYQLYLDLLKISDANLRFDFDSAG
SYG_MYCPE       --EENNRVVLKLIPELAPYKFAVLPLSNK---LNDKAEEIFNNLILSNICT----YDSSG
SYG_MYCGE       --EEE-REVLSLPFDLCPEQIIVLPLVNK---LKKEAFSVFETLAKTRWRV---CFETTG
SYG_MYCPN       --GEM-REVLRLPFHLCPEQIVVLPLVNK---LKETAQTLFEALSQTHWRI---GFESAG
SYG_UREPA       --NDEDRILMNLKYDLAPYKIAVMPLVNK---LKEKAEAVYNKILDLNISV---TFDNSG
                      * :: :   :.*    . ** .:       :  :   :           ::   

SYG_BACC1       SIGKRYRRQDEIGTPFCITYDFDSVE---------DKAVTVRDRDTMEQVRMPISELKGF
SYG_BACCZ       SIGKRYRRQDEIGTPFCITYDFDSVE---------DKAVTVRDRDTMEQVRMPISELKGF
SYG_BACAN       SIGKRYRRQDEIGTPFCITYDFDSVE---------DKAVTVRDRDTMEQVRMPISELKGF
SYG_BACHK       SIGKRYRRQDEIGTPFCITYDFDSVE---------DKAVTVRDRDTMEQVRMPISELKGF
SYG_STAAM       SIGKRYRRQDEIGTPYCVTFDFDSLE---------DNQVTVRDRDSMEQVRMPISELEAF
SYG_STAAN       SIGKRYRRQDEIGTPYCVTFDFDSLE---------DNQVTVRDRDSMEQVRMPISELEAF
SYG_STAAR       SIGKRYRRQDEIGTPYCVTFDFDSLE---------DNQVTVRDRDSMEQVRMPISELEAF
SYG_STAAS       SIGKRYRRQDEIGTPYCVTFDFDSLE---------DNQVTVRDRDSMEQVRMPISELEAF
SYG_STAAW       SIGKRYRRQDEIGTPYCVTFDFDSLE---------DNQVTVRDRDSMEQVRMPISELEAF
SYG_STAES       SIGKRYRRQDEIGTPYCITFDFDSLE---------DNQVTVRDRDSMEQVRMPISELETF
SYG_CLOPE       SIGKRYRRQDEIGTPFCITVDFDTLE---------DGCVTVRDRDNMEQQRVKIEDVRAI
SYG_CLOTE       TIGKRYRREDEIGTPYCITIDYDTLE---------DNTVTIRDRDSMDQIRINIDELVKY
SYG_CLOAB       SIGKRYRRQDEIGTPYCITVDFDTLE---------DEAVTIRDRDSMSQVRVKIEELEKY
SYG_CALS4       SIGRRYRRQDEIGTPFCVTYDFDSEN---------DHKVTIRDRDTMEQIRIDIDQVDKY
SYG_LEPIC       AIGKRYRRQDEIGTPFCITVDYDTLK---------DNTVTVRERDSMSQERIAVNQLKNW
SYG_LEPIN       AIGKRYRRQDEIGTPFCITVDYDTLK---------DDTVTVRERDSMSQERIAVNQLKNW
SYG_BDEBA       SIGKRYRRQDEIGTPFCVTVDFDTIN---------DQAVTVRHRDKMTQERVAITQLNAY
SYG_CHLTE       SIGKRYRRQDEIGTPFCFTVDHDTLE---------NGTITVRYRDTAAQERINMSKAAEF
SYG_BORBU       TIGKRYRRQDEIGTPYCVTIDYNTIE---------DETVTVRERNSMTQKRIFINDLYSY
SYG_BORBP       TIGKRYRRQDEIGTPYCVTVDYSTIE---------DETVTVRERNNMTQKRIFINDLYSY
SYG_TREDE       AIGKRYRRQDEVGTPFCVTVDYDSKE---------DNTVTLRFRDSMEQVRIPRTELISR
SYG_TREPA       AIGKRYRRQDEVGTPFCVTVDYQSKE---------DDTVTVRLRDSMAQRRVSRAFLAEF
SYG_COREF       AIGRRYRRQDEIGTPFCVTVDFDTLE---------DNAVTVRERDTMEQIRVPLDELQGY
SYG_CORGL       AIGRRYRRQDEIGTPFCVTVDFDSLE---------DNAVTVRERDTMEQVRVPLDELQGY
SYG_NOCFA       AIGRRYRRQDEIGTPFCITVDFDTLE---------DQAVTIRERDSMAQERIALDKVEGY
SYG_MYCBO       AIGRRYRRQDEVGTPFCVTVDFDSLQ---------DNAVTVRERDAMTQDRVAMSSVADY
SYG_MYCTU       AIGRRYRRQDEVGTPFCVTVDFDSLQ---------DNAVTVRERDAMTQDRVAMSSVADY
SYG_MYCPA       AIGRRYRRQDEIGTPFCVTVDFDSLE---------DNAVTVRRRDDMSQERIGMDAVADY
SYG_CUTAK       AIGKRYRRQDEIGTPFCITVDFDSLE---------DDAVTIRERDTMAQQRVSIDKVEEY
SYG_BIFLO       AIGRRYRRQDEIGTPLCITVDFDTLE---------DHAVTIRERDTMAQERVALDKVADY
SYG_STRAW       AIGRRYRRQDEIGTPFCVTVDFDTLD---------DNAVTVRERDSMKQERVSLDQIEGY
SYG_STRCO       AIGRRYRRQDEIGTPFCVTVDFDTLD---------DNAVTVRERDTMKQERVSLDQIEGY
SYG_THET2       NIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGF
SYG_THET8       NIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGF
SYG_DEIRA       NIGKAYRRHDEVGTPYCVTVDFDTVGLGENTDESLKDTVTVRDRDTLAQERVKISELAGW
SYG_MESFL       NVGKRYRRQDAIGTPFVITVDFDTPETN---------SVTVRERDSMEQVRINLDELEAY
SYG_MYCMS       NIGKRYRRQDAIGTPFVITYDFQTLEDQ---------KVTIRYRDTMKQERILISQLKDF
SYG_MYCGA       SIGKRYRRYDAIGAKYCLTYDFDSLEKG---------IVTIRERDSMEQIKIPISELRQW
SYG_MYCPE       SIGKRYRRQDAIGTPYCITVDFDTLEDE---------CVTIRDRDSMKQIRIKIKDIDLS
SYG_MYCGE       SIGKRYRKADAIGIKYAVTFDFESLEDN---------AVTIRDRDTLVQQRIAIKELPQW
SYG_MYCPN       SIGKRYRKADAIGTKFAITFDFESLEDQ---------AVTIRERDSLKQVRVPIKELKAW
SYG_UREPA       SIGKRYRRQDAIGTIYCITIDYDSFGDEH------DPTFTIRERNTMAQKRIKLSELSLY
                 :*: **: * :*    .* *..:              .*:* *:   * ::        

SYG_BACC1       LEKKIQF-----------------------------
SYG_BACCZ       LEKKIQF-----------------------------
SYG_BACAN       LEKKIQF-----------------------------
SYG_BACHK       LEKKIQF-----------------------------
SYG_STAAM       LTEKTKF-----------------------------
SYG_STAAN       LTEKTKF-----------------------------
SYG_STAAR       LTEKTKF-----------------------------
SYG_STAAS       LTEKTKF-----------------------------
SYG_STAAW       LTEKTKF-----------------------------
SYG_STAES       LAEKVKF-----------------------------
SYG_CLOPE       IEKSLEF-----------------------------
SYG_CLOTE       ISEKVEF-----------------------------
SYG_CLOAB       LEEKIK------------------------------
SYG_CALS4       LEEKLKF-----------------------------
SYG_LEPIC       LFERL-------------------------------
SYG_LEPIN       LFERL-------------------------------
SYG_BDEBA       IAAKLKTFNQ--------------------------
SYG_CHLTE       LATKLM------------------------------
SYG_BORBU       IKTEILNYKEDFNK----------------------
SYG_BORBP       IKTEILNYKEDFNK----------------------
SYG_TREDE       IKTEIKNYKRAH------------------------
SYG_TREPA       LRTEIKHYRRP-------------------------
SYG_COREF       LAQQLIGC----------------------------
SYG_CORGL       LAQRLIGC----------------------------
SYG_NOCFA       LAQHLIGV----------------------------
SYG_MYCBO       LAVRLKGS----------------------------
SYG_MYCTU       LAVRLKGS----------------------------
SYG_MYCPA       LSARLKGC----------------------------
SYG_CUTAK       LGGKLLGC----------------------------
SYG_BIFLO       VAARIGEKRTRVPLKPVEMGGEPWPESGVQEAGGLY
SYG_STRAW       LAARLIGC----------------------------
SYG_STRCO       LASRLVGC----------------------------
SYG_THET2       LRERLKW-----------------------------
SYG_THET8       LRERLRW-----------------------------
SYG_DEIRA       IQAKLR------------------------------
SYG_MESFL       LKAKF-------------------------------
SYG_MYCMS       LNSQFN------------------------------
SYG_MYCGA       IRNNLHE-----------------------------
SYG_MYCPE       KVQELFKNAK--------------------------
SYG_MYCGE       FMKNGQ------------------------------
SYG_MYCPN       FAQHDDQSH---------------------------
SYG_UREPA       LSQKAHEDFQKQCQK---------------------