CLUSTAL format seed alignment for MF_00255

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYGB_LACS1      --MAHTFLLEIGLEEIPAHVVTPSVNQLVQKTTKFLKEQRIDFDEVIP--YSTPRRLTVK
SYGB_LACPL      --MAKTYLLEIGLEEMPAHVVTPSVLQLKERMIKFLKDARLDFEDVKT--FSTPRRLTVQ
SYGB_LACDB      --MTKDFLFEIGVEEMPAHVVSKSVKQLADRTGKFLKENGLGFKEIKT--YSTPRRLTVL
SYGB_STRP3      --MSKNLLIELGLEELPAYVVTPSEKQLGERLATFLTENRLSFEDIQT--FSTPRRLAVR
SYGB_STRP1      --MSKNLLIELGLEELPAYVVTPSEKQLGERLATFLTENRLSFEDIQT--FSTPRRLAVR
SYGB_STRPN      --MTKNLLVELGLEELPAYVVTPSEKQLGEKMAAFLKGKRLSFEAIQT--FSTPRRLAVR
SYGB_STRR6      --MTKNLLVELGLEELPAYVVTPSEKQLGEKMAAFLKENRLSFEAIQT--FSTPRRLAVR
SYGB_LACLA      ---MTNYLLEIGLEEIPAHLVTPSINQLAERMETFLKENRLEFDKIIK--FSTPRRLAII
SYGB_BACHD      -MSKRDFLLEIGLEELPARFVSDGEKQLADKVESFLKEQRISFEQISS--FSTPRRLAVL
SYGB_BACSU      -MSKQDLLLEIGLEEMPARFLNESMVQLGDKLTGWLKEKNITHGEVKL--FNTPRRLAVF
SYGB_FUSNN      ----MELLFEIGMEEIPARFLNQALEDLKSNFEKKLKNNRIKFDGVRT--YGTPRRLVLV
SYGB_NEIMB      -MMTQTLLIELLTEELPPKALNNLGNHFAASVAEGLEKAQLVDGAAEFTAYASPRRLAVQ
SYGB_RALSO      ---MSTLLIELLTEELPPKALARLGEAFAQSLFDGLSAQGLLEEGAQVEGFATPRRLAAS
SYGB_ECOLI      -MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQW--FAAPRRLALK
SYGB_HAEIN      -MTTQNFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKIEW--FAAPRRLAVK
SYGB_VIBCH      --MAKEFLIELGTEELPPKQLRTLAEAFAANFAAELATADIAHEGVTW--FATPRRLALK
SYGB_XYLFA      MTELKPLLIELGTEELPVNALPNLSRAFFEGVLAGLEKRGIVVDHGEAKSLSTPRRLAVL
SYGB_RHILO      ---MPDLLLELRSEEIPARMQRKAAGDLKKMLTDGLVEAGLTYEAARE--YWTPRRLTLD
SYGB_BUCAP      -MIKKTFLVEIGTEELPSNILKKIILVFYKNFVDELSFNKILYKNINY--FSTPRRLALQ
SYGB_BUCAI      -MTKKILLIEIGTEELPARLLSKISLYFYKNFIKELDFHNISYKNIKY--FSTPRRLALK
SYGB_BUCBP      --MKNTFLIEIETEELPPKSLKAIAQSFNKQIIEKSKTYYLKYKQTKW--FATPRRIAVM
SYGB_HELPY      -MHSDELLVEILVEELPAQALLNEYKEMPKKLHALFNKRALEVGNIEI--FYTPRRLCLL
SYGB_HELPJ      -MHSDELLVEVLVEELPAQALLNEYKEMPKKLHALFQKRALEVGNIEV--FYTPRRLCLF
SYGB_RICFE      ---MSELLLELFSEEIPAFMQKNAEEGYLNIFTKIFEENEIFA-KVQA--FAGPRRITLY
SYGB_RICBR      ---MSELLLELFSEEIPAFIQKDAEEGYLSIFTKIFEENEIFA-KIQV--FSGPRRITLY
SYGB_RICPR      --MVSELLLELFSEEIPAFMQKNAEEGYLKIFTKIFEENEIFA-KVQV--FAGPRRITLH
SYGB_AQUAE      --MTNELLIEIGTEELPAGVINPALDYLKDKINSLLNARQVKT-------YGTPRRLTLY
SYGB_THEMA      ---MRTALLEVGLEELPASEFHSILKQLEEKSAELLKAYRVSSGSVEV--FVGSRRFGVI
SYGB_SYNY3      -MPLQTFLFEIGTEELPADFVRSAITQWQGLIPPGLAAEFLQPESVEI--YGTPRRLAVL
SYG_CHLMU       -<QDEDFLLEIGSEELPAAFVPTGIQQLESLAKKLLADHNISYNNLEV--LGTPRRLALR
SYG_CHLTR       -<QPEDFLLEIGSEELPATFVPTGIQQLESLAKKLLADHGIAYKHLEV--LGTPRRLALC
SYG_CHLPN       -<STEDLLLEIGSEELPATFVPIGIQQLESLARQVLTDHNIVYEGLEV--LGSPRRLALL
                       *.*:  **:*                       :            .**:   

SYGB_LACS1      VTGLADKQADIEEEAKGPSKKIALDD----EGNWSKAAQGFVRGQGVTVD----------
SYGB_LACPL      VLGLADKQADVKKEVRGPAKKIAQDA----DGNWTKAAIGFSKGQGASTD----------
SYGB_LACDB      VKELDEKQADVDEVKKGPAKKIAQDA----DGNWTKAAVGFARGQGMSAD----------
SYGB_STRP3      VSGLAAQQTDLTEDFKGPAKKIALDA----DGNFSKAAQGFVRGKGLTTD----------
SYGB_STRP1      VSGLADQQTDLTEDFKGPAKKIALDA----DGNFSKAAQGFVRGKGLTTD----------
SYGB_STRPN      VTGLADKQSDLTEDFKGPAKKIALDS----DGNFTKAAQGFVRGKGLTVE----------
SYGB_STRR6      VTGLSDKQSDLTEDFKGPAKKIALDS----DGNFTKAAQGFVRGKGLTVE----------
SYGB_LACLA      VEGLAEASEAIDEEVKGPSAKIAKDA----QGNWSKAIQGFSRGQGATPD----------
SYGB_BACHD      VIGLAEKQADVEEESRGPAKKIALDE----SGNWTKAAQGFARGQGVSVD----------
SYGB_BACSU      VKDVAEKQDDIKEEAKGPAKKIALDA----DGNWTKAAIGFSKGQGANVE----------
SYGB_FUSNN      ADEVAGMQEDLDELSIGPSRERAYK-----DGALTKAGEGFLKAHRIEEE----------
SYGB_NEIMB      VKNVKAVQADQKIVKKGPAVANAMKD-----GAPTKALEGFARGAGAKI----------E
SYGB_RALSO      ITGVRRAAPDRELREKVLPVNIAFDAEGKPTAPLTKKLAALAKSIGADTIAP-------E
SYGB_ECOLI      VANLAEAQPDREIEKRGPAIAQAFDAE----GKPSKAAEGWARGCGITV----------D
SYGB_HAEIN      VLNLATQQPSKEIEKRGPAVSAAFDAE----GKPTKAAEGWARGCGITV----------E
SYGB_VIBCH      VANLAESQPDRVVEKRGPAVNVAFDAD----GKPTKAAEGWARGNGITV----------E
SYGB_XYLFA      LTAVAVEQPKQYRELFGPYLNTAFDTE----GKPTKALEGFAAKCGVNW----------R
SYGB_RHILO      IRGLTARSKDIREEIKGPS-----------TTAPEQAVQGFLRKAGLSSVA--------D
SYGB_BUCAP      IIELDTSEKINEKIKKGPAIKHAFD----ENGNPTKAAYYWAKSCKINLN---------Q
SYGB_BUCAI      IKDIDITERFVEIKKRGPSIINSYD----KDGFLTEAATRWLKHCGININ---------Q
SYGB_BUCBP      ILDINTSDTNFYLQTKGPSIKNAFD----KLGNPTSIMKFWMQKMNIKIH---------E
SYGB_HELPY      IKDFPLLTQETKEEFFGPPVKIACNHQD-KTQGLNALGLGFYQKLGLKDH---------Q
SYGB_HELPJ      VKDFPLLTQETKEEFFGPPVKIACNNQD-KTQGLNALGLGFYQKLGLKDH---------Q
SYGB_RICFE      ATHLPKVTLPKETEIKGPS-----------IDAPEAAINGFCKAHNVSKL----------
SYGB_RICBR      ATHLPKVTLPKEIEIKGPS-----------TEAPEAAINGFCKAHNVSKL----------
SYGB_RICPR      ATHVPKVILPKEEEIKGPS-----------IEAPEIAINGFCKAHNVSKL----------
SYGB_AQUAE      FKDFENERKEKKEVIWGPPKNVAYDE----KGNPTKALEGFLKKNNASLE----------
SYGB_THEMA      LKNLPERQEDFTEEKKGPPLNVAYDE----NGKPTRALEGFLRNNNASLE----------
SYGB_SYNY3      IKGLPECQPDRLEEIKGPPASAAFKD-----GQPTPAALGFAKKQGVNPE----------
SYG_CHLMU       IQGLSHLTIRPEAEKKGPPLSLLFEE----DGSVSSQGEQFFASHGLSISHRSALDQSST
SYG_CHLTR       IEGLSHVTIRPESEKKGPPLSLLFMT----DGSVSPQGEQFFSSHGLSISHRSALDQPSA
SYG_CHLPN       VKNVAPEVVQKAFEKKGPMLTSLFSP----DGDVSPQGQQFFASQGVDISHYQDLSRHAS
                   .                                                        

SYGB_LACS1      DIFFKELKGTEYVYVKKFIPGKPVSEVLTG-MKDVAMDLKFPTMMRWG-----SNDFEYV
SYGB_LACPL      DIVFKDVKGTPYVFVQTFTAGKTAAEVLTGGIKDVITKMNFPTMMKWS-----TYSFKYI
SYGB_LACDB      DIYFEELKGVEYAYVHVQKAGKEAKEILLG-LDEVIKAMTFPTKMRWD-----SQDFEFV
SYGB_STRP3      AIEFREVKGEEYVYVTKHEAGKPAKEVLLGV-TEVLSAMTFPVSMHWA-----NNSFEYI
SYGB_STRP1      AIEFREVKGEEYVYVTKHEAGKPAKEVLLGV-TEVLSAMTFPVSMHWA-----NNSFEYI
SYGB_STRPN      DIEFREIKGEEYVYVTKEEIGQAVEAIVPGI-VDVLKSLTFPVSMHWA-----GNSFEYI
SYGB_STRR6      DIEFREIKGEEYVYVTKEEVGQAVEAIVPGV-VDVLKSLTFPVSMHWA-----GNSFEYI
SYGB_LACLA      DLILKG----DYYYAKKHIDGVKAEEILSKVGDEVIAKMTFSTYMKWG-----NNDFLFV
SYGB_BACHD      DLYIQEVKGTEYIFAKKFVAGQETASLLPEL-KELITSLHFPKNMRWH-----TYSLRYA
SYGB_BACSU      DLYIKEVKGIEYVFVQKFQAGQETKSLLPEL-SGLITSLHFPKNMRWG-----NEDLRYI
SYGB_FUSNN      QIEIIKNDKGEYIAFKRFLKGKPTEAILPEILKALVLEETFQKSMRWS-----TKTIRFA
SYGB_NEIMB      DLTIVHDGKQDVYAYEYVQIGKPLGGLLEDIINQAVKKLPIPKVMRW-----GSSTFTFV
SYGB_RALSO      SLERAPDGKAESLFHRYTARGAVLADGLQAALSQTIAGLPIPKVMIYQRP--NGDNVQFV
SYGB_ECOLI      QAERLTTDKGEWLLYRAHVKGESTEALLPNMVATSLAKLPIPKLMRWG-----ASDVHFV
SYGB_HAEIN      QAERIATDKGEWLIHRAKIEGQPTKNLLNDIVANALAKLPIPKPMRWA-----DKTVQFI
SYGB_VIBCH      QAERLVTDKGEWLLFKEQVQGQQTASVVVEMAAKALANLPIAKPMRWG-----DKETQFI
SYGB_XYLFA      TLERIRDTKGERFVHRVVVPGERTDALLPGILTEAIAGMPIPKPMRWG-----AHEYLFA
SYGB_RHILO      AHVHSDPKKGDFYVAHISKPGRAAEEIIAQLVPGIIRNFPWPKSMRWGPASAKPGSLRWV
SYGB_BUCAP      AERLKTKTG-EWIIHRIQEKKEKIELLFPKIIEKILKQINLKNTMRWE-----TTNLRFI
SYGB_BUCAI      AIRLKNEKG-EWLFYKTRKKQENIESLIPKITESALKNISIKKSMRWG-----QDNQKFS
SYGB_BUCBP      ITYLNTNKG-SWVTCSKITNKKSIQEILIELCRLAIKNISIPTFMKWS-----NNDIQFS
SYGB_HELPY      YFQTAFKNNKEVLYHAKIHEKEPTKDLIMPIVLEFLEGLNFGKSMRWG-----NVEKSFI
SYGB_HELPJ      HFQTAFKSNKEVLYHAKIHAKQPTKDLIMPIVLEFLEGLNFGKSMRWG-----NVEKSFI
SYGB_RICFE      ELSTKLINNQLYYFFVKKTEEREIKEILPEIIIEAINKYSWAKSMFWG----DYK-IKWI
SYGB_RICBR      ELSTKLINNQLYYFYIKKVEERQIKEILPEIIVEAINKYSWAKSMFWG----NYN-IKWI
SYGB_RICPR      DLSTKLRNNKLYYFFVKKTKERETKEILPKIIIDAINKYSWTKSMFWG----CYK-IKWI
SYGB_AQUAE      EVKVLKKDKGEYVAIVRKVIEKSPIEKLQEEFEEILLSVPFPKRMRWT----SSKRITFS
SYGB_THEMA      NVVHRE----GYVYLSRVVEGKPVEEVLPDLFRDLVLGLNFRKPMRWG----SGE-HEYI
SYGB_SYNY3      DFEIRSTPKGDFIFVNKQLQGQASRDLLPKLALSWLKALDGRRFMRWG-----DGDWRFP
SYG_CHLMU       ICRVRSIKGTDYLFLVIPEERIETAAILVNELPLLIRSMRFPKKMTWD-----NGGVEYA
SYG_CHLTR       IWRVRSINGTDYLFLVIPEERKETAAILVNELPQLIRSIRFPQKMTWD-----NGGVEYA
SYG_CHLPN       L-AIRTVNGSEYLFLLHPEIRLRTADILMQELPLLIQRMKFPKKMVWD-----NSGVEYA
                                           .                * :           : 

SYGB_LACS1      RPIKWLVALLDDE-----VVPFEILDIKTGRTTQGH--RFLGE-AVDVPSADKYLETLET
SYGB_LACPL      RPIRWIVSLLDDE-----VVPVQILDVAAGRVSRGH--RFLGH-DVEIATAADYEADLAS
SYGB_LACDB      RPIHWLVALYGSE-----VVPVEFLDITAGRKTAGH--RFLGD-SVVLANADDYVEALRD
SYGB_STRP3      RPVHTLTVLLNDE-----ALELDFLDIHSGRVSRGH--RFLGT-ETTITSADSYEADLRS
SYGB_STRP1      RPVHTLTVLLNDE-----ALELDFLDIHSGRVSRGH--RFLGT-ETTITSADSYEADLRS
SYGB_STRPN      RPVHTLTVLLDEQ-----EFDLDFLDIKGSRVSRGH--RFLGQ-ETKIQSALSYEEDLRK
SYGB_STRR6      RPVHTLTVLLDEQ-----EFDLDFLDIKGGRVSRGH--RFLGK-ETKIQSALSYEEDLRK
SYGB_LACLA      RPIQWIVSLLEDK-----VVAFDLLDVTANRFSRGH--RFLANVEVELKNANDYASKMPE
SYGB_BACHD      RPIQWLVALYGQE-----VIPFEITGVAAGLETAGH--RFLGE-NVTIDEPTLYKEKLLQ
SYGB_BACSU      RPIKWIVALFGQD-----VIPFSITNVESGRTTQGH--RFLGH-EVSIESPSAYEEQLKG
SYGB_FUSNN      RPIEWFLALYGGK-----VIDFEIEGIKSSNKSKGH--RFFGK-EFEVSSVENYLKKIRE
SYGB_NEIMB      RPVHGLVVLHGGD-----IVNVSVLGLQSGNKTLGH--RFLSDGEITIENADSYAAQMRE
SYGB_RALSO      RPAHRLIALLDDE-----IIPAGVLGLQSGNVTLGH--RFLSAGEIIIPHATAYASTLKS
SYGB_ECOLI      RPVHTVTLLLGDK-----VIPATILGIQSDRVIRGH--RFMGEPEFTIDNADQYPEILRE
SYGB_HAEIN      RPVHTVTMLLGDE-----LIEGEILGVASARTIRGH--RFLGEKEFYIQHADQYPQLLRE
SYGB_VIBCH      RPVKTLTILFGSE-----LIQGEILGVASARTLRGH--RFMGEAEFTIESAEQYPAILEE
SYGB_XYLFA      RPVHWLVMLLGQD-----VVEAEIMGVKAGRISRGH--RFLYDKPVSLSDPQNYIDVLQA
SYGB_RHILO      RPLQSVLCTFGPETEEPVVVDFEIDGIRSGNITYGH--RFLAPGEITVRRFDDYVSKLEA
SYGB_BUCAP      RPIRNIVMLLDEK-----IIKSEVFNVPSNNFLYHH--ISCKEEKIYIKNAIEYPAVLFK
SYGB_BUCAI      RPIRNIVILLDKK-----VIPGDVFNITSKNLLQNH--LSSKDSQIKIKDAKDYPKILLE
SYGB_BUCBP      RPVRNVIMLLNHE-----IIRNNVLGLETNRLLSGH--KFMTNNKIILNHAYQYPELLLN
SYGB_HELPY      RPIHNICVLFNGEDFS--GIEVKEYGFKTKQATKVH--RQEGFDFIQVDSPKAYFEVLE-
SYGB_HELPJ      RPIHNICVLFNGENFN--DIEIKEYGFKTKQATKAH--RQEGFDFIEVDSPKAYFEVLE-
SYGB_RICFE      RPLRNILCIFDGE-----VLPLQFGHLTANNIAYGHRYRLTDNKKLEVTDFEDYKNKLSE
SYGB_RICBR      RPLRNILCIFDSE-----ILPLQFGHLAANNVTFGH--RLTDNKKLEVTDFEDYKTKLTE
SYGB_RICPR      RPLRNILCIFDGE-----ILPLRFGHLSTNNITYGH--RLTNNKKLEIIDFENYRNKLLE
SYGB_AQUAE      RPVRWILALFNGQ-----VLKLRFGELESSNKTYGH--RFLSKGEVTINNPADYEKTLKE
SYGB_THEMA      RPVHWIVAMVDGR-----VLDLEIFGLRSSRISYGK--RYHA-GSIEIPDSERYYESLKK
SYGB_SYNY3      RPIRWLVCLLDDQVLP-LQIDNGSTTLVGDRLSRGH--RILHPADVSLEHGQNYLAQLKT
SYG_CHLMU       RPIRWLVALYGDQ-----VLPISLGFVSSGNISWGH--RQLDNRQLTIPSSKEYIDILRD
SYG_CHLTR       RPIRWLVALYGDQ-----ILPISLGFVSSGNTSWGH--RQLDNRQLTIPSSNMYVDTLRS
SYG_CHLPN       RPIRWLVALYGEH-----ILPITLGTIIASRNSFGH--RQLDPRKISISSPQDYVETLRQ
                ** . .             .      .        :           :     *   :  

SYGB_LACS1      -QKVIADAGVRKAEIRKQIDDLATENNWNIVVDEDLLEEVNNLVEYPTVFAGKFKEEYLQ
SYGB_LACPL      -VQVVADAAKRKATIREQIAALANERDWQIKVNEDLLEEVNNLVEYPTAFAGDFDTKYLT
SYGB_LACDB      -QYVIVDADERKAMIVSQINDLVNSHNWQIKLDASLLEEVNNLVEYPTVFAGSFDQKYLE
SYGB_STRP3      -QFVIADAKERQEMIVEQIKAIEAAQGVQVDIDADLLNEVLNLVEFPTAFMGSFDAKYLD
SYGB_STRP1      -QFVIADAKERQEMIVEQIKTLEVEQGVQVDIDEDLLNEVLNLVEFPTAFMGSFEAKYLD
SYGB_STRPN      -QFVIADPCEREQMIVDQIKEIEAKHGVRIEIDADLLNEVLNLVEYPTAFMGSFDAKYLE
SYGB_STRR6      -QFVIADPCEREQMIVDQIKKIEAKHGVRIEIDADLLNEVLNLVEYPTAFMGSFDAKYLE
SYGB_LACLA      -NFVLVDAEHRKAEISAQILALASENKWQVTLHKDLLEEVNNIVEYPTAFVGSFDPKYLS
SYGB_BACHD      -QYVMADSEERKKAIRHQIQSIMEEKDWVIPIDEDLLDEVTNLVEYPTALFGRFDEAFLS
SYGB_BACSU      -QHVIADPSVRKQMIQSQLETMAAENNWSIPVDEDLLDEVNHLVEYPTALYGSFESEFLS
SYGB_FUSNN      -NNVIIDISERRKMIEEMINNSLLE-DEKADVDKALLDEVTNLVEHPFAIVGTFSEEFLE
SYGB_NEIMB      QGKVVASFAERKAAIQTVLEGQARRLNATAAADEALLDEVTALVEWPVVLEAGFEEHFLA
SYGB_RALSO      QGKVIAGYAERKEAIRAELLKAAG--ADTVVMPEALLDEVNALVEWPVVYPCHFEEQFLA
SYGB_ECOLI      RGKVIADYEERKAKIKADAEEAARKIGGNADLSESLLEEVASLVEWPVVLTAKFEEKFLA
SYGB_HAEIN      KGSVVADFNERKAEILAKSQAKATALGGVADIEESLLEEVTSLVEYPNVLAAKFEEHFLA
SYGB_VIBCH      RGKVIADYATRKAMIIEGSQQAAQQLGGIADLEDALVEEVTSLVEWPVVMTAKFEEKFLK
SYGB_XYLFA      -AYVLVDPAARRARIVAEIEAVARQVGGVARITEDNVAQVVNLVEWPSAVLCSFERVFLE
SYGB_RHILO      -AKVVLDADRRKEIILADARNLAFANGLDLVEDEGLLEEVSGLVEWPVVLMGEFEEAFLA
SYGB_BUCAP      KNKIIANYETRKEKIKYEAKKIAKKVDGIIKTNPFLLEEVTSLVESPQALLARFKKDYIN
SYGB_BUCAI      KNNIIADYFIRKEKIIEDIENIAKKIKGFIKKNNVLIEEVTALVESPKALLVNFQEKFLQ
SYGB_BUCBP      SGKVIADYDARKHKIQKHASIAAQSVNGILKIKTTLLEEITALVEWPTILLATFKKRFLN
SYGB_HELPY      KNHVILDPKKREAKILQEIKELETKHHIIVETDRDLLDEVVAITEYPSALLGEFDKAFLK
SYGB_HELPJ      KNHVILDPKKREAKILQEIKGLEKKHDIIVEVDRDLLDEVVAITEYPTALLGEFDKAFLK
SYGB_RICFE      -NHVILERTKREEIIKTGLLELANSRNLNIKEDNRLIEEVAGLSEFPVVLLGKIPQKFLE
SYGB_RICBR      -NYVILERLKREEIIKTSLLEQANSHNLTIKEDLRLIEEVAGLSEFPVVLCGAIPQKFLE
SYGB_RICPR      -NNVILERLKREEIIKVGLLELANAQNLNIKQDVCLIEEVTGLSEFPIVLLGKIPQKFLE
SYGB_AQUAE      -HYVIPDFNERKEIILRALEKSSQEVGGKPSYPEGLVEEVTNLVEYPFPVLGKFDEKYLE
SYGB_THEMA      -GFVISSHLERKKFVLEQIDEFEKRSSMKIERDEELIEEIVAITEYPRIVVGQFDRKYLE
SYGB_SYNY3      -AGVVVDPQERRAMIEQQITTQAATLEGEAIIYEDLLDEVEQLVEYPTAVLGKFDQEFLS
SYG_CHLMU       -ACVIVSQKERRSIIEQGLQNLTGDQTVAIAPEH-LIEETVFLTEHPFVICAQFNPDFCS
SYG_CHLTR       -ACVIVSQKERRAIIKQGLQNLTGDQIVAIAPEH-LIDETVFLTEHPFVISAQFDPAFCS
SYG_CHLPN       -ACVVVSQKERRMIIEQGLRAHSSDTISAIPLPR-LIEEATFLSEHPFVSCGQFSEQFCA
                   ::     *.  :                     : :   : * *      :   :  

SYGB_LACS1      -VPNEVLITSMKDHQRFFYVTDKDGN------LLPNFVSVRNGNKDYLENVVAGNEKVLT
SYGB_LACPL      -IPDEVLITSMRDHQRFFYVTDAEDN------LLPHFVSVRNGNTDHLENVALGNQKVLT
SYGB_LACDB      -IPDEVLITSMKDNQRYFEVYDQEGK------LINCFISVRNGNKDHLENVISGNEKVLV
SYGB_STRP3      -VPEEVLVTSMKNHQRYFVVRDQEGH------LMPNFVSVRNGNDQAIENVIKGNEKVLV
SYGB_STRP1      -VPEEVLVTSMKNHQRYFVVRDQAGH------LMPNFVSVRNGNDQAIENVIKGNEKVLV
SYGB_STRPN      -VPEEVLVTSMKEHQRYFVVRDQDGK------LLPNFISVRNGNAERLKNVIKGNEKVLV
SYGB_STRR6      -VPEEVLVTSMKEHQRYFVVRDQDGK------LLPNFISVRNGNAERLKNVIKGNEKVLV
SYGB_LACLA      -VPAEVLVTSMRDNQRYFEVYNQEGQ------LAPNFISVRNGNAENIENVVLGNEKVLV
SYGB_BACHD      -LPNEVLITSMREHQRYFPVKNQAGE------LLPYFVTIRNGDHRHLENIVKGNEKVLR
SYGB_BACSU      -IPEEVLVTTMKEHQRYFPVKDKNGD------LLPHFITVRNGNSHAIENVARGNEKVLR
SYGB_FUSNN      -VPQEVLIISMKVHQRYFPILNKKGK------LLPKFIVIRNG-IDFSENVKKGNEKVLS
SYGB_NEIMB      -VPQECLILTMQQNQKYFPLLDQNG-----KLMNRFLLVSNLQTEDP-SHIIQGNERVLR
SYGB_RALSO      -VPQECLILTMQTNQKYFALTDAQG-----HLRNRFLIVSNLATETP-QAIIEGNERVVR
SYGB_ECOLI      -VPAEALVYTMKGDQKYFPVYANDG-----KLLPNFIFVANIESKDP-QQIISGNEKVVR
SYGB_HAEIN      -VPAEALVYTMKGDQKYFPIYDKDG-----KLLPHFIFVSNINPEDP-TAIIEGNEKVVR
SYGB_VIBCH      -VPAEALVYTMKGDQKYFPVYDASK-----KLLPNFIFVSNIESKEP-RHIVEGNEKVVR
SYGB_XYLFA      -VPQEALIQTMEVNQKFFPVLDSLG-----KLTEKFIGIANIESNDV-AEVAKGYERVIR
SYGB_RHILO      -IPAEVIRLTIRANQKCFVTRPQGEGE---ALSNRFILTSNIEARDGGKEIAHGNGKVVR
SYGB_BUCAP      YIPKKILIHTIEKQQRCFSIYSNNSKKE---ILPYFIFISNIKSKKN-KEIILGNEKVMH
SYGB_BUCAI      -IPKKILINTIEKKQKCFPIY--NSEKK---LLPYFIFISNIQTQES-EKIIIGNQRVMH
SYGB_BUCBP      -LPQEILVHIIEKKQRCLPIYSTNNGT----ILNSFVVVSNIETSYP-NNIVRGNERVIH
SYGB_HELPY      -LPSEIIITSMKENQRYFATFCQKSQEESPTLHNGFIVVSNAINKDK-QKIILGNQKVLK
SYGB_HELPJ      -LPSEIITTSMKENQRYFAIFNQKSQEESPTLHNGFIVVSNAISKDK-QKIILGNQKVLK
SYGB_RICFE      -LPKEVLISSMRTHQKYFCLFDKEGN------FAQYFLFVSNGRFANAELVIKGNEKVLS
SYGB_RICBR      -LPKEVLISSMRTHQKYFCLFDRSEN------FAPYFLFVSNGQFANSKLVVQGNEKVLS
SYGB_RICPR      -LPEEVIVSVMRTHQKYFCLFDKNGS------FAPYFLFVINGRFVNTELIIQGNEKVLS
SYGB_AQUAE      -LPPLVITTVAAHHQRFFCFE-KDGK------LLNYFLGISNN--KPNEKIKEGYEKVLR
SYGB_THEMA      -LPEEIIVTAVKHHQRSFIAH-KGTL------TNTFVAFQDGP--QPPENVVKGYERVIN
SYGB_SYNY3      -LPREVTTTVMVTHQRYFPVVDKDGR------LLPHFITIANGDPSKGDIIAAGNGRVIR
SYG_CHLMU       -LPKELLIAEMINHQRYFPTQNLQ------GEITNRFLIVCDNSPTD--TIIEGNEKALA
SYG_CHLTR       -LPKELLIAEMIQHQRYFPTQNMQ------GEITNRFLIVCDNSPTD--SIVEGNEKALA
SYG_CHLPN       -LPKELLIAEMVNHQKYFPTHETSS-----GAISNFFIVVCDNSPND--TIIEGNEKALT
                 :*          .*: :                  .             :  *  :.: 

SYGB_LACS1      ARLEDAKFFYEEDQ--------------------QHTIADYVERLKK--VMFHDKIGTIY
SYGB_LACPL      ARLEDAAFFYHEDQ--------------------QHSIQEYVERLKK--VSFHDKIGTMY
SYGB_LACDB      ARLDDAVFFYDEDR--------------------KYPISHFVDRMDS--VSFHDKIGSMA
SYGB_STRP3      ARLEDGEFFWREDQ--------------------KLQIADLVAKLTN--VTFHEKIGSLA
SYGB_STRP1      ARLEDGEFFWREDQ--------------------KLQIADLVAKLTN--VTFHEKIGSLA
SYGB_STRPN      ARLEDGEFFWREDQ--------------------KLVISDLVEKLNN--VTFHEKIGSLR
SYGB_STRR6      ARLEDGEFFWREDQ--------------------KLVISDLVEKLNN--VTFHEKIGSLR
SYGB_LACLA      ARLEDAEFFWKEDQ--------------------KLKIEDLVAKLAK--VTFHAKIGSIT
SYGB_BACHD      ARLSDAAFFYGEDQ--------------------KLNIDEANKRLDQ--IVYHEELGSIG
SYGB_BACSU      ARLSDASFFYKEDQ--------------------KLNIDANVKKLEN--IVFHEELGSLA
SYGB_FUSNN      ARLADARFFYYEDL--------------------KIPLDNNVEKLKT--VVFQKDLGTIY
SYGB_NEIMB      ARLSDAEFFYKQDQ--------------------KATLESRLPKLT--NVVYHNKIGSQA
SYGB_RALSO      PRLADARFFFEHDK--------------------KKPLADRVPQLA--RVVYHNKIGTQL
SYGB_ECOLI      PRLADAEFFFNTDR--------------------KKRLEDNLPRLQ--TVLFQQQLGTLR
SYGB_HAEIN      PRLTDAEFFFKTDL--------------------KQKLVDRLPRLE--TVLFQQQLGTLK
SYGB_VIBCH      PRLADAEFFFNTDR--------------------KRPLVDRLPLLE--NAIFQQQLGTIK
SYGB_XYLFA      PRFSDAKFFFNEDL--------------------KQGLKAMGERLR--TVTYHAKLGTLA
SYGB_RHILO      ARLSDALYFWTTDQGDLPDLGQLEASAEKFGLDLNKPLDQRMARLDHLNVTFHAKLGTQG
SYGB_BUCAP      ARLSDAMFFLKQDR--------------------KRKLENYLPFLKK--VSFYNNLGTLY
SYGB_BUCAI      ARLSDAEFFFKNDR--------------------KVKLESRLLSLKK--VLFQNNLGSLY
SYGB_BUCBP      AQFVDAEFFFKKDT--------------------KKKLIDYKPLLKK--IIFHDTLGTLL
SYGB_HELPY      ARLSDAVFFYENDL--------------------KKPLDN--APLES--VVFVQGLGTLK
SYGB_HELPJ      ARLSDAVFFYENDL--------------------KKPLDN--APLES--VVFVQGLGTLK
SYGB_RICFE      ARLSDALYFYKQDI--------------------AKTLESRLGKLEA--VTFHAKLGNLR
SYGB_RICBR      ARLSDALYFYKQDI--------------------SKTLEANLEKLAA--VTFHTKLGSLK
SYGB_RICPR      ARLADALYFYKNDI--------------------AKTLESRLDKLKS--VIFHTKLGSLK
SYGB_AQUAE      ARLEDALFFYREDL--------------------KKDLKSLIPELKK--VLFHPKVGSMY
SYGB_THEMA      ARLEDARYYFQKDL--------------------ETPLEKMNEKLKE--IVFQEKLGTLY
SYGB_SYNY3      ARLADAKFFYQADC--------------------DDSLDSYLPQLET--VTFQEELGTMR
SYG_CHLMU       PRLTDGNFLFKQDL--------------------LTSLDSFVEKLKS--VTYFDALGSLA
SYG_CHLTR       PRLTDGNFLFKQDL--------------------LTPLSSFVEKLKS--VTYFESLGSLA
SYG_CHLPN       PRLTDGEFLFKQDL--------------------QTPLTTFIEKLKS--VTYFEALGSLY
                .:: *. :    *                        :      :      :   :*.  

SYGB_LACS1      EKMERVNLLAKFLGNKLGLS-----ETELKDLDRASMIYKFDLVTGMVGE--FSELQGIM
SYGB_LACPL      EKMQRVMIISDFLADRFGLT-----ETEKNQLHRAAQIYKFDLVTGMVGE--FPELQGVM
SYGB_LACDB      EKMTRVRIIGDYLAKRFGLS-----AEEVADFDRVSGLYKFDLVTQMVGE--FAELQGVM
SYGB_STRP3      EHMDRTRVIAASLAKEANLS-----AEEVTAVDRAAQIYKFDLLTGMVGE--FDELQGIM
SYGB_STRP1      EHMDRTRVIAASLAKEANLS-----AEEVTAVDRAAQIYKFDLLTGMVGE--FDELQGIM
SYGB_STRPN      EHMIRTGQITVLLAEKASLS-----VDETVDLARAAAIYKFDLLTGMVGE--FDELQGIM
SYGB_STRR6      EHMIRTGQITVLLAEKAGLS-----VDETVDLARAAAIYKFDLLTGMVGE--FDELQGIM
SYGB_LACLA      EHMARTKEIAAKLADIAGLT-----DEEKRDVARSAEIYKFDLLTGMVGE--FDELQGVM
SYGB_BACHD      DKIKRVKVLAASIAEKLGVT-----SQTLQAINRVAEICKFDLVTQMVGE--FPELQGRM
SYGB_BACSU      DKVRRVTSIAEKLAVRLQAD-----EDTLKHVKRAAEISKFDLVTHMIYE--FPELQGIM
SYGB_FUSNN      NKVKRCEKIAEFLVGKLKYN-----YMK-EDILRTVKLAKADLVSNMINEKEFTKLQGFM
SYGB_NEIMB      ERIERLQSIAAHIAKALGA--------DAAAAERAARLAKADLVTEMVGE--FPELQGTM
SYGB_RALSO      ERVSRLQAIAGQLAEKLGA--------EVAHASRAALLAKADLLTDMVGE--FPELQGTM
SYGB_ECOLI      DKTDRIQALAGWIAEQIGA--------DVNHATRAGLLSKCDLMTNMVFE--FTDTQGVM
SYGB_HAEIN      DKTDRIEQLAGEIAKQIGA--------DEAKAKRAGLLSKCDLMTNMVFE--FTDTQGVM
SYGB_VIBCH      DKTDRITELAGYIAEQIGA--------DVEKSKRAGLLAKCDLMTSMVFE--FTDTQGVM
SYGB_XYLFA      DKVARVLVLAEAIAPQIGV--------DPLLARRVALLSKNDLQSRMVNE--FPELQGIA
SYGB_RHILO      ERVERIRRLAEELAPTVGA--------DPVLAARAAVLAKADLQTEVVGE--FPELQGAM
SYGB_BUCAP      EKTLRLKLLIESISCYTNTI-------NKNDLIRSAVLSKCDLITQMVDE--FPELQGTI
SYGB_BUCAI      EKTLRIKLLIKWIAKYSSS--------DVEDSIRAALLSKCDLVTDVVCE--FPELQGKI
SYGB_BUCBP      DKTHRIKKLITWISKFTHA--------NVNDCIRAADLSKCDLVTNMTFE--FPECQGII
SYGB_HELPY      DKMERESIIAQYLTQKYISSLNMPLEKALELVKRAVQIAKADLLSEVVYE--FSELQGIM
SYGB_HELPJ      DKMERESIIAQYLTQKYISSLSMPLEKALELISRAIQIAKADLLSEVVYE--FSELQGIM
SYGB_RICFE      EKVERVAKICSYTALD------------NTDLITAAKLCKSDLVSEMVGE--FPDLQGIM
SYGB_RICBR      EKVERITNICKYIDPD------------NKDLITAAKLCKSDLVSEMVGE--FPELQGIM
SYGB_RICPR      EKVDRITDICRYIAPD------------NIDLIMAAKLCKSDLVSDMVGE--FPDLQGIM
SYGB_AQUAE      EKEERMEKIAQKLCPLLKCEW--------EKVKEAVWLSKVDLLTEMVKE--LDELQGYM
SYGB_THEMA      DKVERIKKISQRLCEDLKLPGS-----FTQKVLEAASICKADIASKVVYE--FPELQGVM
SYGB_SYNY3      DKVDRIMEMAAAIADQLGVTE-----QQRGEIDSTAMLCKADLVTQMVYE--FPELQGIM
SYG_CHLMU       DKTARLKLHLEETYPLLPLCP-------KEDIDTAVHYCKADLVSAVVNE--FPELQGIM
SYG_CHLTR       DKTSRLKLHLEEAYALLPLCA-------KEDIDTAIHYCKADLVSSVVNE--FPELQGIM
SYG_CHLPN       DKVERLKAHQRVFSTFSSLAA-------SEDLDIAIQYCKADLVSAVVNE--FPELQGIM
                ::  *                                  * *: : :  *  : . **  

SYGB_LACS1      GEIYARLQGEDDNVSTAIREEYMPTSSEGELPQSNVGAVLSIADKLDSIQSFFAANMIPS
SYGB_LACPL      GDKYAVLKGEDPAVGQAIREHYMPISADGDLPKSKVGAVLAIADKVDSITSFFAVGLTPS
SYGB_LACDB      GMHYACLAGENENVSVAIKEHYMPTTAEGDLPKTKVGALLSVADKLDTIIAFFGAGMIPS
SYGB_STRP3      GEKYARLAGEDAAVATAIREHYLPDAAGGALPETKVGAVLALADKLDTLLSFFSVGLIPS
SYGB_STRP1      GEKYALLAGEDAAVATAIREHYLPDAAGGALPETKVGAVLALAAKLDTLLSFFSVGLIPS
SYGB_STRPN      GEKYTLLAGETPAVAAAIREHYMPTSAEGELPESKVGAVLAIADKLDTILSFFSVGLIPS
SYGB_STRR6      GEKYTLLAGETPAVAAAIREHYMPTSAEGELPESKVGAVLAIADKLDTILSFFSVGLIPS
SYGB_LACLA      GEKYALLAGENANVSAAIREHYMPTSAEGELPETKVGSVLAAADKIDSVLSFFNVGLIPS
SYGB_BACHD      GEVYAEIAGEPPEVAKGIVEHYLPRFAGDQSPSSVQGTVVSLADKLDTIAACFGIGLIPT
SYGB_BACSU      GEKYARMLGEDEAVAAAVNEHYMPRSAGGETPSTFTGAVVAMADKLDTIASFFSIGVIPT
SYGB_FUSNN      GENYALKAGEEIGVALGIKEHYYPRFQGDLLPSGIEGIIAGISDRIDTLVGCFGVGVIPT
SYGB_NEIMB      GKYYARLDGETEEITEAVEQHYQPRFAGDNLPEGKIAAAVALADKLETLVGIWGIGLIPT
SYGB_RALSO      GTYYARHDGEAEDVALACSEHYQPRFAGDALPGTATGTVVALADKLETLVGIWGIGLAPT
SYGB_ECOLI      GMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKMDTLAGIFGIGQHPK
SYGB_HAEIN      GMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVASAVALADKFDTLTGIFGIGQAPK
SYGB_VIBCH      GMHYARHDGEAEEVAVALNEQYMPRFAGDELPSRGVSAAVAMADKLDTIVGIFGIGQAPK
SYGB_XYLFA      GHHYALISGELPEVAMAIEDAYRPRFSGDEIARSPLGKVLGLAERLDTLACGFAVGMKPT
SYGB_RHILO      GRKYALLQGEHPSVAAAIEEHYKPQGPSDYVPSDPVSVAVALADKLDTLVGFWAIDEKPT
SYGB_BUCAP      GMYYALENKENKEVAIAIKEQYLPSFSGDELPSTPIGCLLSISDKIDTLSGMFAIGETPT
SYGB_BUCAI      GMYYALEDKEKKDVATALEEQYLPRFSGDKLPCTPIGCGLSIADKMDTLSGMFYIGNIPS
SYGB_BUCBP      GMYYALHDLEPKNIAIAIKEQYQPKFSKDNLPSNTISYSLALADKIDTLTGLFSINKNYN
SYGB_HELPY      GYYYALKQNENELVALSVKEQYLPASENAPLPSSVFSSIVALSLKLDSLFSLFSVGKIPS
SYGB_HELPJ      GYYYALKQNENELVALSVKEQYLPASENAPLPSSVFSSIVALSLKIDSLFSLFSVGKIPS
SYGB_RICFE      GYYYAKHEGLGEEVAAAIKDHYKPQGLSDNVP-GGNAALLALADKVDSLVGLMIAGEAPT
SYGB_RICBR      GYYYAKHENLNEEIAVAIRDHYKPQGLSDSVP-VGNAALLAIADKLDSLVGLMIAGEAPT
SYGB_RICPR      GYYYAKHEELNEEVAKAIRDHYKPQGLNDNVP-SGNATLLALADKLDSLVGLIIVGETPN
SYGB_AQUAE      GYVYAKAQGYDEEVAKALWEQYFPRSLEDKVPETTTGTILSLSDKIDNLYSFFKAGEIPK
SYGB_THEMA      GRIYALREGINEEIATAIEDHYS------EEPQTVIGSILGIADRIDTIVGNFAIGNVPT
SYGB_SYNY3      GEKYALVSGESAAVAQGIVEHYLPRHQDDDLPQGLPGQVVGMADRLDTLVSIFGLGLLPT
SYG_CHLMU       GRYYLQNAALSKAAAIAVGEHLQHITLGSSVS--TTGALLSILDRVDNLLSCFILGLLPT
SYG_CHLTR       GRYYLQNASLSRAAALAIGEHLQHITLGSSIS--TTGALLSILDRIDNLLSCFILGLLPT
SYG_CHLPN       GEYYLKHANLPTASAVAVGEHLRHITMGQKLS--TIGTLLSLLDRLDNLLACFILGLKPT
                *  *            .  :           .    .   .   :.:.:      .   .

SYGB_LACS1      -GSNDPYALRRQALGIIRIALDKGWDISLPLLHEAINYAYAEREDLYKNTQPI-------
SYGB_LACPL      -GSNDPFALRRQAFGIVRIVREQGWDFPIRQLEADIQKELVAHDATY-NLDFE-------
SYGB_LACDB      -SSNDPYALRRYAYGIVRILLNEDWSLPFDQVVPEIVELLSGKTPAK-LPQGA-------
SYGB_STRP3      -GSNDPYALRRATQGIVRILDHFGWRIPMDKLVDSLYDLSFD-------SLTY-------
SYGB_STRP1      -GSNDPYALRRATQGIVRILDHFGWRIPMDKLVDSLYDLSFD-------SLTY-------
SYGB_STRPN      -GSNDPYALRRATQGVVRILDAFGWHIAMDELIDSLYALKFD-------SLTY-------
SYGB_STRR6      -GSNDPYALRRATQGVVRILDAFGWHIAMDELIDSLYALKFD-------SLTY-------
SYGB_LACLA      -GSNDPYALRRAVQGLIRIIEKMNWHFDLSLFIDQFEG----------------------
SYGB_BACHD      -GSQDPYALRRQAAGVVQILLDHELDLDVDELLLETVEQLQEKELL--TVPES-------
SYGB_BACSU      -GSQDPYGLRRQASGIVAILLDRNWGISFEELL---------------TFVQT-------
SYGB_FUSNN      -GSKDPFALRRTALGIVNIIINANLDISLKDLVKVSLDALEEDK--VLKTDRA-------
SYGB_NEIMB      -GDKDPYALRRAALGILRMLMQ--YGLDVNELIQTAFNSFPQGLLNEKT-----------
SYGB_RALSO      -GEKDPFALRRHALGILRMLIEKPLALGIAEVLEAAAASFEGIAAVKPD-----------
SYGB_ECOLI      -GDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAVRLYGDKLTNANV-----------
SYGB_HAEIN      -GSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAALFGDKLTNQNV-----------
SYGB_VIBCH      -GS-DPFALRRASLGVLRILVEYGYQLDLVDLIAKAKSLFGDRLTNANV-----------
SYGB_XYLFA      -GNKDPFGLRRNALGLARTMIESRFDLDLKVLLDQASDWVAFATTIEQERHAQESVKQSK
SYGB_RHILO      -GSKDPYALRRAALGVVRILVEDRIQLRLSSIFASAGACYAGSGADQTR-----------
SYGB_BUCAP      -PEKDPFGLRRAALGILRIIITKKIPIDLKKIIEISLKIYTFKKVNYSII----------
SYGB_BUCAI      -SDKDPFALRRLAIGIIRIILEKNIPLNLEDLIKKSLSLYNKKNEDDLIL----------
SYGB_BUCBP      ISEKDPFSLRRLATGIMRIIIKKNIHINLYDLLEKSLKTYKKIN-NSDII----------
SYGB_HELPY      -GSKDPFALRRLSFGLLKIIAHYGLEFDLKADLK---NLFQKVGVYQSFD----------
SYGB_HELPJ      -GSKDPFALRRLSFGLLKIIAHYGLEFDLKADLK---NLFEKVGVYQSFD----------
SYGB_RICFE      -GSGDPYALRRQALGIIRIILENKLELNLNDLIIFSLKLYGNSAD---KD----------
SYGB_RICBR      -GSGDPYALRRQVLGIIRIIIENKLELNLNSLIDFSLKLYSSDKD---KD----------
SYGB_RICPR      -GSGDPYALRRQALGIIRIIIENKLEINFINLISFSVSLYKVSSNSH-LD----------
SYGB_AQUAE      -GSSDPYGLRRSAFGIIKIVDVKNLDLNLEDFKEIYGEFKQYPKLVE-------------
SYGB_THEMA      -SSKDPYGLKSKADTIFRIIRKNEWDISLEELLTFASSLVGYRLSEELET----------
SYGB_SYNY3      -GSSDPFALRRAANAVINVAWAASLEINLLELLTQGCRDFVTSHPDKTSP----------
SYG_CHLMU       -SSHDPYALRRQSLELLTLLYTTQSSVDIEDLFSRLVRHFPTTIPNTVWSPED-------
SYG_CHLTR       -SSHDPYALRRQSLEILTLLYTTQSSVDIEDLFARLIRHFPSSIPNTVWSPEA-------
SYG_CHLPN       -SSHDPYALRRQSLEVLTLVSASRLPIDLASLLDRLADHFPSTIEEKVWDKSK-------
                  . **:.*                 . .                               

SYGB_LACS1      -----------------TNVSETDSFVIDRLAQVLSGN-KFRRDILDAVVARA-------
SYGB_LACPL      -----------------KQTAPVADFLTDRVKQWFNNR-KIRYDIVDTVIKGS-------
SYGB_LACDB      -----------------EEDKQLADFIRDRIKQFLQKN-NYQYDVIDAVLASS-------
SYGB_STRP3      -----------------ANKADVMNFIRARVDKMMGK--AVPKDIREAVLESS-------
SYGB_STRP1      -----------------ANKADVMNFIRARVDKMMGK--AAPKDIREAILASS-------
SYGB_STRPN      -----------------ENKAEVMDFIKARVDKMMG---STPKDIKEAVLAGS-------
SYGB_STRR6      -----------------ENKAEVMDFIKARVDKMMG---STPKDIKEAVLAGS-------
SYGB_LACLA      -----------------ENHLEILDFVKARIQKLLLEK-LDRHDIVEAAINSS-------
SYGB_BACHD      -----------------EVVKQLREFFALRVKTKLQDE-GVRYDLTDAVLASG-------
SYGB_BACSU      -----------------DKENELLDFFTQRLKYVLNAE-QIRHDVIDAVLESS-------
SYGB_FUSNN      -----------------KVETDVLDFLKQRIINVFTDM-KYRKDVILAVLDKD-------
SYGB_NEIMB      -------------------PSETADFMQARLAVLLQND--YPQDIVAAVLAKQ-------
SYGB_RALSO      -------------------LAAITDFLYDRLRGYLKDK-GYSTNEVEAVVSQR-------
SYGB_ECOLI      -------------------VDDVIDFMLGRFRAWYQDE-GYTVDTIQAVLARR-------
SYGB_HAEIN      -------------------VADVVDFMLGRFRAWYQDE-GIAVDVIQAVLARR-------
SYGB_VIBCH      -------------------EQEVIEFMLGRFPTWYQDA-GFSIDIIQAVLARN-------
SYGB_XYLFA      KEAAVKHSVPQVSDEKSARIEELYDFIVERLRGYYADK-GIPTTHFNAVAELK-------
SYGB_RHILO      ---------------------DLLAFFHDRLKVYLRDQ-GARHDLIDAVITPQ-------
SYGB_BUCAP      -------------------SKKIIKFFISRLSFFYEKK-GYSTKVIKSVLSCK-------
SYGB_BUCAI      -------------------FDKMIKFFMIRLFHWYEET-GYSAKIIKSVLSCK-------
SYGB_BUCBP      -------------------LKKEIQFLFNRIYSIYDKN-KYNHSIIKSILENN-------
SYGB_HELPY      -------------------LEILEKFLLERFHNLID----CNPSIIRSVLNTN-------
SYGB_HELPJ      -------------------LEVLEKFLLERFHNLID----CNLSIIRSVLNTN-------
SYGB_RICFE      -------------------------LITSFFEERAKFY-FKNDYDIALINAAL-------
SYGB_RICBR      -------------------------LIISFFEERAKFY-FKNEYDISLINAVL-------
SYGB_RICPR      -------------------------SVISFFEERAKFY-FKNDYDITLINAVL-------
SYGB_AQUAE      --------------------------FLKQRLISYLED-YPVDIVRAVLNVYS-------
SYGB_THEMA      -------------------------FFAGRFYQFLINE-LGISFDVARAVNHL-------
SYGB_SYNY3      -------------------LQALKTFFLQRLQTLLQDEQGIDYDLVNAVLGNGETNCDEA
SYG_CHLMU       ------------------VLNKLCSFVWGRLKTILSSL-GFAKEVIAAVLTENCP-----
SYG_CHLTR       ------------------VLSKLNTFVWGRLRTILSSL-GFDKEVIATVLTDNCP-----
SYG_CHLPN       ------------------TIHEILEFIWGRLKTFMGSL-EFRKDEIAAVLIDSAT-----
                                          .                                 

SYGB_LACS1      ----DMPFIQALQAAQVLSKHAEDDNF----KEVIEALTRVTRLAKKAPE----FGSDAV
SYGB_LACPL      ----RQDIREMFKAADVLNAHQDDPQF----KDTIEAFTRLLRITAKAKL----AADDLT
SYGB_LACDB      ----EQDPSQILAAAKVLQQHHDDEAF----KPVVESLTRIANILKKAK-----FSQASP
SYGB_STRP3      ----TFVVPEMLAAAEALVKASHTENY----KPAVESLSRAFNLAEKAD-------ASVH
SYGB_STRP1      ----TFVVPEMLAAAEALVKASHTENY----KPAVESLSRAFNLAEKAD-------ASVQ
SYGB_STRPN      ----NFVVADMLEAASALVEVSKEEDF----KPSVESLSRAFNLAEKAE-------GVAT
SYGB_STRR6      ----NFVVADMLEAASALVEVSKEEDF----KPSVESLSRAFNLAEKAE-------GVAT
SYGB_LACLA      ----NFDITNMMESAFVIDGHKLHEPF----KPAIENVSRSINLVKKAK-------DIKE
SYGB_BACHD      ----ISNVPVVFKKAKLLVSKVNTPEF----KELVEGLSRVTNIAGKAE-------KNVA
SYGB_BACSU      ----ELEPYSALHKAQVLEQKLGAPGF----KETAEALGRVISISKKGV-------RG-D
SYGB_FUSNN      ----SDNITTALEIVKVITEKLSKDKM----QALLQVVKRVSNIMKGNK--------DVT
SYGB_NEIMB      ----PRRLDDLTAKLQAVAAFKQLPEA----AALAAANKRVQNLLKKAD-----AELGA-
SYGB_RALSO      ----PQRLDDIVARLEAVRAFAALPQA----EALAAANKRITNILKKTD-----ITIGS-
SYGB_ECOLI      ----PTRPADFDARMKAVSHFRTLDAA----AALAAANKRVSNILAKSD-----EVLSDR
SYGB_HAEIN      ----PTRPADFDARVRAVSHFRTLDSA----EALAAANKRVSNILAKAG-----AAIGE-
SYGB_VIBCH      ----PTKPADFDQRVKAVSHFRALEEA----EALAAANKRVGNILAKYD-----GELGEE
SYGB_XYLFA      ----PVSLYDFHRRLDAIGRFAALPEA----EALAVANKRIRNILRKAE-----IKIPAS
SYGB_RHILO      ----SDDLLQIVRRVEALGSFLDTEDG----KNLLAGTKRAANILAAEEKK--KTAVAKT
SYGB_BUCAP      ----LTEPLDIDKRINAISDLKKI-------ESIILIAKRIDNIVKNNH-----QIISSE
SYGB_BUCAI      ----SIELIDIHKKIQAISFFKKLKDS----QSIILSIKRISNILAKEK-----EKINGD
SYGB_BUCBP      ----TKILTNIDPKIKAITYVFKNHPKIL--QNLIITQKRVSNILKQFK-----ENISFN
SYGB_HELPY      ----ERDIVKIIQKVKALKRFLDDPKNAQKKELLFSAFKRLANINKDRN-----PNESSE
SYGB_HELPJ      ----ERDIVKIIQKVKALKRFLDNPKNAQKKELLFSAFKRLANINKDRN-----PNESSG
SYGB_RICFE      ----DLNLVDTKFKLDSLKEFLVEDAG----KQLLNAYKRASNIIDGQK-------ITGL
SYGB_RICBR      ----DLNLANIKFKLDALKEFLEKEDG----KQLLNAYKRASNILGSQN-------IDGA
SYGB_RICPR      ----DLNLVDTKFKLDTLKEFLVQDVG----KQLLNAYKRVSNIMGNQK-------ITGL
SYGB_AQUAE      ----PMEPYKVINSVRVLYEASKSPEF----PSVVEAAKRVIRIIPKDW-------KNYE
SYGB_THEMA      ----WKKPLRGILSAEALQEISEKPEF----QDLFVGFERV-HNITKNH-------DSTK
SYGB_SYNY3      QSRLHDRLLADLQDVKERAQYLQELRDNGHLDAIYPTVNRSAKLASKGTLPTDQLDPRPV
SYG_CHLMU       -----KNPLTIINSARSIQELQ--NTQTL--ETIASTHNRLKKILASLS--------FSV
SYG_CHLTR       -----KNPLTIIQSAQSIQELK--NTQIL--KTIAAMYNRLKKILASLS--------FSV
SYG_CHLPN       -----KNPIEILDTAEALQLLKEEHTEKL--AVITTTHNRLKKILSSLK--------LSM
                                                       *                    

SYGB_LACS1      IDSTLFENDTEKVLADEFAKVEAGYGDA----EMNEKFTILSSLKDSITAYFD---ATMI
SYGB_LACPL      VDPSLFENEAEQHLYDAVLELQKQFTPAM---SMEDRFKALAALRPLIVDYFE---QTMV
SYGB_LACDB      VDPSLFEDRSEQDLYDGVEALANVKDHA-------ELYEAFVALQGVIDRYFD---VNMI
SYGB_STRP3      VDPSLFENEQENTLFAAIQGL----TLAG---SAAQQLEQVFVLSPVINDFFD---NTMV
SYGB_STRP1      VDPSLFENEQENTLFAAIQGL----TLAG---SAAQQLEQVFALSPVINDFFD---NTMV
SYGB_STRPN      VDSALFENDQEKALAEAVETL----ILSG---PASQQLKQLFALSPVIDAFFE---NTMV
SYGB_STRR6      VDSALFENDQEKALAEAVETL----VLSG---PASQQLKQLFALSPVIDAFFE---NTMV
SYGB_LACLA      INPTLFEEDAEEALYNVVISLQNQWTYMP---GEEKFRAIVHSLAPAIETFFE---SVMV
SYGB_BACHD      INPDLFEKEEERVLYEAYVQTKDLVQGALASGDVSAAYAALEQTIEPIHQYFE---HVMV
SYGB_BACSU      IQPDLFENEYEAKLFDAYQTAKQNLQENFSKKDYEAALASLAALKEPIDAYFD---HTMV
SYGB_FUSNN      IKEKLFKTDIEKTLYAESKKVESEVEQAIKEKEYADYFEKLFTLVPTIDKYFE---TVIV
SYGB_NEIMB      VNESLLQQDEEKALFAAAQGLQPKIAAAVAEGNFQTALSELASVKPQVDAFFD---GVMV
SYGB_RALSO      VQPQLLREDAERALHQAVATSEPHVHDAFARGDFTTALKTLASLREAVDSFFD---GVMV
SYGB_ECOLI      VNASTLKEPEEIKLAMQVVVLRDKLEPYFTEGRYQDALVELAELREPVDAFFD---KVMV
SYGB_HAEIN      INLTACVEPAEKALAEAVLALRTEVQPLIAQGDYTTVLDKLANLRAPVDSFFD---NVMV
SYGB_VIBCH      IDLALLQEDAEKALAEAVEIMAEALEPAFATGNYQEALSKLAGLRAPVDAFFD---NVMV
SYGB_XYLFA      VDATLFDQPAESGLLVALEGVITDTRSALDCKNYVSVLTCLARLRPPIDEFFD---KVMV
SYGB_RHILO      VEPALFKENAEKSLFAAVNQAEKQAGEAIQNEDFSAAMLALSALREPVDSFFE---GVLV
SYGB_BUCAP      IHVELMKKTEEKNLLKEIKIFNSKTKELFIQKKYKEILVEIKKLEKPIDNFFD---KVQI
SYGB_BUCAI      INKKLMIEKEEIILFNNIEEFDNYTKNLFLEKKYNDILIKIKSFENPIYNFFK---KVKI
SYGB_BUCBP      INMKTLEQIEEIKLIEQLNIIEKKYKHPFSKETYISMMLTLNSFCQLIHEFFN---KVMI
SYGB_HELPY      FSTNLFKEPKEHALFEAFNAIKMNAFESLDSK-----IEAYFGLHAPLEEYFK---SVLV
SYGB_HELPJ      FSTSLFKELQEHALFEAFNAIKTSTFESLDSK-----IEAYFGLHAPLEEYFK---SVLV
SYGB_RICFE      VDASLFSTQPEKELFEVMQKISPQVTSSISDKDYNKALNLLSFLLTPITSFFD---NVLV
SYGB_RICBR      VEPSLFNTQPEKELFEVTQKLSLQ----IVDKDYDKALNLLQTLLTPITSFFD---NVLV
SYGB_RICPR      VDASLFSTQYEKELFEVIQKISQQIIVIIANKDYQKALNLLSSLLKPITSFFD---NVLV
SYGB_AQUAE      VDEKLLSEEAERELYQKLTEFENKELKSPLEL---------LPLKEYIDKFFD---NVKV
SYGB_THEMA      FDGALFEKEEEKKLMNKFYEVKEKVLKALERLNYREALQYLIELKPYIDEYFD---NVFV
SYGB_SYNY3      IQAPQLVQDSEKAVYQALLAIYPKAVEVQESRDYETLVNALHELAPTVAEFFDGPDSVLV
SYG_CHLMU       TEQIFSLITSEDMLFKQALERFKEATTSLPISS-REYLLQLEDLSQSTALFLD---SVRI
SYG_CHLTR       TEQMFSLQSAEDLLFKQALDRFVEETTALPISS-KDYLHLLKELAQSTELFLD---SVRV
SYG_CHLPN       TSSPIEVLGDRESNFKQVLDAFPGFPKETSAHAFLEYFLSLADLSNDIQDFLN---TVHI
                          .                                       ::.      :

SYGB_LACS1      MADDEKVKNNRLLQLVKIAELTEDFGSLDKLIVK---
SYGB_LACPL      MSKDEKVRDNHLKQLLTIAQMINVMGDLNQLIVK---
SYGB_LACDB      MAKDEAVKNNRLSQLAAVNDLAKRLGDLSKLVIK---
SYGB_STRP3      MAEDQALKNNRLAILSDLVSKAKTIAAFNQLNTK---
SYGB_STRP1      MAGDQALKNNRLAILSDLVSKAKTIVAFNQLNTK---
SYGB_STRPN      MAEDQAVRQNRLAILSQLTKKAAKFACFNQINTK---
SYGB_STRR6      MAEDQAVRQNRLAILSQLTKKAAKFACFNQINTK---
SYGB_LACLA      MAEDLSVRDNRIALLSEVVALTSVMADFSLINTK---
SYGB_BACHD      MVDEQVIKENRLALMHAFAGVIGSYANFQEIVFK---
SYGB_BACSU      IADNESLKANRLAQMVSLADEIKSFANMNALIVK---
SYGB_FUSNN      MDEDKNVRDNRIGQLTYIMNLFEKIAYLNKLD-----
SYGB_NEIMB      MAEDAAVKQNRLNLLNRLAEQMNAVADIALLGE----
SYGB_RALSO      MADDTALRDNRLALLGELHGLMNRVADISKLAA----
SYGB_ECOLI      MVDDKELRINRLTMLEKLRELFLRVADISLLQ-----
SYGB_HAEIN      NAEDPALRQNRLAILNTLQGLFLQVADISVLQ-----
SYGB_VIBCH      MADDEALKKNRLTLLNKLRNLFLQIADISLLQK----
SYGB_XYLFA      NDENLMLRANRLALLQRLGEYLCCVAAIEHLSN----
SYGB_RHILO      NDEDLEVRANRLALLTRIRAATGQVADFSKIAG----
SYGB_BUCAP      NHSNFEIRQNRLLLLIKIQKFFLKIANFSYLY-----
SYGB_BUCAI      YHSDSKIRLNRLLLLSKLKKIFFKIADFSYLY-----
SYGB_BUCBP      NHKIVSIKNNRLAILFKIQNLFFTISNFSNININITI
SYGB_HELPY      MDKDIEIQKNRKNFLWGVYQSFLEIGDIKEIAI----
SYGB_HELPJ      MDKDIEIQKNRKNFLWGVYQSFLEIGDIKEIAI----
SYGB_RICFE      NDPDPKIAENRLSLLHNICELFDKVAKFCRL------
SYGB_RICBR      NDSDPKIAKNRLLILQDVCKLFHKIAKFNRL------
SYGB_RICPR      NDSDPKIAQNRLSLLQNTCEVFDKVAKFCRL------
SYGB_AQUAE      MAEDEKIRNNRISLLKRVENLFRTFGDFNEIVIKEG-
SYGB_THEMA      MVKRDDLRVNRLSFLKNIDELFMMVGDMTYLVKRSQV
SYGB_SYNY3      MAENDELRQNRLNLLGLIRNYALILGDFGAIVKGI--
SYG_CHLMU       ADDDENIRNQRIALLVATQKCFGFYAWDAL-------
SYG_CHLTR       ASDDESTRNQRIALLIAAQKCFGFYAWGVL-------
SYG_CHLPN       ANDDGAIRNLRISLLLTAMDKFSLCHWESVAV-----
                          :   :